[Godzik Lab] [AIDA Server]

Single-Domain Protein Structure Prediction Result by FFAS-3D


  Domain Architechture

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
1234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123
primarysequence        MPELSPLTYGHTDARLILRVGGSMGDVYGQRLLKRDLNGYILNEEGVGLAMENKETYLGSILPKMNMGWSLGFGYKGVNLGMTFTGRFGGIVISETQSVLDAAGVSKVSADVRDAGGVQINQSKVSAQTYYQTIQGTAAYYTYSATNVRLGELSLSYTLPKKWFDNKVGMTVGLVGKNLWMIYCKAPFDPELTTSAASNFYQGFDAYMLPSTRNFGFNVKFQF
secondarystructureCCCCCEEEEECCCEEEEEEECEEECEEEEEEEEEECCCCCEEEECCCEEECCCCCEEECCCCCCEEEEEEEEEEECCEEEEEEEEEEECCEEEEHHHHHHHHCCCCCEECCEECCCCEEECCEEECCCCCCCCCCCCEEEEEEECCEEEECCEEEEEECCHHHHCCCCCEEEEEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEECCCCCCCEEEEEEEEEEC
confidencescore9851034660544199999381400699889967779972998099813218984397467865479657527991938999994996259955427878713841000000026845402124313232210234424469839268872179887719023279454699999976279828788994433346886231031478996328999999989
Dom IDPDB hitZ-score
1.3syb_A-14.100-----GGNYKPLDGLEISLYGSHFQDVWNQYYLGVTENGIALRTAFNGYHTGDTGAREAGYIDNDTWSLAFTLGHRAHALTLAYQQVDGNSAQIRYETDWSYYGVPGLSTGVWYVKGWDIDGTHYDGDRNGAYGNYAEVRAQDGEKHHEL-GLMAAYKVQN---GPIKDSTFKLTYMM---------HKASQNQIDGS-------------VNELRLVSTFPF

  Assembled Model

Download Assembled Model