[Godzik Lab] [AIDA Server]

Automated Multiple-Domain Protein Structure Prediction by FFAS-3D and AIDA

Click 2013.May.18.32034.tar.gz to download the assembly result and individual domain structures.


  Domain Architechture

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550----
12345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234
primarysequence        MRSKFLFLCLFLFGMLTACKDTKWVDVPTGTPPEGSVTGKPGETEEPDDPDPTDKTFINCSYIRGDFFETNRISGASMGACNDLIYLTARPYADGDLTFDLPVNDATLTGAATYAASYNGRNGVLKLDGTGKMNAGDGLLHSPDGAFKKFTFGTYIYVSEWVDGACLFKKVDGGSVVIAFQLGATEGNLKLTVGSATATVTNSALKSGAWHYVAVTYDGGAAKLYIDTNNTATDFTGSLPASVPNTRADFVMGENLKGYLDETFVNSLLMGTLGRNPISFDNWNNTKTLAYWKYDDAAKPGKDSHTWAIRLEQIRTALNGQAGDRKIRLGIAGGEWLKMVGNATARTNFANNVKKVIEQYNLDGADLDFEWAYSGTDLSNYSKAIVQLREVLGKDVFLTVSLHPVSYKISAEAIAAVDFISLQCYGPSVELFSMERFKSDGKAAVDYGIPQDKLVMGVPFYGTTGTAGEQAAYFDLVGKGNLTNTSADTWSYEGKNYTLNSQNTIRQKTQYVCENGFGGIMSWDLATDVDVTHEMSLLKAVKEELDYYANPTVE
secondarystructureCCCCHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCHHHCCCCCEEEEEEEECCCCCEEEECCCCCEEECCCEEEEECCCCCCEEEEECEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEEECCEEEEEEECCCCEEEEEECCCCCCCEEEEECCEEEEEECCCCEECCEEEEEEEECCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCCCCCCCCCC
confidencescore97420357787561000125674034699999987232256220179999976501378641047413349778010202583799985538993156542479635329604540159910279971145200236444599765642269999999544345199974279942999983997770799986714898847510025399999642871199998115456678854875676676301013356766854400100112587763456667743100000269999999902489999999999984339963999983897001028978899999999999998399827653026999868678999999999981997189999668753220888400848998212699999996670389999999499999738831023123689998643122347865566421132049759975999999999999992986599998128989999702799999871999999989
Dom IDPDB hitZ-score
1.1js1_X-9.380-------VPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNDDVIESP                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
2.3aro_A-103.000                                                                                                      -NNLQFSKIELAMETTSGYNDMVKYHELAKIKVKFNQWSGTSGD----------TYNVYFDGVKVATGAITGSQTTASFEYGQGGLYQMEIEACDATGCSKSAPVEITIADTDGSHLKPLTMNVDPNNKSYNTDPSIVMGTYFVEWGIYGRDYTVDNMPVDNLTHILYGFIPIDYEVVIHDPWAAYQKSFPQAGHEYSTP-----IKGNYAMLMALKQRNPDLKIIPSIGGWTLSDDFVDKKNRDTFVASVKKFLKTWKFDGVDIDWEFPGGVNDGPAYIALMRELRVMLGRTYELTSAIGVGYDKIEADAVQYMDYIFAMTYDFYGGWNNVPGHDNGIQLLLAQGVPANKLVLGTAMYGRGWEGAQGVWEDGVIDYKGYDAQAEAPWVWNRSLITFDDHRSVLAKGNYAKSLGLAGLFSWEIDADN-----GDILNAMHEGMAGGVVTPPN

  Assembled Model

Download Assembled Model

  2 Domain Structures on the 1st Level

Download Domain 1 Download Domain 2