current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: TM0013 TM0013 281894 Purified-2001-08-24, from JCSG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MFENEILFDNGQHKFMFLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVAEVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKIYISSLWVRFLPHFGIYDQKRIVPISDKGTKIKLLSGNELEILPAHFLHSTGNFVLYDPVAKILFSGDIGAAVFEKGKRYRYVDDFERHLPLMEAFHKRYMSSNAACKKWVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNLKCGVDLIDNLYSLLast
1 -75.4004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  14  14IATNTKVLRARSWSRLRFEIEYALERGTTSNSYVIEG-DKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAGDLRAAFPDD-NLNILPMRGKETLDLGKGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDNWE-SFKEDQRYYFNCLMAPHAIHVEAALEKISDLQVRLYAVGHGPLVR-TSLIALTQAYADWSK........... 251
2 -71.6002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  19  13MIPGVYWVGIVDWMVRIFHG-YHTDEGSSYNSYFIDD-ECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGME-KATWLIVDDKYTLKI-GKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSKGTVVLDSMYG. 268
3 -69.3001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  17  6IIDGFHLVGAIDWNSRDFHGYTLSPMGTTYNAYLVED-EKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHYK-DWPVQVVKHGETLSL-GKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLEAMREYYANIVNPYAPQTLKAIETLVGVAPEFICPDHGVIFRGDQCTFAVQKYVEYAEQVIFYDSMWH. 264
4 -68.5001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  17  10......IYWVGAVDWYFHGPAFSTHRGTTYNAYLIVD-DKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHI-DFNYTIVKTGTSVSL-GKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMEAAKYYANILMPFSNLITKKLDEIQNLAIKTIAPSHGIIWRKD-PGRIIEAYARWAEGVIAYDTMWL. 263
5 -67.7002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  18  12......VYWTGVLDWDLRNYHGYTLQGTTYNAYLVCGDEGVALIDNSYPGTFDELMARVEDAVGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLKHYPSLREAEFMTVKTGDVLDL-GGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMAARKFYANLITPLSKLVLKKFDEVKELGIQMIAPSHGQIWTD--PMKIIEAYTGWATGTVIYDTMHG. 268
6 -64.4004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  17  9......IHWVGQRDWDFHGTEYKTLRGSSYNSYLIRE-EKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGPE-----WNFNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFQCQRYYANILTPFSRLVTPKITEILGLPVDMIATSHGVVWRDN-PTQIVELYLKWAADTIFYDTMSN. 259
7 -63.4001vme_A mol:protein length:410 Flavoprotein  ali model follow..  17  17DDPEIYVLRIDDDRIRYFEAVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIHDVEIIASNFGKRLLEGFYGIKD---VTVVKDGEEREI-GGKKFKFVMTPWLHWPDTMVTY--LDGILFSCDVGGGYLLPEILDDSNESVVERYHVTKYIVTVIGHYKNYILEGAEKLSSLKIKALLPGHGLIWKKD-PQRLLNHYVSVAKGTVIYDSMYG. 271
8 -39.4002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  17  35............................QVPVFLLRLGEASALVEGGISRDAELVWADLCRWADPSQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAWKSESAVRDALPVRAVADGEWLELGPRHRLQVIEAH--HSDDHVVFYDVRRRRLFCGDALGEFDEAEGVWRPLVFDDM----------------EAYLESLERLQRLPLLQLIPGHGGLLRGRLAADGAE.................. 249
9 -33.1003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  13  20.............................ATVYVMCGEKLTVMIDAGVS-------NSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQV-YKAKVLVKSGFKKYLTS--KKLDQDKVIEVEGNEEFDL-GGYRMRLIYTP--HARHHMSVLV--DDFLFTGDSAGAYFNGVVIPTTPPVIDY----------------KMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMLSK............. 226
10 -32.8005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  16  24..GEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKA--GVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTS------------------VERIQKHEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRS......... 245
11 -32.7003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  16  2VKDFVIEPPIKNNLHIYKTFGVFGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNN--KGIKTYATAKTNEFLKKDGKATSTEII---KTGKPYRI-GGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYS----------------KATLIIPGHDEWKGGGHVEHTLELLNK.............. 218
12 -32.4001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  12  1...DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKI--GAKTYSTKMTDSILAKENKPRAQYTF---DNNKSFKV-GKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFS----------------GAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQ......... 219
13 -32.0002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  16  9..GTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKER--GIKAHSTALTAELAKKNGYEEPLGDL---QTVTNLKF-GNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYR----------------NINAVVPGHGEVGDKGLLLHTLDLLK............... 222
14 -31.8002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  15  15..GTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKER--GIKAHSTALTAELAKKNGYEEPLGDL---QTVTNLKF-GNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRY----------------RNINAVVPGHGEVGDKGLLLHTLDLLK............... 228
15 -31.1003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  15  9..GTISISQLNKNVWVHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKER--GIKAHSTALTAELAKKNGYEEPLGDL---QTVTNLKF-GNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRY----------------RNINAVVPSHGEVGDKGLLLHTLDLLK............... 222
16 -31.1004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  16  42..GEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEWPTS------------------VERIQKHEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRS......... 263
17 -30.9002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  14  41..GEVRLYKIGDGVWSHIATQKLGDTVYSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAA--GVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVVRFGPVEVFYPGA---HSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEWPAT------------------IKRIQQREAEVVIPGHGLPGGLELLQHTTNVVKTHKVRP......... 262
18 -30.8004tyf_A mol:protein length:231 NDM-4  ali model follow..  14  8..GDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGLVAAQHSLTFAANEPATAPNFG-PLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF-----------------KASMIVMSHSAPDSRAAITHTARMADKLR............ 231
19 -30.7002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  15  42..GEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRA--AGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTS------------------IERIQQHEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRS......... 263
20 -30.7003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  13  14..GDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAANEPATAPFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF-----------------KASMIVMSHSAPDSRAAITHTARMADKLR............ 237
21 -30.6001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  13  9..DDISITQLSDKVYTYVSLAEIEGWGVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQR--KGVQSYANQMTIDLAKEKGLPVPEHGF---TDSLTVSL-DGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKF-----------------SARYVVPGHGNYGGTELIEHTKQIVNQYIEST......... 229
22 -30.5001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  13  9..DDISITQLSDKVYTYVSLAEIEGWGVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQK--KGVQSYANQMTIDLAKEKGLPVPEHGF---TDSLTVSL-DGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKF-----------------SARYVVPGHGDYGGTELIEHTKQIVNQYIEST......... 229
23 -30.3002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  18  5..KPLEVIKIEDGVYLHTSFKNIEGYGVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNS--KSIPTYTSELTKKLLAREGKPVPTHYF----KDDEFTL-GNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKK----------------YPIQMVVPGHGKVGSSDILDHTIDLAESASNKL......... 223
24 -30.2004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  14  26.....................VTDRDFYSSNVLVAKMLDTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKM--GAETWSSDLTKQLRLEENKKDRIKAAEFYKQGKVFSF-SNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCM---IKPKELGYLGDANVKAWPDS------------------ARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL....... 250
25 -29.8004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  13  20..GDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAANEPATAPFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAF-----------------KASMIVMSHSAPDSRAAITHTARMADKLR............ 243
26 -29.7005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  14  20..GDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAANEPATAPNFG-PLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF-----------------KASMIVMSHSAPDSRAAITHTARMADKLRL........... 244
27 -29.7004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  13  23..GDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAANEPATAPFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF-----------------KASMIVMSHSAPDSRAAITHTARMADKLR............ 246
28 -29.6003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  13  21..GDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAANEPATAPFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF-----------------KASMIVMSHSAPDSRAAITHTARMADKLRKLV......... 247
29 -29.4005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  21  48...........................VDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNS--KSIPTYTSELTKKLLAREGKPVPTHYF----KDDEFTL-GNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNI----------------VSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKL......... 240
30 -29.4004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  15  5..PELRIEKVKENIFLHTSYSRVNGFGVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRKNG-YELLGSVSTHWHEDRTAGIKWLNDQ--SISTYATTSTNHLLKENKKEPAK----YTLKGNESTL-VDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRY-----------------EAQIVIPGHGKIGDIALLKHTKSLAETASNKS......... 223
31 -29.0004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  19  5..PDLKIEKLDEGVYVHTSFEEVNGWGVPKHGLVVLVNAEAYLIDTFTAKDTEKLVTWFVER---YKIKGSISSHFHSDSTGGIEWLNSR--SIPTYASELTNELLKKDGKVQATNSF----SGVNYWL-VKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYG-------------------KAKLVVPSHSEVGDASLLKLTLEQAVKGLNES......... 220
32 -29.0004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  19  6..PDLKIEKLEEGVYVHTSFEEVNGWGVSKHGLVVLVNTDAYLIDTPTATDTEKLVNWFVER---YKIKGTISSHFHSDSTGGIEWLNSQ--SIPTYASELTNELLKKDGKVQAKNSF----SGVSYWL-VKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCF---VKPDGLGNLGDANLEAWPKSAKILMSKY----------------VKAKLVVSSHSEIGDASLLKRTWEQAVKGLNES......... 221
33 -28.9004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  14  47..GDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAANEPATAPNFG-PLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF-----------------KASMIVMSHSAPDSRAAITHTARMADKLR............ 270
34 -28.7003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  12  18.....................VEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTL--GAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCI----LKENLGNMSFANRTEYPKTLEKLKGLI------------EQGELKVDSIIAGHDTPIHDGLIDHYLTLLEKAP............ 232
35 -27.3004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  11  58.............................ISALLVTSDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVLSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRTDANIVTLADDGVVSV-GPLALTAVASP--HTPGGTSWTGDDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAA--------------FRNTLARVAALDCDILVTPHPPLMDTTACRRYAQGARQ.............. 283
36 -27.2001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  14  15.....................VEDNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSI--GAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPLLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCIL-------------------------KEKLGNLSFADVKAYPQTLERLPIKTVIGGHDSPLHGELIDHYEALIKAAP............ 225
37 -27.1001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  15  37............................DLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARVTPRDLRLILLSHAHADHAGPVAELKRRT-GAKVAANAESAVLLARGGSDDLHNADRIVMDGEVITV-GGIVFTAHFMA--HTPGSTAWTWTDTRIAYADSLSAPGYQLQGNPRYPHLIEDYRRS------------------FATVRALPCDVLLTPHPG.............................. 227
38 -27.1004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  11  58.............................ISALLVTSDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVFSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRTDANIVTLADDGVVSV-GPLALTAVASP--HTPGGTSWTGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAA--------------FRNTLARVAALDCDILVTPHPPLMDTTACRRYAQGARQ.............. 283
39 -27.0005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  13  30............................GLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALFRIEDVKLILNSHGHIDHAGGLAELQRRS-NALVAASPSAALDLASGEVGPDDPQYRLARDGGQFNV-GPVYLTAHATP--HTPGGLSWTWQSCDMVYADSINAVSRPGFKFSASSE---------------YPNALADLRHSFETLEKLPCDVLISAHPEA............................. 226
40 -26.5001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  13  24............................DLASYLIVTPRGNILINSDLEANVPMIKASIKKLFKFSDTKILLISHAHFDHAAGSELIKQQT-KAKYMVMDEDVSVILSGGKSDFHTVDKVLHDGERVEL-GGTVLTAHLTP--HTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAEDY-----------KHSIKVLESMRCDIFLGSHAGM............................. 218
41 -26.5003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  14  25............................GISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMFKLSDVKYILSTHSHEDHAGGISAMQKLT-GATVLAGAANVDTLRTGVSPKSDPQFRAVADGELVKL-GPLAVKAHATP--HTEGGITWTWQSCEQGKCKDVADSLTAVSADSYRFSDHPEVVAS--------------LRGSFEAVEKLSCDIAIAAHPEV............................. 218
42 -26.5003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  14  54............................GIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLFKVADIKLILNTHAHLDHTGGFAEIKKET-GAQLVAGERDKPLLEGGYYPGDEKVDRAVKEGDRVTL-GDTTLTAHATP--HSPGCTSWEMTVKEVLFFCSGTVALNRLVGQPTYAGIVDDYRAT------------------FAKAKAMKIDVLLGPHPPFIKPGELVTYATSLSE.............. 278
43 -25.9005aeb_A mol:protein length:272 LRA-12  ali model follow..  13  36...........................YDLACYLITTKQGNIIVNTGLAASALQIKNNIKALFKLTDTKILLTTQAHYDHLGAMAEIKKIT-GAKLMADEGDATVMADGGSSDYAIADRLLHDKDTIQL-GDTKLVMLHHP--HTKGSCSFLFDTKRILIANMPTIVIEKKFSE-----------------VSSYPGIAKDYAYTLQAMKNLSFDIWVASHA............................... 228
44 -25.5002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  13  16.....................FNPARNIDFNGFAWIRPEGNILIDPVALS------HDWKHLESLGGVVWIVLTNS--DHVRSAKEIADQT-YTKIAGPVAEKENFP-------IYCDRWLSDGDELVPG----LKVMELQGSKTPGELALLLE-ETTLITGDLV---------------RAYRAGGLEILPDEKLMNKQKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKELVATLA............ 201
45 -25.0002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  13  21............................TVNLYLLQGAGEVALVDTATRAARGALELHLAELLCFQDVKTILLTHHHPDHYGLSGFFEGL--GARVFLHEEEFARGHRFWREPEAQNPLPLRDGEALEV-AGKRLRVLWTP--HADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRS---------------LDRLADLGARVAYAGHFGPIADARLEALLALLDGPKTAWELSLHLFP. 277
46 -24.4001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  16  27...........................HFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELISPDDITDVLFTHVHLDHIFNSVLF----ENATFYVHEVYKTKNYLSFGTIVGRIYSISSWKNVVLLKGEESVKVFHTP--HAREHLSFLENAGRVLITGDITPN-------------------RLSYYDIIKGYGSVQVKNFLDRVGRID--LLVFPHDAPLKPE......................... 212
47 -23.9004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  17  66...........................GGAEAALEEAARGPILVDTGGPWAREALLGALAGQVAPGDVTLVVGTHGHSDHIGNLGLF----PGAALLVSHDFCLPGGRYLPHG-------LGEGQPLRLGPG--LEVWATP--HGGQRDVSVTALGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV-------------------ADVVVPGHGPPFR........................... 236
48 -22.0004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  19  32.............................TNTYLVGTGPRRILIDTGEPAI-PEYISCLKQALTEFAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTP--HTDDHMALLLEEENAIFSGD-----------------------CILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAKIQQYISHRNIREQQIELVKIIYK. 248
49 -21.0002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  17  11...........................LQENAYLVETGEGPVLIDPGDEP--EKLLALFQTT----IPLAILLTHAHFDHVGAVAPLVEAL-DLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLPVRPLEEFGFQVLHLP--HSPGHVAFYDPEGAQVFSGDL-------------------LFRGSVGRYDLPGADPKALFASLKRLLSLPPETVHPGHGPLGLEARTNPFLTGLE............... 204
50 -19.5005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  14  44............................HINLWLLRDEIDGTIVDCGSEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGDNVRLWMTLGEYMFGCLMAAGNGSNAYRRLREGDAVKI-GARTWRVVTGY--HSPEHCALHSEADGVLISGDVLPRISTNVSVFDLEPEANPLALYLES---------------LGRYETMAPDLVLPSHGKPFRGTRIAQLRAHHDA.............. 291
51 -19.4002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  15  29...............................SLLLKKGNKEIVVDTGQSENFIKNCGLMG--IDVGRIKKVVLTHGHYDHIGGLKGLLERNPEVKIYTHKEI--LNKKYAMRKGGQFEEIGFDLSFYEKYKNNFVKRIPDKFLD-EVFVVVKEEDGINVVTGCSHAGILNILETARNRFGVSYIKSLIGGFH-LRGMEEEKVKDIARKIEEYGVKKVLTGHGIDEYGFLKSVLKDKISYLTTSSSI....... 276
52 -18.4004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  18  56...........................TSINAFLVNIGKSLILIDSGAASCFGSHLGSVLSNLQPEQVDTILLTHLHPDHVCGISK-VANFPNATVYVSNDEASFYLGTVEKIKQAIAPYQAKQRFKTYKLGDDIQGFKV---HTPGSYELKTKGESIVFIGDIVHSHTVQFDRPETAIEYDIDPKKAVETRLKQFANFAKNGQTI-----AAPHLPFPGIGHTYSAD......................... 278
53 -18.1002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  10  41...........................IPVSAYLIQCTDATVLYDTGCHPECCNLPERLRQLLSPDDISTVVLSHLHNDHAGCVEYF----GKSRLIAHEDEFATIEAWLATPRNWDLVGRDERERELAPGVNLLNFGTG---HASGMLGLAVRLEKFLLVSDACTNYGPPARRAGVLHDTIGYDRTVS---------------HIRQYAESRSLTVLFGHDR.............................. 261
54 -17.8003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  11  21...............VFWNRGPGGEVRFPVYSILIEHAEGRFLIDTG-QEKHQTIPGALGLLLEPRDIDVVVNSHFHFDHCGGNKYF----PHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATGVKLISTP--HSIGHYSLLVEFPRILFTIDAAYTQKSLETLCQAAFHIDPVAGVNS-------------MRKVKKLAEDHGAELMYSHDM-----------DNFKTYRTGTQFYG..... 268
55 -17.5003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  16  21...........DHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGKMTEEDRIVNILKRVYEPDDLLYIISSHLHFDHAGGNGAF----TNTPIIVQRTEYEAALHYMKECILPHLNYKIIEGDYEVVPGVQLLYTPG---HSPGHQSLFIETEQVLLTIDA----------SYTKENFEDEVPFAGFDPELALSS----IKRLKEVVKKEKPIIFFGHDI.............................. 241
56 -17.4002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  17  35...........................LPVWCYLLETEEGPILVDTGKMTEEDRIVNILKRVYEPDDLLYIISSHLHFDHAGGNGAF----TNTPIIVQRTEYEAALHYMKECILPHLNYKIIEGDYEVVPGVQLLYTPG---HSPGHQSLFIKTEQVLLTIDA----------SYTKENFEDEVPFAGFDPELALSS----IKRLKEVVKKEKPIIFFGHDI.............................. 239
57 -17.4004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  16  87...........................TAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLQPEQVDTVLLTHLHPDHACGLVN-SPAYPNATVEVPQAEAEFMQGMFKMARQAVAPYAKMNKLKPYKTEGEVSLVASS--HTPGSYLFKSGGQSLLVWGDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILA-----EAATDKLWVAGAHLPFPGLGHVREEAQGYAWV................... 313
58 -17.2004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  18  87...........................TAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLQPEQVDTVLLTHLHPDHACGLVN-SPAYPNATVEVPQAEAEFMQGMFKMAQQAVAPYAKMNKLKPYKTEGEVSLVASP--HTPGSYLFKSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWV-----AGAHLPFPGLGHVRKEAQGYAWV................... 313
59 -17.1001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  16  90......................KAPLETSVTGYLVNTGSKLVLVDTGAAGLFGPTLGRLAANLQPEQVDEIYITHMHPDHVGGLMV-QLAFPNAVVRADQKEADFSKGFFKGAMASLNPYVKAGKFKPFSGNTDIKALASH--HTPGTYVVESQGQKLALLGDLILVAAVQFDDPSVTTQLDSDSKSVAVERKKAFADAAKGGYLI-----AASHLSFPGIGHIRAEGKGYRFV................... 321
60 -16.9002dkf_A mol:protein length:431 metallo-beta-lactamase superfamily protein  ali model follow..  14  10.........................REVTGSAHLLLAGGRRVLLDCGMFQGKEEARNHAPFGFDPKEVDAVLLTHAHLDHVGRLPKLFREGYRGPVYATRATVLVLEDALKVMDEPFFGPEDVEEALGHLGALSLAFGQAGHLPGSAFVVAQGEGRTLVYSGDLGNREKDVLPDPSLPPLADLVLAEGTYPHRPYRETVREFLEILEKTLSQGGKVLIPTFAVERAQEILYVLYTHGHRLPRAPIYLDSPMAG 255
61 -16.7004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  14  57...........................MAINILLVKTKEKLILMDTGMGIFADERTGFLLKSLSAHDITDIFLSHAHPDHIGGVVD-KLVFPNASIFISKIEHDF-ASIKDFNNSALKAHPERLNQIIPALQNILKAIQPKL-HTPGVTTISSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLK-----QLADTKARAFTSHLPWPGLGFTKVKAPGFEWI................... 288
62 -16.3001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  11  31.......................PEAGEATSGYLFEHDGFRLLVDCGSG-----VLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQGQLPELPIYGHTFDENGFHSLTHEPHTKGIPY-NPEETLQI-GPFSISFLKTVHPVTCFAMRITAGNDIVVYSADSFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASI-------AKDANVKELLLTH................................ 229
63 -16.1001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  13  14...............................MYLVIDDEEAAIVDPVQPQKVVDAARKHG------KLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALTH-----------KITHLSTLQV-GSLNVKCLATP--HTSGHICYFGSEPPAVFTGDTLGKFYEGTADEMCKA--HEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMR.................. 226
64 -15.5003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  15  46...........................LPTHPILIQTAQYNLIIDAGGVDEESHIIADLANYLTPKDIDYVLMTHMHFDHAAGLTD-HAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKGDYSNKLILFEKHFIKMQHSG--HSFGHTIITSQGDKAVHMGDIFPTTA-------------KNPLWVTAYDDYPMQSIREKERMIPYFIQQQY-WFLFYHDENYFAVKYSD..................... 262
65 -15.4003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  13  29...........................IKHGSLMLTYDNHSIQVDP---------VSEYADYTTFPKADIILITHEHGDHLDPKAIQAVEKSDTEIIANENSQKKLGK----------KVLKNGDTDTSISYMKIEAVPAHPRHRDNGYILTFDGLRVYIAGDT-----------EDIPEMKDLKDIDIAFLPVNQPYTMTVSQAAKAARMFSPKILYPYH---YGDTKIGELKDALKDSGIDVRIRE..... 227
66 -15.0003g1p_A mol:protein length:258 Protein phnP  ali model follow..  11  41...............................SGVVKFNDAITLIDAG--------LHDLADRWSPGSFQQFLLTHYHMDHVQGLFPLRGVGDPIPVYGPPDEQGCDDLFKHPGLLDFSHTVEPFVVFDLQG---LQVTPLPLNHSK-GYLLETAHSRVAWLSDTAGLPEKTLKFLRNNQPQVMVMDCSHPPRADAPRNHCDLNTVLALNQVIRSPRVILTH................................ 222
67 -15.0002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  20  11...........................FSQNCSLIWCEQLAALVDPGGD--AEKIKQEVDAS----TLMQILLTHGHLDHVGAASELAQHY-GVPVIGPEKEDEFWRMFGLDECQPLTP-LNDGDRVSV-GNVTLQVLHCP--HTPGHVVFFDEQSQLLISGDVI-----KGGVGRSDFPRGDHTQLIDAIKRKLLPLGDDVT-------------FIPGHGPL............................. 195
68 -14.9001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  17  15................................YILHDEDTVGVVDPSEAEPIIDSLKRSG------NLTYILNTHHHYDHTGGNLELKDRY-GAKVIGSAMDKDRIPGIDM--------ALKDGDKWMF-AGHEVHVMDTP--HTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLR.................. 222
69 -14.4002xr1_A mol:protein length:640 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  17  193.........................KEVGRSCFLLSTPESRILIDCGGSDENMTPYLYVPEVFPLNQIDAVIVTHAHLDHQGLVPLLFKYGYEGPVYCTPPTRDLMVLLQLDYIDKHTIPLDYEEVTDIAPDIKLTFHNA---HILGSAISHDGLHNVVFTGDYKYELFDPAVNKFPRVETEATYGNANAFQPALKDAEKHLQMVVKNTIERGGIAVIPAFA-VGRSQEVMIVLEESIR.............. 436
70 -14.1002ycb_A mol:protein length:636 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  14  189.........................REVGRSCLYLQTPNSRVLLDCGVNVAGGDDKNSYPYLFTLDSLDAVIITHAHLDHSGFLPYLYHYGYDGPVYCTAPTRDLMTLLQLDHIDKHTITLDYGEVTDIAPDIRLTLHNA---HILGSAMAHDGQHNMVYTGDFKYELLEAAANRFPRIETESTYGGHEDVQPSRNRAEKELVKTIYSTLRRGGKILIPVFA-VGRAQELMIVLEEYIR.............. 433
71 -13.8004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  20  14........................EPVSCTFTYLLGDSREAVLIDPV-LETAPRDAQLIKEL----RLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLH-----------IEDGDSIRF-GRFALETRASP--HTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQ------------------GCAKTLYHSVHEKIFTLPGDLIYPAH................................ 179
72 -13.2002wyl_A mol:protein length:360 L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG  ali model follow..  11  43...........................LGCTGIWLKSEGGTNVCVDAGVKKLQPNLRTTPFVLDPFAIDAVLATHDHNDHIVAAAVMQNCADDVPFIGPKTCVDLWIGWGV--PKERCIVVKPGDVVKVKD-DRTALITLPADQKAANYLFKTPGGSLYHSGD--SHYSNYYAKHGNEHQIDVALGSY-GENPRGITDKMTSADMLRMGEALNAKVVIPFHHDIWS........................... 286
73 -13.1003h3e_A mol:protein length:267 uncharacterized protein Tm1679  ali model follow..  13  28...............................SVLV----DSVLFDTGK----SDVFLKNARKLGIDLPKDVLISHGHYDHAGGLLYLSGLYYNTGKFVIERITEIGKNMFLLGPANLRGKVPTGDFFVERNGERRK----DLFEDEQTLVVRTKEGLVVITGCSHRGIDNILLDIAETFN-ERIKMVVGGFH-LLKSSDDEIEKIVKAFNELGVETVVPCHGERAVDIFKREFLGKIMDCYAGLKL....... 257
74 -12.8002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  10  21.........................QEVGRSCIILEFKGRKIMLDCGIHPGLEGMDAPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKT-KGRTFMTHATKAIYRKVSNISADDMLYTETD-HEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDFSRQ----MAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNTVHDI--RGLIPVF-ALGRAQELLLILDEYWQ.............. 258
75 -12.7003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  15  11........................DEGLAHASYLVQETGEACVIDP---------ARDVEPYLLTAKIVAALETHIHADFVSGAREMADR-AGAAICVSDEGPPEWKSEYVKAYP--HRLLKDGDELHF-GNVRIVVMHTP--HTPEHVSYLPDVPMALFSGDF---------VFVGDVGRPDLLERVAGESGSSEALARQMFRSLRKFEALPDHVVLPAHGA---GSACGKALGAVPSSTVG.......... 218

FFAS is supported by the NIH grant R01-GM087218-01
1 0 9 9 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.