current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: TM0013 TM0013 281894 Purified-2001-08-24, from JCSG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MFENEILFDNGQHKFMFLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVAEVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKIYISSLWVRFLPHFGIYDQKRIVPISDKGTKIKLLSGNELEILPAHFLHSTGNFVLYDPVAKILFSGDIGAAVFEKGKRYRYVDDFERHLPLMEAFHKRYMSSNAACKKWVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNLKCGVDLIDNLYSLLast
1 -66.300[C] COG0426 Uncharacterized flavoproteins  ali follow..  15  26IAPNTTAIRCLDWDRDRFDIEFGLQNGTTYNSYLIRG-EQTVLVDTSHQKFRQLYLETLKGLINPKAIDYIIVSHTEPDHSGLVEDVLQLAPRATVLASKIALQFLEGLVHDPFS--KRIVKSGDRIDIGKGHEIEFVSAPNLHWPDTIFSYDRKTEVIYTCDAFGMHFCDNRTFDEDLE-AIEADFRFYYDCLMGPNARSLLNAMKRMGDLKIKIIANGHGPLLY-HHLDVLTECYQSWSQRGLFYVADYG. 281
2 -21.400[R] KOG0813 Glyoxylase  ali follow..  17  30.............................TNTYLLGSGSRRILIDTGDEDV-PQYIAHLGDVLQQESIDTILLTHWHHDHVGGVKSIVGTKAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAHNQEFTTEGANVRVVHTP--HTTDHV-VLAMNEGTLFSGD-----------------------CILGEGTAVFEDLFEYMKSLEKILDIKPQRIFPGHGNVIEEGKIEYYINHRNQREQQIDVVKVVYK. 246
3 -20.300[R] COG0491 Zn-dependent hydrolases, including glyoxylases  ali follow..  23  11...........................YKTNCYVVRGENEVAIIDPGM-----HAHDDLVEYITTNNLSKIVLTHGHIDHTRDAGVVAKRF-NAPVYIHPDDAFFLEVYKGSGTKTAMLFLVDGETITL-AGEEFTLKHAP--HSPGCTLIVGKEGDVLFKGSIGRTDFEWSD------------------------ADAMNESLRTAVLPLDDALILPGHGP.............................. 196
4 -16.400[R] COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II  ali follow..  14  29...............................SALVESNGYKVLVDTGTDG--KVLLNNMHELIDANDIDVLFITHGHYDHTGGLKEFLKERSEPIEVYAHPGI-FDERIALKPRKRDIGIPFQRKELEELGA-RFNLSPEPLEFLPGALIVEGSKGLVVISGCGHSGIINIARHAMELRG-SKIAALIGGFH-LRGAKKELLDDVVTNMKELGVNALYPGHCTGIEESYLWSKLDNVEGIYVGKEI....... 270
5 -14.700[S] KOG4736 Uncharacterized conserved protein  ali follow..  16  294...........................AVGAITLVNDNGYIVLIDTGASSDTERLLHSLAKEVTLDQIDSVVITHASPGHMGNMNFF----AQKPILYHSMEYIGRHVTPTELKERPYRKLSGN----------VEVWKTP--HTQHDLSVLAGYGTMAIVGDLI-------------PSEHLLSEKRDVMIEEGVWDNAIKRQNANLIVCM-ADWIVPGHGQPFR........................... 468
6 -13.900[R] COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain  ali follow..  16  187.........................REVGRSCYLLQTPESRILIDCGVNVSNLSSYLYVPEVQPLDALDAVVITHAHLDHCGLVPLLYKFGYRGPIYLTPPTRDLMVLLQLDFLEKHTITLDYGVVTDISPDVRLTFYNA---HILGSAIAHEGHYNIAFTGDFKFELFDRAATNFPRLEAEATYGGPNDFQPSRKEAEERLIEVINRTLDRGGKVLIPTFA-VGRSQEVMIVLEEAMR.............. 429
7 -13.600[R] KOG3798 Predicted Zn-dependent hydrolase (beta-lactamase superfamily)  ali follow..  16  89...........................LGHATVLVDLEGVKFVTDPVWADRASRYRPPPMKLEDLPDLDFAVVSHDHYDHLDAVKRITNLNPQIKWFVPLGLKKWMKNQGIADGSNTVTELNWGESSEFVNGKTITIWCLPAQHSGQGWAVIGENRRFYFPGDTGFCDVEFKKIGEKLGPFDLAAIPIGAYEPRWFMKSHHIDEAVEVHKLVRARNSIGIHWGTYPMGTTEYYLEPRDKLKELMDAREDL... 337
8 -13.300[A] KOG1136 Predicted cleavage and polyadenylation specificity factor (CPSF subunit)  ali follow..  13  13.........................QDVGRSCLLLSMGGKNIMLDCGDERRFPDFSYIVPEGPITSHIDCVIISHFHLDHCGALPYMSEIV-TGPIYMTHPTKAIAPILLEDMRKKKVIPVTLHQSMMVDTDLEIKAYYAGHVLGAAMFWIKVGSQSVVYTGDYNMT----GAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHEC--KVLIPVFALGRAQELCILLETYWERMNLKYPIY...... 266
9 -13.200[R] KOG0814 Glyoxylase  ali follow..  14  48........................DGESSTYSYLLADNGQAVIIDPV-LEQAKRDAQLVKDL----ELKYAINTHMHADHITGSGWLRKLTGCQSVIAAASGAKA-------------RHLNEGDRIDF-GTHVIDALATP--HTNGCMTYVIKDQGCVFTGDTLLIRGCGRTDFQE------------------GCPRNLYENVHSKIFTLPENRIYPAHD--YKGQMESSVWE.................. 224
10 -12.600[R] COG2333 Predicted hydrolase (metallo-beta-lactamase superfamily)  ali follow..  15  95...............................ATLIVKNGKGILYDTGSSWRGGSMAELILPYLQREVLEKLILSHDDNDHAGGASTILKAYPNVELITPSR---------KNYGENYRTFCTAGRDWHWQGLHFQILSPHNVVTRADNILVDDGKNSVLLTGDA---------------------------------EAKNEQIFARTLGKIDV-LQVGHHGS--KTSTSEYLLSQVR............... 264
11 -11.900[R] COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold  ali follow..  12  108...........................FGHSAFLLNVDNKQLLIDPGRNRYEYSEDIMLHLIDEMPPIDAVLITHDHYDHLDYRSIVKLNNKVSHFFVPLGCSAHLIRWGI--PEEKITELNWWEETEYQG---LTVALTPSRHSSGGWVILGNKTRVYTSGDS-GYGPHFKQIGDKYGPFDITLIEGAQYDRNWPDLHMVPEQAIQANLDVGGKTMMLMHWGAFTNEPIERALKEAKIREVNIIA....... 350
12 -11.800[A] KOG1137 mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit)  ali follow..  13  31.........................SEVGRSCVYMSFRGKNILFDCGIHPAYSGMAAPYFDEIDPSSIDVLLITHFHIDHAASLPYFLEKT-NGRVFMTHATKAIYKLLLTDYVKDKIEVIDFHQTVEVNG--KFWCYTAGHVLGAAMFMVDIAGVRILYTGDYSRE----RAAELPQFSPDICIIESTSGVQLHQSRHIREKRFTDVIHST--RVLIPAF-ALGRAQELLLILDEY................ 266
13 -11.800[A] KOG1135 mRNA cleavage and polyadenylation factor II complex, subunit CFT2 (CPSF subunit)  ali follow..  14  14.........................KDEGPLCYLLQVDGDYILLDCGWDERFGQYFEELKPFIP--KISAVLISHPDPLHLGGLPYLVSKCGTAPVYATKMGQMFIYDMVYSHLDEKVEQVKYNQTVVLKGDSGVHFTALPAGHMLGGRICRVTGEDIVYCVDF-KERHLNGCSFDNFNRPHLLITGAHHISLPQMRRKDRDEQLVTKIL----RTVRQKGDCMIVIDTAGRVLEL-------AHLLDQLWS. 254
14 -11.000[R] COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily)  ali follow..  11  55........................SLGVRSLALFLKIGKVGILIDPGEMKALSLAREKIQEYA--KKAQIVTISHYHYDHHTPFEKAREIYAGKLLLIKHPTENINNSQKKRAHEFLKNAKEIAKDIKFADSQSFDFFSPPVPHGREGVLVDDGKKSVLHASDTQLINDKAVEWIIEKNPDILIAGGPPTYHRVGNVKEIGMKNINRIISETNAKIVLDHH--IIRDK---GYERFFSELDERPLTFAEFLG. 316
15 -10.700[J] COG1236 Predicted exonuclease of the beta-lactamase fold involved in RNA processing  ali follow..  11  52......................................................SIDTTRSPGKQPQPDAYLITHAHSDHHGKSAML-----SPRAVCTDKTATALEI--RHDRKYVGSMCRLGDEIEIEGVRVKTYPTAHTAGAAAFYWENDVGTRILVTGDV--VLITEANYGDPEDPSCHFADDLESMKCALFESGPVAFGAYEFGKAQRAVELMRGFGAIRMEARTRALTRSMLEDAGELAGIDS.... 250
16 -10.000[T] COG5212 Low-affinity cAMP phosphodiesterase  ali follow..  12  21........VENSFTLYSLGQNGGPLES-CCSSHLISAFQEIISLDGGSH------LSALVELIQSKRIKTFLITHCHLDHIYGAVINSAMFNPRTIVGLNYVIDTLKKHVFNNLFINFQVVEPSMYTSLTTTLSILPFPVN--HGSSFGQELKSSAYFLAFGDVEPDMVASEPLNIHIWRACSSLIAQRKLSHILIECSRHLVNELCILQSLVQSYCLLTHSANPADVILEQLESLSSKSSLSVTFKILQRG. 341
17 -9.390[R] COG1235 Metal-dependent hydrolases of the beta-lactamase superfamily I  ali follow..  44..........................GGNTICIEVRCGDHVLLFDAG-----SGLHPAGLALRAEGITDNLFFSHCHYDHIVGFPYFKPFY-REMLKDFMSPPWFPVPLEICCAKIATRDFKAGDVLDVHPGLSIRTGMLNHPGNAIGYRLDWEGKSLAIITDTHEPSSIDETVLDLIRDVDLFLYDAMFTDEEMGLYHSSWQQAIRLAKLADAKNVGFIHAPSRSDEELDDIEKQAKAEFNGAFAAMD.... 286

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 5 7 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.