current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: TM0013 TM0013 281894 Purified-2001-08-24, from JCSG0516

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MFENEILFDNGQHKFMFLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVAEVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKIYISSLWVRFLPHFGIYDQKRIVPISDKGTKIKLLSGNELEILPAHFLHSTGNFVLYDPVAKILFSGDIGAAVFEKGKRYRYVDDFERHLPLMEAFHKRYMSSNAACKKWVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNLKCGVDLIDNLYSLLast
1 -116.000TM0013 TM0013 281894 Purified-2001-08-24  ali  100  1MFENEILFDNGQHKFMFLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVAEVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKIYISSLWVRFLPHFGIYDQKRIVPISDKGTKIKLLSGNELEILPAHFLHSTGNFVLYDPVAKILFSGDIGAAVFEKGKRYRYVDDFERHLPLMEAFHKRYMSSNAACKKWVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNLKCGVDLIDNLYSL 253
2 -94.000FN0013A AFE_0842 378921 Purified-2007-09-27  ali follow..  39  2...SQLLYDNGTHKCIAFT-DLVEGEGIQANQFLIVNNGEGMLLDPGGNLTYKNLLAEMASYFLPAHLDYVFASHEDPDIVASANGWLL-ITDAKILIANEWTRFLPHFCSKGAGRVIGIPAQGMRVNL-AGQELFVVPAHYMHSVGNFQVYDPVSKILFSGDLGANLVSGHDAAKVIEGAERAATSMDGFHRRYMGGQKVCRLWTNMARGMDIEWIVPQHGASFKGETVLAFLDWFEGLESGPDLLQKDFQF 257
3 -63.900TM0755 TM0755 282625 PDB-2004-09-21  ali follow..  17  11DDPEIYVLRIDDDRIRYFEAVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIHDVEIIASNFGKRLLEGFYGIKD---VTVVKDGEEREI-GGKKFKFVMTPWLHWPDTMVTY--LDGILFSCDVGGGYLLPEILDDSNESVVERYHVTKYIVTVIGHYKNYILEGAEKLSSLKIKALLPGHGLIWKKD-PQRLLNHYVSVAKGTVIYDSMYG. 265
4 -63.700GD14186A YP_001299287.1 388212 Crystal|NMR-2008-04-09  ali follow..  16  3IKGKVHYVGVNDRNKALFENLWPLPYGVSYNSYLIDD-EMVALVDTVDVCYFEVYLKKIRSIIGDKPINYLIINHMEPDHSGSISLIKQYYPNIVIVGNKKTFEMIEGYY--GVGGERYVVGEGDFLAL-GHHRLRFSLIPMVHWPETMVTFDETEGILFSGDAFGCFGANGGVVDTNINTDIYWEMVRYYSNIVGKYGAPVQKALQKLQNLKITTVCSTHGPVWT-EEIPRVVRIYDRLSR-VIAYGSMYG. 257
5 -27.800TM0681 TM0681 282551 Purified-2001-10-17  ali follow..  14  28................LSDRVFVIGTGTSANSVLVCGKKFCVLFDSTLFPEKARKIKEFAAEILGKEIAVVFNTHYHPDHTFGNEVFDRIISHSLT-LEEMDEEYIRKIGVEVSLKFPDETFSERENYRFGDIVVEAVHLG--HTPDSSIFVLKNEKIVICGDLL--TTGIHAEIVTDSDLFGWIEA------------------LSEIEKIRADYFVPGHGKVGTIEDVRNMKDYISKVLRFR......... 236
6 -27.800TM1295 TM1295 283159 Purified-2004-11-17  ali follow..  17  16.....................WHIADYRGDSMYLVVGEEKALLVDTGMG------EGDLKGFVRTEKPVEVVLTHAHWDHIMQANQF------EKVYLNHRDFQIIELFKINVNYENFLNVKEGDRFDL-GGRTLEVIEVP--HTPGSIVLLDRENRLLFSGDSVGA--------------------------MHLPGCLPLREYLKSLKKLSFEKIYHGHLT-FGPDYLDDLIKAVEGVIDG.......... 212
7 -26.300TM0607 TM0607 282480 Purified-2001-02-22  ali follow..  18  7............................PVNIGVVYTENAAVLVDSGLDESVPRKISRLLQ----KPPLYLINTHSHADHCGGNAFLKKRF-STRVFAPKMEKEIIEN-FLMAEPSAVDEVIEEGTITI-ESVDLEIVPLS--HSTNQIGVA--VDGVLFCADVFSEETLRKHRIFVIYNVEKFLET------------------LDFLEKTSYSYYVPSHGEVTRDELVEKNRKAVENIINAV......... 217
8 -25.400FL10934A YP_165938.1 375728 Purified-2007-06-12  ali follow..  16  35..............................NSGVIIGDDSVMVVEAQATPRLAQKVIDCIREVTDKPISHVVLTHYHAVRVLG-----SAFGAGQVIMSDTARSMVVERGQEDWDSEFQTFSDSMTVYL-GKRRVDIMHLGRAHTAGDAVIHVPDQNVMFTGDI---VEYHSACYCGDGHFNDWGNT------------------LDNIAWFDVDAIAPGRGDALVGENTRDFVQSTYRAARGGSLKEAWDAV 264
9 -25.000FJ9329A YP_323572.1 370290 PDB-2007-03-23  ali follow..  13  15.....................FNPARNIDFNGFAWIRPEGNILIDPVALS------HDWKHLESLGGVVWIVLTNS--DHVRSAKEIADQT-YTKIAGPVAEKENFP-------IYCDRWLSDGDELVPG----LKVMELQGSKTPGELALLLE-ETTLITGDLV---------------RAYRAGGLEILPDEKLMNKQKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKELVATLA............ 200
10 -24.200TM0894 TM0894 282763 PDB-2005-05-26  ali follow..  16  21...........................HFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELISPDDITDVLFTHVHLDHIFNSVLF----ENATFYVHEVYKTKNYLSFGTIVGRIYSISSWKNVVLLKGEESVKVFHTP--HAREHLSFLENAGRVLITGDITPN-------------------RLSYYDIIKGYGSVQVKNFLDRVGRID--LLVFPHDAPLKPE......................... 206
11 -23.300MA16092B NP_808546.1 400112 Cloned-2009-03-24  ali follow..  18  70...........................GGSKTALEEAVRGPILVDTGGPWARGALLEALATQVAPEDVTLVVGTHGHSDHIGNLGLF----PEAALLVSHDFCLPEGLYLPHGLC-------ETQPLILGSG--LQVWATP--HGGQRDVS------VVVEGTSLGTVVVAGDVFERLGDED--------SWQALSEDPVAQQRSRERILSV-ADVVVPGHGAPFR........................... 240
12 -23.100MA16092A NP_981942.1 400061 Selected-2008-12-22  ali follow..  17  66...........................GGAEAALEEAARGHILVDTGGPWAREALLGALAGQVAPGDVTLVVGTNGHSDHIGNLGLF----PGAALLVSHDFCLPGGRYLPHGLG-------EGQPLRLGPG--LEVWATP--HGGQRDVSVVVAGTTVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV-------------------ADVVVPGHGPPFR........................... 235
13 -22.300MM3808A 13278494 354611 Purified-2003-08-14  ali follow..  19  31.............................TNTYLVGTGSRRILIDTGEPSV-PEYISCLKQALVEFAIQEILVTHWHSDHSGGIVDICKNINNDTTYCIKKLRRNPQREEIIGNGEQQFIYIENGDVVKTEGATLRVLYTP--HTDDHMALLLEEENAIFSGD-----------------------CILGEGTTIFEDLYDYMNSLNNLLKIKANIIYPGHGPVIHNAKILEYISHRNNREEQIELRTMIYK. 247
14 -21.700MA3808A NP_057111.1 399812 Purified-2009-03-14  ali follow..  19  31.............................TNTYLVGTGPRRILIDTGEPAI-PEYISCLKQALTEFAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTP--HTDDHMALLLEEENAIFSGD-----------------------CILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAKIQQYISHRNIREQQIELVKIIYK. 247
15 -20.700C.KS20803A NP_372069.1 423895 Purified-2012-05-01  ali follow..  19  11...........................VDTNTYFIENDKAVILIDPSGES--EKIIKKLNQI----PLKAILLTHAHFDHIGAVDDIVDRF-DVPVYMHEAEFDFLKQYGLPIITSKVTPEKLNEGSTEIEGFKFNVLHTP--HSPGSLTYVFDEGDTLFNNGIGRTDLYKGD------------------------YETLVDSIQDKIFELEGDLLFPGHGPTVDDEQLNPFLH.................. 206
16 -19.200PU1679B YP_753611.1 381520 Purified-2007-11-06  ali follow..  14  25...............................SALVEVDERKILFDTGSSDALFKNAENLG--VKLEEVEALVISHGHFDHTSAVIPFLQRFGPKKLYLHPGIFSQRYLQGKKGLGPNIGCPFEPEDLVKNGA-EIIFIDSFSEIMPGALLVDHPEGLIIISGCAHSGMINTIEYIREKTGRSKILAFIGGTH-LITASEDRLAQTIAVLKMMDIEKIAVGHGFYAAARLLNELGPRVIKADTGMSF....... 274
17 -16.600TT10477A YP_012016.1 404703 Selected-2009-08-14  ali follow..  11  109LASIKDLIPNDLEKAWEIQKKLALHPENPGGFSCLIETKHKYLLDTGWSYEKSFKREGIDKMLQAREIEALFISHEHWDHFWGLPVTMKYDNRIPLYVHDGFYKEGLQYIKDSGYKGTPVIQKEPMRQIIPGMAVL-IINRVFGETSLAFNVKDKGLVLISGCCHQGILQMADFAYTDLKYDRFYGIYGGLHSPFEDWDPKYDDLVISLAKWNFERIGCNH................................ 345
18 -16.000MA16095A NP_996995.1 400077 Purified-2009-03-13  ali follow..  13  15................................YLVIEELEAVAVDVAVPKRLLEIVGREG------SLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTR-----------RLAHGEELRF-GAIHVRCLLTP--HTAGHMSYFCPDPPALFSGDALSVAGCGSCLEGSAQQMYQSLAELGTFAQKVEPCNDHVRAKLSWAKARPLSRRGKRVGGEGTGFGVGGALR.................. 225
19 -15.800XB5432A 10175883 358570 Crystal|NMR-2005-05-26  ali follow..  17  49...........................LRTDPFLIQLDGQNILVESGGISEESFLEDDLQSLLTVADIDAVLMTHLHFDHASGLGEWVSTFENAVIYASAREWAEMREPNIRSRNTYWEWRPVEQQVVTFEKEQIRMIHTG--HSDGHSIIVHEGETFIHLADIMPTHA------------HQNVLWVLAYDDYPMDSIFAKQKWQAFASEQEA-WYLFYHDYKYRAIKWND..................... 268
20 -15.100GS0207A YP_001302908.1 384386 PDB-2009-11-06  ali follow..  13  41...........................IKHGSLMLTYDNHSIQVDP---------VSEYADYTTFPKADIILITHEHGDHLDPKAIQAVEKSDTEIIANENSQKKLGK----------KVLKNGDTDTSISYMKIEAVPAHPRHRDNGYILTFDGLRVYIAGDT-----------EDIPEMKDLKDIDIAFLPVNQPYTMTVSQAAKAARMFSPKILYPYH---YGDTKIGELKDALKDSGIDVRIRE..... 239
21 -14.800MA16095B NP_081173.1 400254 Purified-2009-05-08  ali follow..  15  14...............................MYLIIEEHEAVAIDVAVAERLLEIAGREG------SLTMVLSTHHHWDHTRGNAELAHILPGLAVLGADERICALTR-----------RLEHGEGLQF-GAIHVRCLLTP--HTSGHMSYFCPDSPALFSGDALGWHLEDTAQQMYQS--HEHTLSNLEFAQKVEPCNEHVQAKLSWAQERDDEDIPTVPSTLGEELMYNPFLRVTED.............. 230
22 -14.800PU1679C NP_247422.1 381581 Purified-2007-10-25  ali follow..  18  21...............................SALIEINNKRILFDAGQNSITLRENLRLF--NEKEGFDYIVLSHGHYDHCDGLKYVIENDINGKVIAHKDA------FLDKYAGNRYIGIDEEIKEYLLKKADLEIIEEPYKIDKDIIVSGYVPREILITGCSHSGII---NVVEYGKKLSEIKGVLGGFH-LVGVSDNYLNRIVDYFKSQDFW-IMPMHCTGFKALTKLSQLNNFVYGHVGKII....... 254
23 -12.900SP13918A ZP_03458960.1 407444 Purified-2010-09-29  ali follow..  10  133...........................LYNMGYIIKTPSGCFGIDISHRWAEEFA----------PYLDFLCVTHKHSDHYSNNLIQAMYDLDKPVLSNYLQPV----------ASYPFYSKKSEEYTI-GNFKIRTCITN--HNEASCGDDAGGLTLIHTGD---SNFKPVQYADITDANDVNHHVNVLIPRYAPNALTENDIIGTGTGQVTPDYVLLSH................................ 311
24 -12.200MA8968B NP_945341.2 400228 Cloned-2009-02-26  ali follow..  12  130...........................LGHATVMVEMDELIFLTDPIFSS--KRFRRSPCTISELPPIDAVLISHNHYDHLNSVIALNERFGNELRWFVPLG---LLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKSWSVLGPWNRFFFAGDT-GYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVEEAVRIHTDVQTKKSMAIHWGTFA........................... 348
25 -11.900MA8968A NP_848843.1 400511 Cloned-2009-02-26  ali follow..  11  130...........................LGHATLMVEMDELIFLTDPMFSS--KRFRRPPCTISELPTIDAVLISHNHYDHLGSVLALNERFSELRWFVPLGLLDWMQKCGCENVIEL----DWWEENCVPGHDKVTFVFTPSQHWCKSWSVLGPWSRFFFAGDT-GYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHAEDAVRIHIDLQTKRSVAIHWGTFA........................... 348
26 -11.900MA2439A NP_057291.1 399960 Purified-2009-03-27  ali follow..  10  21.........................QEVGRSCIILEFKGRKIMLDCGIHPGLEGMDAPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKT-KGRTFMTHATKAIYRWLLSDYVKDKIETINFHEVKEVAG--KFWCYHAGHVLGAAMFMIEIAGVKLLYTGDFSRQ----MAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNTVHDI--RGLIPVF-ALGRAQELLLILDEY................ 256
27 -11.400TM1162 TM1162 283028 Crystal|NMR-2002-09-14  ali follow..  12  8..............................HAVVLIEGKKNIIIDP----FISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKK-NDATVISNYEICHYLGKKGV-----------KTHAMHIGGSYLFDFGRVKMTHGSG----ILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDFVMDVEDAVRAAVMIKPKKVVPMHYGTWEFADVELFKKKVEEKGVECVILE..... 219
28 -9.940TM0663 TM0663 282535 Purified-2004-02-02  ali follow..  13  19.................................VVDSENDGFLLDFGEEFLNPRTGKILHDLLKLKMVAFLFLSHAHADHTGMVGLIDEKIP---LLMTGETFAVMRASVYTSNSNVLTQLGG-VDVNSLWKNELFVEPVHSVIGAAGLAARVDDLWLAYTGDF--------------ETAEEERYWLDTLGEKRLALSLRTSRFFENLKDKRPLVLI-VEGTRVEKDVFENAMRVFRGTKNLILVDFPIRHL 314
29 -9.930GS13936A YP_001303382.1 384870 Purified-2008-06-17  ali follow..  11  55..........................GVSESMFLIFPDGTTMLLDCGDHNAVEWISRYVRRVPQKDYVDYMMLTHYHSDHGGGFSQAAEYLTFGKAFAADAFEHMKDFYDYMLAHKKMEILGETNQIAMKKDASVRNICANGRIADKEIFTY--DFKFYTAGDFSDPNGKRFEIEDAIADVVEPVSVAKINHHGHKSMTDKL-----------VAALRPRVVVNNVWDQLHTLPSVMERFYN........... 353
30 -9.570GS13918A NP_809107.1 384839 Selected-2007-09-11  ali follow..  133...........................LYNMGYIVKTPSGCFAIDISHRWAKE-----------APYIDFLCVTHKHSDHYNTDLIQAMFDLDKPVLSNYL-----------KDTTYPYTAKGDKDYEIGKFKIRTCITDHNNSGLSNFVTIFQIDVFMHVGDSN---------FKTEQYTNIAPHVNVLIPRYAPNALTENNILGTGAGQVQPDYVLLSH................................ 304

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 3 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]