current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: TM0013 TM0013 281894 Purified-2001-08-24, from JCSG0516

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# E-value Template Links and tools%idFirst MFENEILFDNGQHKFMFLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVAEVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKIYISSLWVRFLPHFGIYDQKRIVPISDKGTKIKLLSGNELEILPAHFLHSTGNFVLYDPVAKILFSGDIGAAVFEKGKRYRYVDDFERHLPLMEAFHKRYMSSNAACKKWVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNLKCGVDLIDNLYSLLast
1 0.000e+00gi|1008843778|gb|KYK26946.1| MBL fold metallo-hydrolase [Euryarchaeota archaeon SG8-5]  clstr ali  17  1.MNKIEIYWVGGIDWHFHG--YKTHRGTTYNAYLIID-EKVVLVDTVKHYLYGEMLARIKEIIDPSKIDYVVSNHVEMDHSGSLPKILEEAPNATLITSVQGEKGLRRHYKR--DWNFHVAQSGEELS-IGKRTLVFVHVPMVHWPDSMVTYIPEENLLLPNDAFGQHIASAERFDDEIEWGVLKEAATYYANIVMPYGTQVGKALEALGGLDIDMIAPSHGIIWRSDILAEYVKWAETEARALIVYDTMWG. 258
2 0.000e+00gi|501238378|ref|WP_012281396.1| MBL fold metallo-hydrolase [Heliobacterium modesticaldum]  clstr ali  22  1.MRPVKIYWVGAVDWDFHG--YLTQRGSSYNAYLIMD-EKITLVDTVKAYLVEEMLDRIAHVVDPSKIDYIICNHVEMDHSGGITRLMELAPNATIITSPNGQRGLKAHYKR--DWPMQVVKTGDRLSL-GKRNLSFVLTQMVHWPDNMVAYMPEEKILFSNDAFGQHIASMERFDDQFSYHIMEEAKKYYANIVLPYGAQVQNALQALAGLEIDLIATSHGLLWRS-HVPEILEEYGKWEKALIIYDTMW.. 257
3 0.000e+00gi|769968552|ref|WP_045089981.1| flavodoxin [Fermentimonas caenicola]  clstr ali  15  9..KDIFYVGVNDRTKHLFESLWPLPNGVSYNSYLIVD-EKVALIDTVDICYSDVFFRKITSLLGDRPIDYLVVNHMEPDHSGSIGLLVNKYPDISIVGNKRTIEMLKGYYGVT--NNLVEILDLDTLNL-GKYNLKFYLTPMVHWPETMMTYLQEMNTLFSGDAFGTFGADGGVLDSQTRIEKYWDEMRYYSNIVGKFGSPVQTALKKLSGVEIDMICSTHGPVWTKNRINEVISLYDKLSKYVIVYGSMYG. 263
4 0.000e+00gi|524525843|emb|CDC61836.1| rubredoxin [Clostridium sp. CAG:448]  clstr ali  15  1MHVTGDIYGVNDRNIDLFEGQYTVPNGMAYNSYVIMDQ-KIAVMDTVDRNFTHEWLDQLAAVLGDRKPDYLVVQHMEPDHSANIANFLKVYPDATVVANAKTFTMIDNFFGAGLCNKTLTVKDGETLSL-GRHTLTFLFAPMVHWPEVMVTYDDTDKALFSADGFGKFGA----LDAEEDWA--CEARRYYFGIVGKYGTQVQALLRKVAPLDIALICPLHGPVLR-ENLGYYIGLYQTWSSYTIAYTSVYG. 252
5 0.000e+00gi|503664959|ref|WP_013899035.1| MBL fold metallo-hydrolase [Methanosalsum zhilinae]  clstr ali  21  11...SENIYWVGVIDWNLRDHAYATPKGSSYNSYLILD-DKITLIDTVKDHLADEMISRIEKVVDPAKIDYVVANHVEPDHSSSLSRVMKMNQNAKIFATKRAKDGLCQYYRPCDSWDFEVVDTGYELDL-GKRTLAFIETPMLHWPDSMQTYLKEDRILFSNDGFGQHLASSHRFNDEVD-NALEEASEYYANILMPFSKPVFNLLEKVEKLEIDMIATGHGIIWR-DNPGQIIDAYRKWASGLVIYDSMWG. 266
6 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  19  17...AVFLTRVNDRRKNLFENLWPLPDGVSYNSYLIRD-EKCALMDTIEAGSDRSYLDWVSSVLGDRQLDYLVIHHMELDHSGEIQSLLQRYPNVKIIGNVKTFKVLCGYLGELP--NLVEVKDGDTLDL-GHHKLKFVFTPWVHWPETMMSYDMTDGILFSGDAFGSFGADGGAFDDQVVFDLESEMRRYYSNIVGKYSNMVQKAFAKLSTLDIRAICPLHGLVWRND-PAKVIELYRRWEEGVVIYGSMYG. 269
7 0.000e+00JGI.Meta 7004288914 C4271276__gene_359843 hypothetical protein [Human Stool microbiome from visit number 1 of subject 160400887]  ali  15  6...SVKYIGVDDTTIDLFESQYVVPEGVSYNSYVILD-EKIAIMDTVDKRGMKEWEDNLLKTLDGKKADYVIVQHMEPDHAGSLARLLELFPDITVVGNAKTFVMINQFFENINIKDSLTVKEGDTLNL-GSHTLTFVMAPMVHWPEVMVTYESSEKILFSADGFGKFGALSL----TENEDWACEARRYYFNIVGKYGAPVQTLLKKASALDIKTICPLHGPVL-SDNLGYYLDLYNTWSKGIIAYASIHG. 254
8 0.000e+00gi|551020691|ref|WP_022764859.1| FprA family A-type flavoprotein [Butyrivibrio sp. XPD2006]  clstr ali  16  1.MKGIKIFWIGDRRLERFENIFPIPEGVSYNSYFI-DDDKTAVFDTADITVADQYIENLKDALAGRKLDYLVVLHMEPDHCSLIDKVVALFPEVTVVGGKQTFTFMQQFFPQTADFNKFEVKEGDTLST-GSHTFSFVAAPMVHWPEVLFAYDDKNKALLSADAFGTFGADGGIFADEFDFEKDFSARRYYANIVGKYGPQVQAVLKKAAGLDIQMLLPLHGPVWRK-NLDVILGKYQKWSTVIVVYGSLYG. 265
9 0.000e+00gi|515986339|ref|WP_017416922.1| hypothetical protein [Clostridium tunisiense]  clstr ali  17  1MINTVNISGVNDRETYLFENLWPLDKGVSYNSYLISD-EKIAIIDTVKNTKIDTFIEKIEGLINGKSIDYLIINHMEPDHSGAIKEVTEKYPDITIVGNKKTFEILESFYGAME--NYLIVEDGDTLSL-GTHVLKFYLTPMIHWPETMMTYDMKDNIVFSGDAFGGFGTDGGIFDDEINLEFYTDERRYYSNIVGKYGAMVQKALKKLADVDIKVVAPTHGPVWR-NTPATIIEYYDLWSKGVIVYGSMYG. 263
10 0.000e+00gi|753835601|ref|WP_041591220.1| flavodoxin [Tannerella forsythia]  clstr ali  16  9..KNIYYVGVNDRQKHLFENIWPLPGGVSYNSYLIAG-EKSALVDTVDICYSDTFFKKIAKILNGRTLDYLIVGHMEPDHAGSIRLLRQQYPDMKIVGNRQTFGMLAGYHNITEG--LHEVKDGESLDL-GTHQLKFYTAPMVHWPEVMFTYEETERVLFSADAFGTFGTDGGVLDTEMNTDRYWSEMRYYSNIVGKYGGPVQKALQKLSGVDVQMICSTHGPVWTEQR-GRVIEIYDRLSRVTLVYGSMYG. 261
11 0.000e+00JGI.Meta 7016108584 C3303068__gene_245760 flavodoxin [Human Stool microbiome from visit number 1 of subject 764062976]  ali  17  6...DIIYVGVNDHDVDLFEGQYMVPNGMSYNSYVILD-DKIAVMDTVDANFTHEWLDNVASALGSRRPDYLVIQHMEPDHSANIVNFLKTYPNASVVSNKKAFAMMENFFGADFCEKRIVVSDGETLDL-GKHKLTFVFAPMVHWPEVMVTYDSADKVLFSADGFGRFGA----LDREEPWD--DEARRYYIGIVGKYGAQVQALLKKAATLDIEKICPLHGPVLTED-LGHYIGLYDTWSEGIVAYTSVYG. 252
12 0.000e+00 GL0119882 [Complete] locus=scaffold7782_4:137:1324:-  ali  17  15..NDILYVGVNDHQVDLFEGQYDVPNGMAYNSYVIKD-EKIAVMDTVDANFTKEWLDNIAAVLDGAKPDYLVVQHMEPDHAANIENFMNAYPDTTIVANTKTFGMMKNFFNLDLEGRTLEVGNGESLTL-GRHVLTFVFAPMVHWPEVMVTYDSTDKVLFSADGFGKFGA----LDVEEDWD--CEARRYYIGIVGKYGPQVQKLLKVAATLDIQIICPLHGPVL-TENLGHYIEKYDIWSSVVIAYTSVYG. 263
13 0.000e+00 GL0089289 [Complete] locus=scaffold40405_9:801:1961:-  ali  18  7..KDIIYVGVNDHDVDLFEGQYIVPNGMAYNSYVIMD-ERIAVMDTVDAHFGEEWLSNVKEALNGREPDYLVVQHMEPDHSANVANFVAAYPNAKIVGNAKTFAMIADFFDITPEENKVAVANGESLSL-GAHQLTFVFAPMVHWPEVMVTYDAKDKVLFSADGFGKFGALD------IEEEWDCEARRYYIGIVGKYSAQVQALLKKAAALDIAIICPLHGPVL-KDNLAHYINLYDIWSEGVMIYTSVYG. 255
14 0.000e+00gi|491494362|ref|WP_005352085.1| FprA family A-type flavoprotein [[Eubacterium] siraeum]  clstr ali  15  6...DVKYVGVNDTTIDLFEGQYKVPDGISYNSYVILD-EKTAVMDTVDINFSAIWLEKVKTELGDRKLDYLVVQHMEPDHSASIAEFLKFYPDTTVVGNAKTFTMIKGFFPDLTITNTLTVKEGDTLTL-GSHVLTFVFAPMVHWPEVMVTYDAKDKILFSADGFGRFGTPDS------EQAWDDEARRYYIGIVGKYGAQVQALLKKAAALDIEKICALHGPVL-SENLAHYLDLYNKWSSYVIAYASIYG. 252
15 0.000e+00gi|524096137|emb|CCY72722.1| metallo-beta-lactamase domain protein [Eubacterium sp. CAG:115]  clstr ali  17  6...DIRYIGVNDHDIDLFEAQYTVPEGMSYNSYVILD-EKVAVMDTVDGRFGGEWLGNLEKELSGRTPDYLVVQHMEPDHSANIAVFAEKYPSAKIVASKQAFVMMKQFFGTDYADRQVVAAEKDTLEL-GKHTLNFIAAPMVHWPEVIMTYDSADKVLFTADGFGKFGA----LDAAADAEWDCEARRYYFGIVGKYGAQVQAVLKKAAALDIAMICPLHGPVL-KEDLGHYIDKYNIWSEGVIAYASVYG. 254
16 0.000e+00gi|524403028|emb|CDB50936.1| metallo-beta-lactamase domain protein [Clostridium sp. CAG:217]  clstr ali  19  6...AIRYVGVNDTDIDLFESQYPVPNGVSYNSYLLLD-DKIALLDTVDKRKYDDWATKVDAVLDGRTPDYIVVHHLEPDHAGSLQMTIEKYPEATLVLSAKALAMLPQFFDLPAGTKTLSVKEGDTLEL-GHHTLTFVMAPMVHWPEVMVSYEQTEKVLFSADAFGKFGAVG------TDEPWPEEARRYFINIVGKYGAPVQTLLKKAAALDIATICPLHGPVLQGDLTP-YLHLYNTWSRGVIAYTSIYG. 252
17 0.000e+00gi|974208405|gb|KUO50241.1| MBL fold metallo-hydrolase [Desulfitibacter sp. BRH_c19]  clstr ali  18  3MKITDSVTWVGKVDWHFHGQELSTHRGSSYNSYLVKDQ-KNVLIDTAWTPFAHEYVDNLEKAIDLKDIDFIVANHSEVDHSGALSELIKRIPDVPIYCSKNGAKMIKA--QMHQDWNFQIVKTGDKLDL-GDKQLMFIEAPMLHWPDSMFCYLTGDNILFSNDAFGQHYATEVLFNDLVDKDELIEAIKYYANILTPFSKFVPKKINEIVNVPLDIICPSHGVIWRDQIVELYAKWADDYQENTIIYDTMWN. 261
18 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  17  5..NDIRYIGVNDHDIDLFEGQYIVPEGMAYNSYVIID-EKIAVMDTVSADFGEEWLANLENVLAGRKPDYLIIHHMEPDHSANIDKFISAYPEAAVVGNAKTFEMIDQFFGSGLCKNKLAVKNGEMLSL-GRHELTFLFAPMVHWPEVMMSYDETDKALFSADAFGKFGA-----LDCQDKEWDCEARRYYMGIVGKYGMQVQAVLKKAAALDIKMICPLHGPVLTG-NLSHYMSLYDIWSEGVIAYTSVYG. 253
19 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  15  8...AIRYIGVDDTTIDLFESQYVVPEGVSYNSYLILD-EKVALMDTVDARGAEAWEKNLMDTLAGRKVDYLVISHLEPDHAGSIGRLVELFPEVTLVGNAKTFAMLPQFFDGVMECEKLTVKEGDTLSL-GSHTLTFVMAPMVHWPEVMVSYESSEKVLFSADGFGKFGALSL----TEDADWACEARRYYFNIVGKYGNPVQALLKKAAGLDIATICPLHGPVL-KENLGYYIGLYDTWSKVLVAYASIHG. 257
20 0.000e+00gi|493918733|ref|WP_006863871.1| flavodoxin [Marvinbryantia formatexigens]  clstr ali  16  5..NDIRYVGVNDHKVDLFEGQYVVPNGMAYNSYVILD-EKVAVMDTVDIHFTHEWLDNISAVLNGRQPDYLVVQHMEPDHSANIANFLKVYPDTTVVANVKTFAMMDQFFNLDESVKRLTVENGGTLSL-GKHLLTFVFAPMVHWPEVMVTYDSTDKVLFSADGFGKFGAN----DVEEPWD--DEARRYYIGIVGKYGAQVQNLLKVAATLDIQIICPLHGPVLTED-LGHYIGLYDTWSSYVIAYTSVYG. 252
21 0.000e+00gi|653088920|ref|WP_027339160.1| flavodoxin [Halonatronum saccharophilum]  clstr ali  17  1MDKVISITDVNDRQTDLFEALWPLPKGVAYNSYLIID-EKVTIVDTVKNNYIDSYIRNIKGVLGDREVDYLVINHMEPDHSGAIKAIKDAFPNIKIVGNKKTLAMIEGFYGLNDGG--HLVGDGDELDL-GGRKLKFYLTPMVHWPETMMTYDQKDKILFSGDAFGGFGTDGGIFDDQLNIAFYEDEIRYFTNIVGKYSQMVLKAIDKLKDLDIGIVASTHGPIWRQD-PNYIINKYSKWSKVVIAYGSMYG. 261
22 0.000e+00gi|518059645|ref|WP_019229853.1| MBL fold hydrolase [Sedimentibacter sp. B4]  clstr ali  20  1MFKITTVSWVGKIDWEFHGDEYSTHKGSSYNSYLIRD-EKTVLIDTVWEPYAKEFINNLKKEIELDKIDYIIMNHSEVDHAGALLELMKKIPNTPVYCTKNGAKIIKGLHHKDF--NFVEVKTGDTLD-IGKNKLVFVEARMLHWPDSMMTYMSGENILFSNDAFGQHYASELMYNNLVDQDLYDEAIKYYANILTPFSKFVTAKINEVLNMKINMICPSHGIIWRDNPLEKYLEWADSYHENTIIYDTMWN. 260
23 0.000e+00gi|497672002|ref|WP_009986186.1| FprA family A-type flavoprotein [Ruminococcus flavefaciens]  clstr ali  16  6..NDIFYIGVNDHQIDLFEGQYDVPNGMAYNSYIIMD-EKIAVFDTVDGNFTEQWLKNIAEVIGGKKPDFLIVQHMEPDHSANIMNFIKAYPEAKIVGNAKTFAMMASYFDLDLGDKKYEVKEGDQLSL-GKHELNFVFAPMVHWPEVMFTYDSTDKVLFSADAFGKFGALD------VDEDWACEARRYYFGIVGKYGVQVQAVLKKAGALDIQTICPLHGPIL-KEDLGYYLGLYNTWSEGVIAYTSVYG. 254
24 0.000e+00gi|489593203|ref|WP_003497647.1| MBL fold metallo-hydrolase [[Clostridium] symbiosum]  clstr ali  20  1.MNAIQI-KDGIYWVGALDWHYTTNRGATYNAYLIID-EKVALIDTVKAPFSRELLERISSIIDPSRIDYIISNHVEMDHSGALPALMETCPNATVVTSAPGVKGLTAHYGPH---NYMAVKNNDTLSL-GKRSLSFVTTPMLHWPDNMVTWCPEEKILFSNDAFGQHYCTNTRFDDDSDFETMQEAKKYYANIIMCYGKQAAGAWKIVKEMEPEMIAPSHGVIWRS-HVADILNAYEHWSSALIVFDSMW.. 257
25 0.000e+00 GL0069585 [Complete] locus=scaffold32600_3:1876:3090:-  ali  19  16....VHYVGVNDRVKHRFEGLWLLPQGVSYNSYLI-DDEKVALVDTVDVAFFTEYLDRIRAVIGDRPVDYLVINHMEPDHSGSIALIRKYYPGVRLVGNKKTFEMVQGFYGVSTEGD-LVVGDGDELPL-GHHRLRFYLAPMLHWPETMVSYDETEHILFSGDAFGCFGANGNIVDEQMETTPFWPEMRYYAAILGKFSPMVKRALAKLGGLKIDMICSTHGPVWKKE-VARAISVYDRMSHGVVCYGSMYG. 267
26 0.000e+00 GL0030488 [Complete] locus=scaffold26929_1:590:1741:+  ali  17  6...SIRYVGVNDNDIDLFEGQYIVPNGVSYNSYLIKD-EKTALLDTVDIHKYDEWEKTLEAKLGGKAPDYLVIHHLEPDHAGSIVKIIEKYPNITLVGNAKTFAMLPQFFEISDSVEKLTVKEGDTLAL-GSHTLTFIMAPMVHWPEVMVSYEESEKVLFSADAFGKFGSIG------TDEDWACEARRYYFNIVGKYGAPVQTLLKKAANLEIAKICPLHGPVLDSD-LDYYLGLYQTWSEGVIAYASIYG. 252
27 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  15  6...DVKYVGVNDTTIDLFEGQYRVPDGISYNSYVILD-EKTAVMDTVDINFSAIWLEKVKTELGDRKPDYLVVQHMEPDHSASIAEFLKFYPDTTVVGNAKTFTMIKGFFPDLTITNTLTVKEGDTLAL-GSHTLTFVFAPMVHWPEVMVTYDSKDKILFSADGFGKFGTPD------TDEPWEDEARRYYIGIVGKYGAQVQALLKKAATLDIEKICALHGPVL-SENLAHYIDLYNKWSSGVMIYASIYG. 252
28 0.000e+00 GL0048500 [Complete] locus=scaffold4912_2:157:1323:+  ali  17  1.MKDTTISDSDDTTLDLFESQYIVPEGVSYNSYVIMD-DKITIMDTVDQRATEEWIANVKNVLKDKTPAYLVVSHMEPDHAANIQKIAEMYPEMKIIGNAKTFSMMPQFFDFDLSNRSVVVKEGEEISL-GAHTLQFFMAPMVHWPEVMVTYEKSEKILFSADGFGKFGALS------VEADWACEARRYYFNIVGKYGAQVQALLKKAATLDIQMICPLHGPIL-KENLGYYIDKYNTWSEGVVAYASIHG. 255
29 0.000e+00 GL0183900 [Complete] locus=scaffold31479_4:2537:3697:-  ali  17  5..NDVRYIGVNDHEVDLFEGQYHVPNGMSYNSYVILD-EQIAVMDTVDARFGSQWLCNLESALSGRTPDYLVVQHMEPDHSANINVFMARYPAARVVASAKAFAMMRQFYGQDYAQRRVVVGEGDILPL-GKHTLSFVAAPMVHWPEVIVTYDAVDKILYSADAFGKFGALD------VDEPWDDEARRYYIGIVGKYGAQVQALLKKAAALDIAAICPLHGPVLR-ENLAHYLHLYQCWSSGTVIAASIYG. 252
30 0.000e+00JGI.Meta 7044913315 SRS012273_Baylor_scaffold_16456__gene_39412 hypothetical protein [Human Stool microbiome from visit number 1 of subject  ali  16  5..NDIRYIGVNDHDIDLFEGQYIVPEGMAYNSYVIID-EKIVVMDTVSADFGEEWLANLENALAGRKPDYLIIHHMEPDHSANIDKFVNAYPEATIVGNAKTFEMIDQFFGRGLCKNRLAVKNGDTLSL-GRHELTFIFAPMVHWPEVMMSYDAADKALFSADAFGKFGA-----LDCQDKEWDCEARRYYMGIVAKYGMQVQTVLKKAAALDIKTICPLHGPVLTGD-LSHYMSLYDIWSEGVIAYTSVYG. 253
31 0.000e+00gi|736422830|ref|WP_034444994.1| flavodoxin [Butyrivibrio sp. AE2032]  clstr ali  15  11......IFWIGDRRLERFENIFPIPEGVSYNSYFV-DDEKTAVFDTADVTVADQYIENLKEALGGRNLDYLIVLHMEPDHCSCIDKVIALFPEVTVVGGKQTFVFMEQFFPEAKDYNRLEVKEGDTLST-GAHTFSFIAAPMVHWPEVLFAHDEASKALLTADAFGTFGADGGIFADEYDFDFLDSARRYYANIVGKYGPQVQAVLKKAQGLDVQMILPLHGPVWR-QNLDEILEKYQKWSTVIVIYGSLYG. 265
32 0.000e+00gi|973098522|gb|KUK57300.1| Flavodoxin [Synergistales bacterium 53_16]  clstr ali  17  1MTQAINVTGVNDHQTDLFESLWPLPRGVTYNSYLI-DDEKTVLVDTVKSPFMTDLLDKIREILGPRGLDYLVINHMEPDHSGAVKILKSIFPEMKIVGNAKTKDLLESFYSLTDD--LVIMKDGDLLD-IGSRKLQFFMVPMVHWPETMVTWDASTKTLFSCDAFGGFGADGGLFDDEVDMNYYEEILRYFSNIVGRYSPQVQKAIEKLKGLDIGIIAPSHGPIHRK-HPGRIIELYDRWSRAVIVFGSMYG. 263
33 0.000e+00JGI.Meta 7058462652 C3922043__gene_313603 flavodoxin [Human Stool microbiome from visit number 1 of subject 765701615]  ali  19  1MHIQAKVYGVNDRVKHRFEGLWSLPQGVSYNSYLIADEEAVALVDTVDVAFFAEYLAHIRAIIGERPINYLIINHMEPDHSGAISLIKKYYPEIKLVGNKKTLDMVQGFYGATSANDVM-VKDGDTLSL-GHHQLKFYLTPMLHWPETMMTYDETEHILFSGDAFGCFGANGAVIDTQMDTTPYFPEMRYYATILGKFGAMVQAGLKKLAGVDIRTICSTHGPVWTAQIPQ-VIETYRRLAMGVICYGSMYG. 259
34 0.000e+00gi|501491517|ref|WP_012499965.1| flavodoxin [Chloroherpeton thalassium]  clstr ali  16  1.MQKVNISDDNDRRTELFENMWPIPQGVCYNSYIIND-EKVAIVDTVEVSAVDEYLDKLEQIIDDRTVDYLIINHMEPDHSGAVRSIRQKYPNVAIVGNKKTFEMLEKFYGIS--DNLHLVEDGDELEL-GSHKLKFYMTPMLHWPETMMTYDQKDKILFSGDAFGSFGTDGGVFDDELNMSFYDDERRYYSNIVGKFAKFVQKALQKLSTLEVKVIAATHGPIWR-EGIKSIIDRYDRWSRVVIVYGTMYG. 261
35 0.000e+00gi|740883321|ref|WP_038668569.1| MBL fold hydrolase [Pelosinus sp. UFO1]  clstr ali  21  9......LTWVGKIDWEFHGEEYSTHKGTSYNSYLIQD-EKTVLLDTVWMPFAHEFIQNLEREIPLTKIDALVITHGEVDHSGALPELMEKIPNVPIYCTANAVKSLKGQY--HQEWNFKIVKTGDRLNL-GSKELIFVEAPMLHWPDTMFAYMTSDNILFSSDAFGQHYASALMYNDLVDQELYQECTKYYANILTPLSKFVDKKIKEVLNLPVDMICSSHGVIWRDQIVTQYAKWALDYQENTIIYDTMWN. 261
36 0.000e+00JGI.Meta 7021213667 C3095923__gene_171343 metallo-beta-lactamase domain protein [Human Tongue dorsum microbiome from visit number 2 of subje  ali  18  17..KDLYYMGVNDRDTNLFENMWPLPEGVAYNSYLIVD-EKTALLDTVKITKVNGFIENLKKNLNGRDLDYLVIHHMEPDHSGCYLSVLDIYPNLTFVGNKKARAMFKDYLDMEPE-NFIEVKEGDTLSL-GKRTLTFVNTPMVHWPESMVSYETTDKILFSQDIFGGFGANGTIFDDEMNFDFFRDERRYYSNIVGKYSKQAAKALQKVKTLEINVICPVHGIVWRSHIIDEYIRLANNEEGVVIAYGSMYG. 270
37 0.000e+00gi|647598177|ref|WP_025874773.1| flavodoxin [Prevotella corporis]  clstr ali  18  6..NKIFYVGVNDRNKAKFEGLWPLPNGVSYNSYLI-DDDKVVLIDTVEVDFFVQFIENIREVLGDRKIDYLVIHHMEPDHSGGLALLKKYYPDIQVIGNKKTFDMMSGFYGI--KENTIEVKNGDTIE-IGKHKLEFFLTPMVHWPETMMTLCTGDSTLFSGDAFGCFGANGGFIDKDIDTSWCWDEMRYYSNIVGKYGTPVQNALKKLSGSHIDYICSTHGPVWH-EYVEKVIGLYDKMSKYVICYGTMYG. 259
38 0.000e+00gi|495790149|ref|WP_008514728.1| MBL fold hydrolase [Dethiobacter alkaliphilus]  clstr ali  20  9......VTWVGKVDWDFHGHELSTHRGSTYNSYLVRD-EKNVLIDTAWTPFAHEYVDKLAEEIDLDDIDYIVANHSEVDHSGALAELMKRIPDTPIYCSQNGAKMIKA--QMHQDWNFKIVKTGDKIDL-GSKELIFIEAPMLHWPDSMFCYLTGDAILFSNDAFGQHYATEVMFNDLVDKDLYQEALKYYANILTPFSRFVPKKVAEFLNLPLNLICPSHGVIWRDQIVEQYAKWADNYQENAIIYDTMWN. 261
39 0.000e+00 GL0100456 [Complete] locus=scaffold3838_1:205:1554:+  ali  17  1MYCTRKVTWVGARRLALFEGVFGVPDGISFNSYLLTD-EKTVLFDGVDSVVRRTFRENLAHALAGRELDYIVVHHMEPDHAAELADLAKDYPKAQFMCSAMAKTMVGQFFGPEVAGRITVIKEGDTL-CTGRHTLRFVAAPMVHWPEVMMTYDETDKLLLSADAFGCFGANGALFADEVDRDYLDEARRYYTNIDGKYGPQVQTVLQKAGTLDIRMLLPLHGFVWRKD-LGYFLEKYDLWSRGVMIYASVYG. 265
40 0.000e+00JGI.Meta 7019869566 C2453750__gene_182904 flavodoxin [Human Stool microbiome from visit number 1 of subject 160603188]  ali  17  14...SVKYIGVDDTDIDLFESQYLVPDGVSYNSYVILD-DKIAVMDTVDERKTDEWFSNLTEVLEDRQPDYLVISHLEPDHSSNIERLAVRYPDMKLVGNAKTFQMLPQFFDMNFSERSIVVKEGEELSL-GTHKLVFYMAPMVHWPEVMVTYEAAEKILFSADGFGKFGAIEL----TKDKDWACEARRYYFNIAGKYGVPVQQFLKKAAGLDINMICPLHGPVL-KDNLGYYIGLYDTWSKGVIAYASIHG. 262
41 0.000e+00gi|651401786|ref|WP_026513380.1| flavodoxin [Butyrivibrio sp. LB2008]  clstr ali  15  1.MNGIKIFWIGDRRLARFENIFPIPEGVSYNSYFI-DDEKTAVFDTADITISDQYLENLKTVISGKKLDYLVVLHMEPDHCSLINTVVTMFPEVTVVSGAKSFEFMKQFFPESENYKKLEVKEGDELST-GKHTFKFIAAPMVHWPEVLMAYDVTSKALFAADAFGTFGADGGLFADDYDFDFLDSARRYYANIVGKYGMPVQTVLKKAAGLDIQIILSLHGPVWR-ENIGWILDKYQKWSTYTIVYGSLYG. 265
42 0.000e+00gi|822035600|ref|WP_046892162.1| nitric oxide reductase [Morganella morganii]  clstr ali  18  8.....NVHWVGQRDWDFHGTEYKTLLGSSYNSYLIR-EGKNVLIDTVDHKFSREFVQHLQTQIDLNDIDYIVINHAEEDHAGALTELMAAIPDTPIYCTENAIDSINGH-HHHPEWNFNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAILFSNDAFGQHYCDERLFNDEVDQELFEQCQRYYANILTPFSRLVTPKITEILGLPVDMIATSHGVVWRDQIVEWYLKWAADYQEDTIFYDTM... 261
43 0.000e+00 GL0073142 [Complete] locus=scaffold2872_4:6431:7645:+  ali  17  16.MKAVEIYWVGVKDWEFHG--YSTSRGSTYNAYLIMD-EKVTLIDGVKAPFTDLMMQKIASVIDPAKIDVVICNHVEMDHSGALPAVMEKAKNATMYCPAAGERGLGMHYDTS-SWKIQTVKTGDTLN-VGKHTLSFTLMPMVHWPDSMMTYMADEKILFPNDAFGQHYATDEIFDDENLDIIMDEAKKYYGNIVMPYGAQVQKVLEAASSLDIEVIAPSHGVIWRK-HIPEIVAKYVKWSRAVVVYDSMWG. 274
44 0.000e+00gi|922595400|dbj|GAP72222.1| flavodoxin/nitric oxide synthase [Candidatus Symbiothrix dinenymphae]  clstr ali  21  1.MKIKEIYSVGVADWNFHG--YLTQKGTSYNAYLIMD-EKITLIDTVKAHFSQELIDRISQIVSLDKIDYVVSNHVEMDHSGALPEVMKHLPNATVLTSQAGEREFKLHFN--PDWKFQIVKTGDSISL-GKRTLSFIMTPMVHWPDNMVTYCPEEKILFSNDAFGQHLASSNVFDDEPLDVIMEEAKKYYANIIMPYSAQVVGALEAVQKLAIQMIAPSHGLIW-KNNIPAILEHYTKWKKVVIAFDSMYG. 257
45 0.000e+00gi|496541440|ref|WP_009247588.1| FprA family A-type flavoprotein [Lachnospiraceae bacterium 6_1_63FAA]  clstr ali  17  9...SVVYIGVNDKTIDLFESQYKVPNGVSYNSYVILD-EKVAVMDTVDKRATEQWMENLSQALNGHSVDYLVVSHLEPDHASNVQKLAELYPDMKIVGNAKIFSMLPQFFSMDLSDRSVVVKEGDTLSL-GSHTLQFFMAPMVHWPEVMVEYEQSEKILFSADGFGKFGALD------VEEDWTDEARRYFINIVGKYGTQVQNLLKKAATLDIQTICPLHGPVL-KENLGYYIEKYLTWSSVVIAYASIHG. 255
46 0.000e+00gi|655057067|ref|WP_028505444.1| flavodoxin [Ruminococcus sp. FC2018]  clstr ali  16  5..NDVKYVGVNDHKVDLFEGQYKVPCGMSYNSYVILD-EKIAVMDTVDAGFTHQWLDNLENTMGGKAPDYLVVQHMEPDHSGSISAFVKRYPGAAIVSSAKAFDMMSRFYGVEPQSNKIVVSEGSTLEL-GKHTLNFVTAPMVHWPEVIMTYDSADKILFTADGFGKFGALD------VEQDWTDEARRYYIGIVGKYGPQVQNVLKKAAGLDIAYICPLHGPVL-SDDLGKYISLYNTWSSYVICYTSVYG. 252
47 0.000e+00JGI.Meta 7075982775 SRS024318_LANL_scaffold_61834__gene_73523 rubredoxin-oxygen oxidoreductase [Human Tongue dorsum microbiome from visit nu  ali  21  1.MKAIEIYWVGVVDWSFHG--YTTSRGSSYNAYLILD-EKVTLIDTVKHGFENEMLERIKSVIDPEKIDYVVSNHVEPDHSGGIPFIMKYAKNAKVVTSPNGLKGLRAHYG---EFDYQPVKTGESIS-IGKRTLSFLQVPMLHWPDSMMTYCPEEKILFSNDGFGQHLAASERFDDENDLSIVEEAQKYYANILMLYGRQAAKALTDAKDFDIQMIATGHGVLWRK-NVAKIVELYKKWSKAVVVYDTMW.. 257
48 0.000e+00gi|503884153|ref|WP_014118147.1| FprA family A-type flavoprotein [Oscillibacter valericigenes]  clstr ali  20  1MHCIRKVTDDSDRQHPCFEAALPIPKGMSFNSYLLLD-EKTVLFDTVDRAVQAQFFENLEYALDGRALDYVFVHHMEPDHAATLGDLMLRHPEATIVCSGKSVNMIRQFHSTDPKG-AVLVNEGDVLST-GRHHFTFYNAPMVHWPEVIVSYDSTDQILFSADAFGTFGANGVLFADEVDFDRDWESRRYYSNVVGKYGPQVLSLLSKAAKLDIQMICPLHGPVWRKNMLGKYAKWYEPEAQGVIAFASVYG. 264
49 0.000e+00JGI.Meta 7049096746 C5178333__gene_332743 uncharacterized flavoproteins [Human Stool microbiome from visit number 1 of subject 158499257] :_  ali  16  7....VKYVGVNDHQVDLFEGQYKVPNGMSYNSYVILD-EKIAVMDTVDGFFTEEWLNNVEQVLSGKTPDYLVIQHMEPDHSASIPAFLKKYPNATVVSTAKGFQFMEQFFGLPAEQRIVAANDG-VLEL-GQHSLHFVYAPMVHWPEVMMTYEATEKILFAADGFGKFGALDA------EEEWADEARRYYIGIVGKYGPQVQAVLKKAAGLDIQTICSLHGPVL-KENLGFYLEKYDKWSSVVIAYASVYG. 258
50 0.000e+00gi|973031907|gb|KUK10433.1| putative flavoprotein [Clostridia bacterium 41_269]  clstr ali  19  8.....IVDWVGKVDWEFHGEELSTHRGSSYNAYLIRD-EKTVLIDTSWAPFAEEFVENLKKEIDLNKIDYIISLHSEIDHSGALPQLMKEIPDTPIYCTTNGAKFIKSQY--HKNWNFVTVKTGDKLS-IGSQEIIFIEAPMLHWPDTMFCYLTGEKILFSSDAFGQHYAAQPAFNDLVDEDLYQEAIKYYANIVAPFSPMVERKIKEVLNLPIEMICPAHGVIWRDQIVETYLKWAKNYAENTIVYGTMW.. 260
51 0.000e+00gi|780018329|ref|WP_045439236.1| MBL fold metallo-hydrolase [bacterium UASB270]  clstr ali  17  1.MKPVEIYWVGGIDWDFHG--YLTQRGSTYNAYLIVD-EKITLVDSVKYYLCDEMFERISHLIDPAKIDYIISNHVEMDHSGSIPMIKEVAKNAAVITSPKGETGLKAHFKRDMD--FQVVKSGDTLN-IGKRTLHFVLTPMVHWPDNMVTYIPDDNVLLSNDAFGQHLASSERFDDEYPLNIIEEAQKYYANIVLPYSTQVQKALQAVGGLEIDVIAPSHGVIWRS-HIPTILAHYQKWSKALIVYDTMWN. 258
52 0.000e+00gi|496070177|ref|WP_008794684.1| FprA family A-type flavoprotein [Fusobacterium periodonticum]  clstr ali  19  1MHNVRNITENNDRRLALFENIHPIPEGVSYNSYMLLD-EKTVVFDTVDWSVTRQYVENIEYLLNGRELDYLVVHHMEPDHCGSIEELALRYPNLKIISSEKGFMFMRQFGYKSINHELIEVKEGDKFKF-GKHEIVFLEAPMVHWPEVLVSFDTTNGALFSADAFGSFKSDGRLFNDEVNWDRDWEGRRYLTNIVGKYGPHIQHLLKKAGPIKIKFICPLHGVVWRNDIIDKYDKWYEPEEKGVIAYASMYG. 268
53 0.000e+00gi|984751230|gb|KWW28356.1| flavodoxin/nitric oxide synthase [bacterium P3]  clstr ali  17  9...NIYYVGVNDRRTDMFENHMELPNGVSYNSYLIVD-DKVALIDPVEAGFIEEYLFKVKSALQGRKVDYLIVNHDEPDHSSSIAAVLREWPDVQVVGNAKTFAPLEAFYGAI--GNKKVVAEGETLSL-GNHTLQFYMLPMVHWPESMVTYEQTSGIVFSNDAFGGFGANGGIFDDQVNLAFYEDEMRYYANIIGKVAMQVVKAIEKLSALEIKMIAPSHGLIWRS-NLAWVLGKYSQWSKVVVVYGSMHG. 260
54 0.000e+00 GL0070100 [Complete] locus=scaffold11017_1:1129:2424:-  ali  16  4..QEIHYVGVNDHAIDLFESQYRVPNGMAYNSYVI-DDEKTAVIDSVDAHFTEVWLDNIRNVLGGKAPDYIIVQHMEPDHSGSLLRFLEAYPAAMVVASAKAFPMIQNFFSAVSPERQVTVGEGDTLSL-GNHTLRFIAAPMVHWPEVIMTYDSTDKVLFSADAFGKFGAQDAA------EGWDDEARRYYIGIVGKYGTQVQTVLKKAAALDIQTICPLHGPVLSGD-LSHYLDLYSKWSSYTIAYTSVYG. 251
55 0.000e+00gi|653214907|ref|WP_027427545.1| flavodoxin [Lachnospiraceae bacterium AD3010]  clstr ali  15  6...SVRYAGVNDHKVDLFEGQYDVPNGMAYNSYVIMD-EKSVVMDTVDQNFTDEWLANIERELSGKKPDYLVVSHMEPDHSANILNFLKKYPETTVVGNAQTFNMMGQFFDLPDNMNKLVVKNGDTLE-IGKNTLTFVFAPMVHWPEVMVSYMTPENVLFSADAFGKFGALD------VEEDWACEARRYYFGIVGKYGAQAQNLLKAASGLKIDVICPLHGPIL-TENLSYYLDLYDKWSEGIIIYASVYG. 252
56 0.000e+00gi|504866832|ref|WP_015053934.1| MBL fold metallo-hydrolase [Methanolobus psychrophilus]  clstr ali  21  13......IYWVGVVDWDFHG--YETPKGGSYNAYLIVD-EKIALIDTVKASFSEEMLKRIRQIVDPAKIDYVISNHVEMDHSGSLPAIMDIATNATLIASAKGKSGLCEHYRECDDWKFQVAKTGDEIKL-GKRTLMFIEATMLHWPDSMQTYLKEDKILFSNDAFGQHIATSKRFDDEVE-DVMEDAAIYYANILLPFGGQVIKYVEKVKELSIDMIAPAHGVIWRKD-PSRIIEAYGRWQKVLVIYDTMWG. 265
57 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  22  1MMIAPKIYDVGVVDWDFHG--YKTERGASYNSYLIMD-EKICLIDTVKAMYADELLDKISRVVDPAKIDYVIVNHVEPDHAGALPALVKAAPNAKFFITAQGKEAIRHYGDL---YDFQVVKDGDKLSL-GKRELTFVALPMLHWPDSMATYCADDGILFSNDAFGQHYAVAKRFDDEVDQGIFYEAKKYFANILWPYARLIDKALTKVAALDLKMIATAHGIIWRS-HIQEIIARYAAWGKGVVAYDTMWG. 258
58 0.000e+00gi|494609353|ref|WP_007367599.1| flavodoxin [Prevotella multiformis]  clstr ali  17  6..NKVYYVGVNDRNKALFEGLWPLPYGVSYNSYLI-DDEKVCLIDTVEVDFFVQFIENLREVLGDRQIDYLVINHMEPDHSGSLALLKKYYPNIQVIGNKKTFDMMAGFY--DIKDNTTEMKNGGELPL-GSHTLQFFMTPMIHWPETMMTLCKGESHLFTGDAFGCFGANGGFIDQEIDTDWAWPEMRYYSNIVGKYGTPVQNALKKLAGIHIDYICSTHGPVWHK-YVDKVISLYDRMSKYVICYGTMYG. 259
59 0.000e+00 GL0046440 [Complete] locus=scaffold30306_3:4463:5620:-  ali  17  6...DIRYIGVNDHDIDLFEAQYTVPEGMSYNSYVILD-EKVAVMDTVDGRFGGEWLGNLEKELSGRTPDYLVVQHMEPDHSANIAVFAEKYPSAKIVASKQAFVMMKQFFGTDYADRQVVAAEKDTLEL-GKHTLNFIAAPMVHWPEVIMTYDSADKVLFTADGFGKFGA----LDVAADAEWDCEARRYYVGIVGKYGAQVQAVLKKAAALDIAMICPLHGPVL-KENLGHYIDKYNIWSEGVIAYASVYG. 254
60 0.000e+00gi|1011262284|ref|WP_062181234.1| flavodoxin [Dysgonomonas macrotermitis]  clstr ali  18  1MLKPIQIKEDNDRTKALFENLWPLPKGVSYNSYLILD-EKTALFDTVDVCYSDVFFQKLETALNGRPLDYLVINHMEPDHSGSLGLLRSKYPNVEIVGNKRTADMIAGFYNIT--DNIKIIGDKEELPL-GKHNLVFYLTPMVHWPETMMTYDTTDKILFSGDAFGTFGTDGGITDRQLYPERYYDEMRYYSNVVGKFGSPVQKALEKLSDLEIDYICSTHGPTWTPEQIQKVISIYDKLSKVVIVYGSMYG. 263
61 0.000e+00gi|511067598|ref|WP_016309186.1| hypothetical protein [Enterorhabdus caecimuris]  clstr ali  21  1MLKAVEIFWVGGIDWNFHG--YTTERGSTYNAYLIMD-EKITLIDTCKRPFVDELIERIGTIVDPAKIDYIVSNHVEMDHSGGLPALAEIAPNATIVGAPKGVAGLTAHYG--EGLNLMGVKTGDTLD-IGRRTLTFVQTPMVHWPDSMVTYDEYDQILFSNDSFGQHYASSKRFDDEVGLEVLVQAKKYYANIVMPYGKNVEAALKALSGLSFDMIAPAHGIIWRS-HVPEILDMYAKWSSGLVVYDSMW.. 259
62 0.000e+00gi|524211551|emb|CCZ78584.1| putative uncharacterized protein [Roseburia sp. CAG:18]  clstr ali  17  8...AVKYIGVDDKTIDLFESQYVVPHGVSYNSYLIFD-EKVALMDTVDARGMEQWEKNLLAALDGRKVDYLIVSHLEPDHAGSIGRLVELFPEVTLVGNAKTFQMLPQFFDEVDENHKITVAEGESLSL-GTHTLNFYMAPMVHWPEVMVTYESSEKILFSADGFGKFGA----LDYEDPEGWACEARRYYFNIVGKYGAPVQALLKKAAGLDIQTICPLHGPVL-NENLGYYIGLYDTWSKGVVAYASIHG. 258
63 0.000e+00JGI.Meta 7073733236 SRS023468_LANL_scaffold_6533__gene_13543 hypothetical protein [Human Posterior fornix microbiome from visit number 1 of  ali  16  5.KNKVYYVGVNDRNKALFEGLWPLPSGVSYNSYLI-DDDKVCLIDSVQVDFFVQFIENLHEVLGDRPIDYLVINHMEPDHSGSLALLKKFYPNIQVIGNKKTFDMMSGFYGIKEG--TIEVKNGEELNL-GNHKLKFFMTPMVHWPETMMTLDVTDHMLFSGDGFGCFGANGGILDEEIDTSWAWLEMRYYSNIVGKYGVPVQNALKKLADQQIDYICSTHGPVWH-EYAQKVIALYDKMSKYVICYGTMYG. 258
64 0.000e+00gi|544870967|ref|WP_021284320.1| hypothetical protein [Clostridium sp. BL8]  clstr ali  16  1MINAANITDVNDRETYLFENLWPLDKGVSYNSYLIND-EKIAIIDTVKNTKIGDFIEKIQSQIGDKTIDYLIINHMEPDHSGAIKEITEKYPNITIVGNKKTFDILESFYGKME--NYHVVDDGDILNL-GSHQLKFYLTPMVHWPETMMTYEIKNKVIFTGDAFGGFGTDGGIFDDEVNLEFYTDERRYYSNIVGKYGAMVQKALKKLKDVDIKVVAPTHGPVWRS-NPDTIIKYYDLWSRGVIVYGSMYG. 263
65 0.000e+00gi|494500889|ref|WP_007290352.1| MBL fold metallo-hydrolase [Thermosinus carboxydivorans]  clstr ali  21  1.MNTVKIYYVGVVDWDFHG--YTTPRGVTYNSYLIID-EKVCVIDTVKAPFAAEFIERISQHIDPARIDYVITNHIEPDHSSALSALMERAPQAKVLLTEHGKAGITKYYQKEYD--FQIVKEGDVLDL-GRNKLHFLPLPMLHWPDSMVSYLDGEQILFSNDAFGQHISTTKRFDDENDIEVLYEAAKYYANILMPYGKLVPGALKKAAQFPIRMIAPSHGVVWRS-HISAILSKYEQWATGVIAYDSMWG. 258
66 0.000e+00gi|545625426|ref|WP_021748812.1| MULTISPECIES: MBL fold hydrolase [Oscillibacter]  clstr ali  17  1MHCVRTVTENNDHRLALFENIHPIPKGVSYNAYLLLD-EKSVLFDTVDWSACRQLLENLEYLLNGTPLDYLVINHMEPDHGASIEEILLRYPKVRIISTEKAFMLMRQFGFHVDGHECIQVKEGDTYSF-GDHTVTFVGAPMVHWPEAMVTFDTTNGVLFSADAFGSFIADGKLFADEVNFDRDWEARRYLTNIVGKYGPHIQLLLGKAGGIQIRYICPLHGPVWRKD-LGYFIDKYDKWSKGVIVYASMYG. 267
67 0.000e+00gi|651395738|ref|WP_026507445.1| flavodoxin [Butyrivibrio sp. MC2013]  clstr ali  16  1MKNYRNVTEDSDTRLSRFENIFPIPRGVSYNSYAVID-EKICLFDTADVSVADQYIENLQALLGDRTPDYQVILHMEPDHCSQIARVAGMYPDMTLVGSAQAFKFLHQFFPELDDMKKQIVKEGDSLST-GHHEFSFVAAPMVHWPEVLFAYDKESGALFSADAFGTFGAIEGLFADEYDFEFLDDARRYYANIVGKFGGQVQLVLKKAAGLDIKYICPLHGPVWRKD-ISWFIDKYQKWSSYLLVYGSLYG. 265
68 0.000e+00gi|737285168|ref|WP_035268490.1| MBL fold hydrolase [Desulfitibacter alkalitolerans]  clstr ali  20  1MKITDSVTWVGKVDWHFHGYELSTHRGSTYNSYLIRDK-KNVLIDTAWTPFAHEYVDSLEKVIDLKDIDFIVANHSEVDHSGALAALMKRIPDTPIYCSKNGAKMLKA--QMHKDWNFEIVKTGDKVNL-GDKELIFIEAPMLHWPDSMFCYLTGDNILFSNDAFGQHYATEVLFNDLVDCELIAEAMKYYANILTPFSKFVPKKIEEFLNVPLDIICPSHGVIWRDQIVELYAKWADNYQENTVIYDTMWN. 259
69 0.000e+00gi|780009324|ref|WP_045435685.1| flavodoxin [bacterium UASB270]  clstr ali  16  8...SQEIAWVNDRETHLFEALWPLPEGISYNAYMICD-EKVALIDTVKINSALSYLEKISAMLPGKKVDYLIINHMEPDHSGSIKVLLQQFPDLQIVGNKKTMGFLEGFYDITE--NLHVVKDGDVLDL-GKHKLRFYLTPMVHWPETMMTYDTVDKVLFSGDAFGGFGTDGGIFDDEVNIAFYKDERRYFSNIVGKFGKPVLNAIQKLQNLDIRVVAPTHGPIWRQD-PAHIVEDYRRWSAVVIAYGSMYG. 262
70 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  17  45...TIKYVGVNDHQVDLFEGQYKVPNGMSYNSYVILD-EKIAVMDTVDANFTHEWLDNIQKVLGDRKPDYLIVQHMEPDHAANIANFLKAYPDTIVVSNKKAFAMMQNFFDLDLESHQIIVDNGGTLSL-GKHNLTFVFAPMVHWPEVMVTYDSTEKVLFSADGFGKFGALDA------DEPWDDEARRYYIGIVGKYGVQVQNLLKVAATLDIQTICPLHGPVLTED-LGHYISLYDTWSSYVIAYTSVYG. 291
71 0.000e+00 GL0151209 [Complete] locus=scaffold57105_1:4862:6013:-  ali  19  6...AIRYVGVNDTDIDLFESQYPVPHGVSYNSYLLLD-DKIALLDTVDKRKYDDWAAKVDAVLDGRTPDYIVVHHLEPDHAGSLQMTIEKYPEATLVLSAKALAMLPQFFDLPAGTKTLSVKEGDTLEL-GHHTLTFVMAPMVHWPEVMVSYEQTEKVLFSADAFGKFGAVG------TDEPWPEEARRYFINIVGKYGAPVQTLLKKAAALDIATICPLHGPILQGDLTP-YLHLYNTWSRGVIAYASIYG. 252
72 0.000e+00gi|914220410|ref|WP_050536416.1| anaerobic nitric oxide reductase flavorubredoxin [Yersinia mollaretii]  clstr ali  18  8.....NIKWVGQRDWDFHGTEYKTLKGTSYNSYLIR-EGKNVLIDTVDQKFGRDFVANLEREIDLNALDYIIINHAEEDHAGALTELMARIPHTPIYCTTNAIDSINGH-HHHPEWNFITVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYITGDAVLFSNDAFGQHYCDEHLFNDEVDQELYEQCARYYANILTPFSRLVTPKINEILGLPVSMIATSHGVVWRDQIVAKYLEWAADYQEDTIFYDTM... 261
73 0.000e+00gi|524500376|emb|CDC38962.1| putative uncharacterized protein [Clostridium sp. CAG:352]  clstr ali  14  9...SIRYIGADDLDIDLFESQYVVPNGISYNSYVILD-DKITVMDTIDKRKTDEWLENLEKVLDGKKPDYLVVQHLEPDHAASLKILADKYPEMKLVGNVKTFAMIPQFFDIDLEDRKVVVKEGDALN-IGSHTLKFIMAPMVHWPEVMVTYEESEKVLFSADGFGKFGALS------TDEDWTCEARRYYFNIVGKYGFQVQALLKKASALDIQMICPLHGPIL-KENLGYYINKYDIWSEGIVAYASIHG. 255
74 0.000e+00gi|544351848|gb|ERL10523.1| metallo-beta-lactamase domain protein [Olsenella profusa F0195]  clstr ali  19  19MYNVREIWWLGDRRLELFENVYPLPEGMAYNDYLIM-SEKTCLVDGVDAAVRDQFEENLTHVLAGRPLDYMVVQHMEPDHCAIIPELLRAHPKLKILASAQAIRMMGQFFDVDVASRTQAVKEGDTLDL-GGHALSFVSAPMVHWPEVMVSFDAATGALFSADAFGAFGASGNLFADEVEWERDYEARRYYANIVGKYGPQTTALLKKASALDIRLILPLHGHLWRQDFVNRYVKWYTPEDSVCIFYGSVYG. 283
75 0.000e+00JGI.Meta 7056027789 SRS047824_WUGC_scaffold_54149__gene_82369 flavodoxin/beta-lactamase domain-containing protein [Human Tongue dorsum micro  ali  18  1MVNVQQIYWAGDRRLSRFENLFPLPHGVSYNCYLIRD-EKTALLDTADVTVKSQFMENIVAALQGRKLDYLVLHHVEPDHCSQVQAVLDVYPDVTLVGNEKTFRILDQFFTGTKNCAKTTVADGDVLEL-GKHKLQFVLTPMLHWPETMMSFDAVTGALFSGDVFGTFGADTGIFADECDFKFLDDSRRYYANIVGKYGVQAQAGLKKTAGLDIRMICPLHGPVWRS-NIDWILQKYQKWEEGTIVYGSMYG. 265
76 0.000e+00gi|647530812|ref|WP_025821270.1| anaerobic nitric oxide reductase flavorubredoxin [Shewanella marina]  clstr ali  20  8.....NIHWVGQRDWDFHGTEFKMTKGTSYNSYLIR-EQKTVLIDTVDHKFSHQFVQNLEMEIDLNSIDYIVINHAEEDHSGALTALMAKIPNTPIYCTENAIDSIVGH-HHHPEWNFHVVRTGDTLDIGNGKQLIFVESPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQELMEQCLRYYANILTPFSSLVVAKIKEVLNLPVDMIATSHGIVWRDQIIHKYLEWASDYQEDTIFYDSM... 261
77 0.000e+00gi|501422500|ref|WP_012447170.1| flavodoxin [Natranaerobius thermophilus]  clstr ali  18  1MNNTVAITDVNDRVSELFEAIWPLPDGVSYNSYLIND-EQVALVDTVKDSEINTYLQNIKNVIGNRSVDYLIINHMEPDHSGAIEALRREYPNITLVGNQKTLTFLEQFYGIVE--NIKIVDDGDQLQL-GQHTLNFYLTPMVHWPETMMTYEQKEKILFSGDAFGGFGTEGGIFDDEVNLDFYQEERRYFTNIVAKYGPMVEKAISKLADLDVKIIAATHGPVWR-EKPEQIIADYSRWSRVVVVYGSMYG. 261
78 0.000e+00gi|503232459|ref|WP_013467120.1| MBL fold hydrolase [Thermococcus barophilus]  clstr ali  19  1.MKAVKIYWVGVKDWRIFDSLIPLPEGTSYNAYLVVGREKTALIDTVNPGFERELEEKINEIVDVADIDYIVMNHAEPDHSGAIPYLLERNKKVILIATEKGANMAKAYYDVPDER-IMVVKDGDTVSL-GGKTLRFIEAPWLHWPETMFTYLVEDKILFPCDFFGAHLA-GGFYDDDVP-DLLTHAQRYFGEIMMPFSAMAKKALKKIEGLEIKIIAPSHGPIYR--NPRRIIEAYKKWSSGIIAYVSMWG. 257
79 0.000e+00JGI.Meta 7021032972 C778695__gene_52826 hypothetical protein [Human Posterior fornix microbiome from visit number 2 of subject 159005010] :_  ali  18  8.....KVTWVGKIDWEFHGDEYSTHRGSSYNSYLIRDK-KTVLIDTVWLPFDKEFVARLKQEIDLQKIDYIVMNHNEVDHSGALPELMREIPNVPIYCTKKGEAIIRGHY--HQEWNFVNVKTGDTLDL-GDSKLTFIEASMLHWPDTMFTYMSGENILFSNDAFGQHFASESLYNSNVPQDLYFETAKYYTNILNLYSPMVNRKVKEAMNLPIDLICPSHGIIWKENPVETYLKWSQAYQENTLVYDTMWN. 261
80 0.000e+00gi|499661923|ref|WP_011342657.1| MBL fold hydrolase [Pelobacter carbinolicus]  clstr ali  19  1MHFPVIVTWVGKTDWEFHGEEYSTHRGSTYNSYLVQDQ-KTALIDTVWAPFAKSYIEELFQKVSPEEIDFVIANHAEIDHSGALPELMRHLPGKPIYCTANGVKSLKGHY--HADWNFQVVKTGDRLSL-GDRELIFIEAPMLHWPDSMFCYLTGEDILFSNDAFGQHLAAEEAYNDRVDSCELWECIKYYANILTPFSPLVLKKIEQFAGLPLKMICPSHGVLWRDQIVQKYLEWANQYREVTIIYDTMWN. 261
81 0.000e+00gi|82524116|emb|CAJ19147.1| putative flavoprotein [unidentified microorganism]  clstr ali  20  8.....KVTWVGKIDWEFHGDELSTLHGSSYNSYLIQD-EKTVLIDTVWLPYDREFVSRLKEVVDIHKIDYIVMNHNEVDHSGALVELMREIPDTPIYCTKKGEAILRGHY--HQDWNYVNVKTGDKLS-IGSSTLTFIEAPMLHWPDTMFTYMSGDEILFSNDGFGQHYATESLFDECVDLEVLYEAEKYYCNILNPFSMMVKRKVAEILNLPIKMIAPSHGIIWRENIIEKYQKWCDAYQEDTIVYDTMW.. 260
82 0.000e+00 GL0056408 [Complete] locus=scaffold3559_7:3777:5018:+  ali  17  18MYCGQKIYWTGDRRKHLFENMWPLPEGVSYNSYLIKD-EKCALMDTVESGSDRSYLDWLADTLEGRPLDYLVIHHMELDHSGEIENLIRQYPDVRIVGNAKTFRVLEAYFGKLP--NLVEVKDGDTLSL-GYHNLKFVFTLWVHWPETMMSYDTTDGVLFSGDAFGMFGADGGVFDDQVDFARYEEMRRYYSNIVGKYSGMVQKALAKLSSARIGAICPLHGLVWRSD-PARVIGLYDRWSRAVVIYASMYG. 278
83 0.000e+00gi|503035841|ref|WP_013270817.1| MBL fold hydrolase [[Clostridium] saccharolyticum]  clstr ali  20  1MKKLVKVYWVGFMDWEFHGADYSINHGSSQNAYLIK-EEKTVLIDTVWRPHSTEFMDNLEREIDLKEIDFIVANHGEVDHSGSLPALMEKIPGTPIYCTANGVKSLTGQYH-HPEWNYQVVKTGDSIDIGNGKKLVFVEMKMLHWPDSMATYLTGDNILFSNDAFGQHYAVEELFNDKADQCRLWEAIKYYANILTPFSPLVKKKIEEIQGLPIDIIATSHGSIWREQIVEKYYEWSQNYQEDTIVYDTMW.. 262
84 0.000e+00gi|652854315|ref|WP_027128391.1| FprA family A-type flavoprotein [Fusobacterium perfoetens]  clstr ali  19  1MYNIRKISESDDIRLELFENIHPIQKGVSYNSYLLLD-EKTVLLDTVDSSKGKEFLEKIKVVLNGRALDYLIVHHVEPDHGAMIGEVVTLYPNIKVIASKQAFVFIKQFGANIKEENMIVVKEGDKISF-GKHEFTFVGAPMVHWPEALVSYESTTKTLFSADAFGTFGCLGKLYDDDFNLELLEEMRKYYTNIVGKFGVQVQTLLKKASGLDIKMICPLHGPIWRT-NLSLLLDKYNKWSKVLIVYASMYG. 265
85 0.000e+00gi|931527985|gb|KPL05060.1| MBL fold metallo-hydrolase [candidate division Zixibacteria bacterium SM1_73]  clstr ali  20  1.MKPIKIFWVGGIDWDFHG--YLTQRGSTYNAYLILD-EKIVLVDTVKYYLFEEMLSRIKEVVDPSRIDYIVANHVEMDHSGSLSKILRIATNAKVITSPHGEKGLRRHFK--EEWDFKVVKSSDSVN-IGKRTLQFFLTPMVHWPDSMATYVPEEKLLLPNDAFGQHIASAERFDDQVGWNLYQEAAKYYANIVLPYGEQVKKALEALSALNIEMVAPSHGVIWRS-HLSKILEAYQKWAKALIAYDTMWG. 258
86 0.000e+00gi|914871696|ref|WP_050741119.1| MBL fold metallo-hydrolase [Acetobacterium bakii]  clstr ali  20  1MNKIIKVSWVGKVDWEFHGNEFSTNHGSTYNSYLIR-EEKNVLIDTVWMPFAKDFVENLSKEINLDEIDFIVANHGEVDHSGSLPALMERIPNVPIYCTANAVKSLKGQY--HQDWNFHVVKTGDKIDIGNGKELIFVEMRMLHWPDSMATYLTGDNILFSNDAFGQHYATEKLFNNLVDCDLYQEAIKYYANILTPFSAILRKKLDEIIGLTIDIIATSHGVIWQDQIVTKYAQWAGDYQENTIIYDTMWN. 262
87 0.000e+00 GL0008591 [Complete] locus=scaffold22697_1:5546:6736:+  ali  21  1MMNIVHYVGVNDRVKHRFEGLWFLPYGVSYNAYLIND-EKVALVDTVDVAFFSEFLDHIHEVIGNKPIDYLIINHMEPDHSGSIPLIRKYYPNIKLVGNAKTLDMVKGYYCAVAPEDV-TVKEGSTLDL-GHHKLSFHLTPMLHWPETMMTYDQTEKILFSGDAFGCFGANGHVIDRHMDTSIYWPEMRYFAAILGKFTPMVQRAIPKLATLDIQMICSTHGPVWEQE-VSKAIATYQRLSSGVICYGSMYG. 259
88 0.000e+00gi|495066082|ref|WP_007790907.1| flavodoxin [Peptostreptococcus stomatis]  clstr ali  18  10..KDLYYIGVNDRDTNLFENMWPLPEGVAYNSYLIVD-EKTALLDTVKITKVNGFIENLKKNLNGRDLDYLIIHHMEPDHSGCYLSVLDVYPNLTFVGNKKAKAMFKDYLDMEPE-NFIEVKDGETLSL-GKRTLTFVNTPMVHWPESMVSYESTDKILFSQDIFGGFGANGTIFDDEMNFDFFRDEMRYYSNIVGKYSKQAAKALEKVKALDIKVICPVHGIVWRTHIIDEYIRLANNEEGVVIAYGSMYG. 263
89 0.000e+00gi|1007513570|gb|KYH41454.1| lactamase [Candidatus Bathyarchaeota archaeon B26-2]  clstr ali  19  7...SKNVYWVGAVDWDFHG--YETRRGTTYNAYLVID-EKTALIDTVKHAFQNELVGNIQELTSLRDVDYVVVNHVEKDHSSSLPSIMRYAKNATIVSTRRGRDGLTKYYG-GGDWTFKIVETGDELNL-GKRTLSFVEAPMLHWPDSMFTYLKEDEILMPNDAFGQHLASSQRFDDEVDQALMDEAAKYYANILMPFASLILKKVEELSDLGIEMIAPSHGVIWRS-NPKKIVDSYVKWSKAVIIYDTMWG. 261
90 0.000e+00JGI.Meta 7079554577 SRS064276_LANL_scaffold_63184__gene_136427 hypothetical protein [Human Stool microbiome from visit number 2 of subject 7  ali  18  5..NDIKYVGVNDHEIDLFESQYVVENGMAYNSYVIMDK-KIAVMDSVDAHFTHEWLDNIQNVTGRKAPDYLIVQHMEPDHSANIMNFMKLYPEAKVVSSAKAFAMMGQFYGEDFSDRQIIIKEGDTLSL-GTHELSFVAAPMVHWPEVMMTYDAHDKVLFSADAFGKFGALD------VEEDWACEARRYYFGIVGKYGTQVQNLLKKAAKLDIQTICPLHGPVL-SENLGYYLNLYNIWSSYVIAYTSVYG. 252
91 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  19  7MHCAQKLTDNNDWDTERFENLFPIPLGVSYNSYFI-DDEKTCIVDSVDDSIRQEFFDNVEHLLNGRQLDYLIVNHMEPDHCSTLVELIDRYPNVKMVGNRTTFRLFEQFYGRPCPDNYYEVKEGSTIEL-GKHTLHSYTMPMVHWPEVTCTFESTTGILFSADAFGTFGTNGNIFADQLDFERVYEARRYYTNIVGKYGVQVQNAIKKALPLGIKMIAPLHGPIWRTPMIQKYMHWYSAEKKGVVIFGSMYG. 273
92 0.000e+00gi|494309585|ref|WP_007174296.1| flavodoxin [Prevotella bergensis]  clstr ali  17  1MKKIVYYVGVNDNSKQLFEGLWPLPEGVTYNSYLVVD-EKVCLMDTVETGFFPQFLANIREVIGDRPIDYVVVHHMEPDHSSSLSLLREFYPDIKIVGNKKTFDMMGGFYGIDDG--CVEVKNGDSLSL-GKHTLNFYLIPMVHWPETMLSVDVTTHVAFTGDAFGCFGANGGVIDSEINTEKYWLEMRYYANIVGRYGTPVQNALKKLADVRIDYLCPTHGPVWH-EHAAKVVSLYDKMSKYVIAYGTMYG. 258
93 0.000e+00gi|304371092|gb|EFM24709.1| metallo-beta-lactamase domain protein [Peptoniphilus duerdenii ATCC BAA-1640]  clstr ali  15  3MYKIREVAEDNDKRIELFENMFPIPDGVSYNSYLLLD-EKTVLVDSVDWSIARDYLERVREVLNGRPLDYLLIHHMEPDHCGAIEEVLLRYPKCKIISSEQAFDIMRQIGYKIPDENIEIVKEGDTRSF-GKHTLAFIEAPMVHWPEVIMSFDTYNGVLFTADGFGSFKADGKLFNDEVDWDRDWEGRRYLTNIVGKYGPFIQDVLKKAGPLQVKYICSLHGLVWR-NNFGYIIDKYDKWSKVLIVYGSMYG. 269
94 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  16  1MYITIIYTGVNDHQVDLFEGQYPVPNGMCYNSYVIRD-EKIAVMDTVDQNFTHEWLDNVQKALNGRKPDYLIVQHMEPDHSANIENFLKVYPEAVIVANAKTFAMISNFFSLNLEGRMLEVKNGDTLDL-GNHVLTFVFAPMVHWPEVMVTYDSRDKVLFSADGFGKFGAMD------VEEDWDDEARRYYIGIVGKYGVQVQNLLKAAASLDIQTICPLHGPVL-KENLGHYIKKYQIWSEGVMIYTSVYG. 253
95 0.000e+00gi|502816503|ref|WP_013051479.1| anaerobic nitric oxide reductase flavorubredoxin [Shewanella violacea]  clstr ali  19  8.....NIHWVGQRDWDFHGTEYKITQGTSYNSYLIR-EEKTVLIDTVDQRFSMQFLQQLESEIDLNEIDFIVINHAEEDHSGALGALLAKIPDTPIYCTENAIDSITGL-HHHPEWNFNVVKTGDTIDIGNDKQLIFIESPMLHWPDSMMTYLTGDGVLFSNDAFGQHYCDEHLFNDEVDQELMEQCLRYYSNILTPFSALVTAKINEVLNLPVEMIATSHGVVWRDQIIHQYLEWANNYQEDTIFYDSM... 261
96 0.000e+00gi|646614817|ref|WP_025563588.1| anaerobic nitric oxide reductase flavorubredoxin [Psychromonas sp. SP041]  clstr ali  20  8.....NIHWVGQRDWEFHGTEYKMTKGTSYNSYLIR-EEKTVLIDTVDHRFSHQFIQNLEMEIDLESIDYIVINHAEEDHAGALSALMERIPNTPIYCTNAAIDSIVGH-HHHPEWNFKTIKTGDSLDIGNGKQLVFVEAPMLHWPDSMMTYITGDAVLFSNDAFGQHYCDERLFNDEVDQELMDQCLRYYANILTPFSALVIAKIKEVLNLPVDMIATAHGIVWRDQIIEKYLEWAGDYQEDTIFYDTM... 261
97 0.000e+00gi|917057680|ref|WP_051664392.1| flavodoxin [Lachnospiraceae bacterium AC2029]  clstr ali  14  8...TIRYIGVDDKDLDLFESQYEVPNGMAYNSYLIID-EKIAVMDTVDERGEEEWLENLERELAGRKPDYVVIQHLEPDHSGSLAKLISLYPEIQLVGNAKTFQMLPQFYPIDTEGKTVVVKEGDTLSL-GSHTLQFFLAPMVHWPEVMMTYEQSEKVFFAADAFGKFGTLD------TDEDWACEARRYYFNIVGKYGAPVQMLLKKAAALDIKVIAPLHGPIL-SENLEYYIGLYDTWSKGVIAVASIHG. 254
98 0.000e+00gi|749816977|ref|WP_040295810.1| flavodoxin [Barnesiella intestinihominis]  clstr ali  16  1MMKITEITGVNDRCKYKFENLWPLPYGVSYNAYLITDK-KNVLIDTVDAAYTDRLLDNIAEIIGDGKIDYLIINHMEPDHSASIQFIRQKYPQMTIVGNIKTLEMVKGYYGI--DDNTLCIKNGESLS-IGKRTLTFHLTPMVHWPETMMTYVNEDKLIFSGDAFGCFGTDGGITDSQLNTDKYWSEMRYYSNIVGKYGPAVQTALKKLSDIEIKTICSTHGPIWEKE-ITRVIGIYDRLSRVVIAYGSMYG. 261
99 0.000e+00gi|524844854|emb|CDF44326.1| uncharacterized flavoproteins [Roseburia sp. CAG:100]  clstr ali  15  5..NNIKYVGVNDHQVDLFEGQYQVPNGMAYNSYIILD-EKIAVMDTVDGAFAEEWLQNVEQVLAGRKPDYLVIQHMEPDHSASIPAFLQRYPETVVVSTAMGFKYMEQFFPEIESEKRSVAANGGTLEL-GSHTLHFVYAPMVHWPEVMMTYEASEKILFAADGFGKFGALD------VEEDWVDEARRYYIGIVGKYGAQVQAVLKKAATLDIQMICSLHGPVL-KDNLGFYLEKYDKWSSVVIAYASVYG. 254
100 0.000e+00 GL0083511 [Complete] locus=scaffold13120_6:1082:2269:-  ali  17  1.MNITEIVGVNDRTTTRFEGLWSLPQGVSYNAYLVAD-EKVALIDTVEEGFGSRLTENIREAIGDRKIDYLVINHMESDHSSSVRALRMLYPDIQIVGNAKTLQMLQGFYGIDTG--TLEVKEGDSISL-GSKTLSFYMAPMVHWPETMVTWCAEAGTLFSGDAFGTFGADGGITDSQIDPSRYWDEMRYYACIVGKYGGPVQKALAKVRGLNPTTICSTHGPVWQREIPQ-VMDVYDRLSRVVIAYGSMYG. 260
101 0.000e+00gi|737676088|ref|WP_035645273.1| flavodoxin [Lachnospiraceae bacterium FE2018]  clstr ali  17  5..NDIKYVGVNDHQIDLFEGQYVVPLGMAYNSYVILD-EKIAVMDTVDRNFTHEWLDNIANAIGDRKPDYLIIQHMEPDHSANIANFLKIYPDAQVISNAKAFKMMDQFFGADAVQSRVTVKNGETFSL-GKHDLTFVFAPMVHWPEVMVTYDSTDKVLFSADGFGKFGA-----NDVEDPEWACEARRYYFGIVGKYGAQTQNLLKAAAGLDIQVICPTHGPVL-SENLGYYLDLYDKWSSYTIAYTSVYG. 254
102 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  15  5..NDIRYVGVNDHQVDLFEGQYKVPGGMAYNSYVILD-EKIAIMDTVDKNFTHEWLDNIQSALGGRKPDYLVVQHMEPDHAANVGNFMKLYPETTIVSSAKAFNMMGPFFGTCYEDRRIVVGEGDTLSL-GKHTLAFVAAPMVHWPEVIVTYDVLDKVLFSADGFGKFGALD------VDEPWDDEARRYYIGIVGKYGAQVQALLKKAATLDIQTICPLHGPVL-KENLGHYIRLYDLWSSVVIAYTSVYG. 252
103 0.000e+00gi|974223278|gb|KUO64119.1| MBL fold metallo-hydrolase [Gracilibacter sp. BRH_c7a]  clstr ali  18  1.MKPIKL-KDNIYWVGAIDWNYLTQRGTTYNAFLIID-EKITLIDTVKYHLVDEMLERISEIIDPADIDYVISNHVEPDHSGSLPEILAIAKKAAILTTPNGEKGLKAHYK--EDWNFQVTKTGEVLN-IGKRNLTFVHTPMVHWPDNMVTYLPEEKILFSNDAFGQHIASSERFDDQLPLGIMEEAQKYYANIVLPFGTQVKKALDALANLELDIIAPSHGIIWRS-NLPAILSEYDKWDKAVIVYDTMW.. 257
104 0.000e+00gi|786805389|dbj|GAO27878.1| flavoprotein [Geofilum rubicundum JCM 15548]  clstr ali  19  1MYQPINLTDVNDRRTHLFENLWPLERGVAYNSYVINDH-KVALIDTVEIGHVDQFLKKVRAVIGDKPIDYLVINHMEPDHAGSVQILTELYPDMQLVGNKKTIPMVEGFFGINDKDKFIEVGEADVLML-GENTLQFHMIPMVHWPETMVSYVQEQKLLFSGDAFGSFGTDGGVFDDEVEFDYFKDEMRYYSNIVGKYGNPVQKALDKLSGLEIEMIAATHGPIIRT-HIAEMLEMYDAWSKVVIAYASMYG. 263
105 0.000e+00JGI.Meta 7014905518 SRS050422_LANL_scaffold_92711__gene_170198 uncharacterized flavoproteins [Human Stool microbiome from visit number 2 of  ali  17  43...DIIYVGVNDHDVDLFEGQYIVPNGMAYNSYVIRD-EKIAVMDTVDGRFAEEWLANIEKALDGVTPDYLIVQHMEPDHAANIQVFAEKYPSAQIVGNAKTFTMMKNFFHLELDGKTVEVKNGETLNL-GKHELTFVFAPMVHWPEVMVTYDSSDKVLFSADGFGKFGA----LDVEEDWD--CEARRYYIGIVGKYGAQVQNLLKVAATLDIQIICPLHGPVL-TENLGHYIEKYNIWSEGVMIYASVYG. 290
106 0.000e+00gi|375302130|gb|AFA48264.1| anaerobic nitric oxide reductase flavorubredoxin NorV [Acetobacterium woodii DSM 1030]  clstr ali  22  6MKKQIKVCWVGKVDWEFHGNEFSTHHGSTYNSYLIQ-EEKTVLIDTVWLPYAKEFVANLARVIDLEEIDYIIANHGEVDHSGALPELLKHIPDVPIYCTENAAKSLKGQY--HQDWNFQVIKTGDKLDLGNGKELIFVEMRMLHWPDSMATYLTGDNILFSNDAFGQHYATDKLYNNLVDCDLIKEALKYYANILTPFSAILRKKLDEILNLAIDVIATSHGVIWNDQIVEKYLQWAADYQENTIIYDTMWN. 267
107 0.000e+00JGI.Meta 7047471396 SRS051791_LANL_scaffold_1279__gene_1910 flavoprotein [Human Tongue dorsum microbiome from visit number 2 of subject 7650  ali  18  7MYNVRKIQDDSDRRLEKFENTYSVPAGMSYNNYLILD-EKTCLVDGIDYNVAQQFFENLEFALQGRTLDYMIVNHMEPDHCAIIPQLVQMYPNMKLIGSMQAFKMMNQFYRFETDSRSIVVKENDTLNL-GKHNLKFITAPMVHWPEVIVTYDETAKILFSADVFGSFGASGNVFADEVDWEHDWESRRYYTSIVGKYGMQASAVLKKVSNLEIKMICPLHAHIWRKDF-DKIISLYEKWTSVAIFYGSVYN. 271
108 0.000e+00JGI.Meta 7037839616 SRS014923_WUGC_scaffold_15923__gene_23367 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  19  6...AIRYVGVNDTDIDLFESQYPVPHGVSYNSYLLLD-DKIALLDTVDKRKYDDWAAKVDAVLDGRTPDYIVVHHLEPDHAGSLQMTVEKYPEATLVLSAKALAMLPQFFDLPAGTKTLSVKEGDTLEL-GHHTLTFVMAPMVHWPEVMVSYEQTEKVLFSADAFGKFGAVG------TDEPWPEEARRYFINIVGKYGAPVQTLLKKAAALDIATICPLHGPVLQGDLTP-YLHLYNTWSRGVIAYASIYG. 252
109 0.000e+00 GL0028535 [Lack 5`-end] locus=scaffold219302_3:1:1185:+  ali  16  17...SIIYIGVDDKDIDLFESQYVVPNGVSYNSYVIMD-EKIAIMDTADARVTDKWFENLRAALGDRKPDYLIVSHMEPDHASNIQKAAEAYPDMKIVGNAKTFPMMAQFFDIDLTDRKVVVAEGDTLSL-GEHELTFVMAPMVHWPEVMMEYESKDKVLFSADGFGKFGALD------TDEDWACEARRYYFNIVGKYGAQVQAVLKKAAGLDINIICPLHGPIL-KENLGYYIDKYNTWSS........... 246
110 0.000e+00gi|738964202|ref|WP_036848062.1| flavodoxin [Porphyromonas cangingivalis]  clstr ali  17  15........GVNDRTKELFEGLWPIPNGVAYNSYLIKD-EKNVLLDTVDICYSERFLQRLESALEGEPLHYLIVNHMEPDHSGSIALLRTKYPDVQIVGNKKTLDMVMGYFGI--NTNCLEVEDGGELN-IGSRTLKFVFAPMVHWPEVMFTYDPKEKTLFSADAFGSFGTDGGIFDDQVCREKYLQEYRYYSNIVGKYGTFTQKALAKASGIEIDTICSTHGPVWRT-HKAEIISLYDRLSRVVVAYGSMYG. 261
111 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  18  7..KDIIYVGVNDHDVDLFEGQYIVPNGMAYNSYVIMD-ERIAVMDTVDAHFGEEWLSNVKEALNGREPDYLVVQHMEPDHSANVANFVAAYPNAKIVGNAKTFAMIADFFDITPEENKVTVANGESLSL-GAHQLTFVFAPMVHWPEVMVTYDAKDKVLFSADGFGKFGALD------VEEEWDCEARRYYIGIVGKYGAQVQALLKKAAALDIAIICPLHGPVL-KDNLAHYINLYDIWSEGVMIYTSVYG. 255
112 0.000e+00JGI.Meta 7007304427 SRS016095_WUGC_scaffold_12439__gene_29412 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  15  8...SIRYIGVDDLDIDLFESQYIVPNGVSYNSYLILD-EKIAVMDTVDCRKTEEWLARLTEELNGRTPDYLIVQHMEPDHAGNIGKLAEMFPDMTIVVSNKAAQMLPQFFHTDFTERTKVVKEGETLSL-GQHTLQFFMAPMVHWPEVMVTYEQSEKVLFSADGFGKFGALSH----EEDWA--CEARRYYFNICGKYGVQVQNLLKKAATLDIAVICPLHGPVL-KENLGYYIGLYDTWSKVLVAYASIHG. 255
113 0.000e+00JGI.Meta 7046120596 C2059140__gene_177305 hypothetical protein [Human Stool microbiome from visit number 2 of subject 604812005]  ali  18  6...DIRYVGVNDHAVDLFEGQYTVPNGMSYNSYVILD-DKIAVMDTVDAHFTHEWMDNLQNLLGDRAPDYLIVQHMEPDHSANIANFMKLYTNATIVSSAKAFAMMEQFFGTDYADRRIVVGEGDTLPL-GKHTLTFVTAPMVHWPEVIMTYDTADKVLFSADGFGKFGALD------VDEPWADEARRYYIGIVGKYGAQVQSVLKKAATLDIAAICPLHGPVL-TENLGYYLGLYNTWSSYVIAYTSVYG. 252
114 0.000e+00gi|740882374|ref|WP_038667622.1| MBL fold metallo-hydrolase [Pelosinus sp. UFO1]  clstr ali  19  1MMNNVQIYSVGAVDWDFHG--YATPRGITYNSYLIVD-EKICLIDTVKAPFGAELLERVSQIVDLTKIDYIVCNHTEPDHASALPMVMEKAPQAKVVLTAQGKESIIKHYQKDYD--FQVVKEGDALDL-GRNQLKFITLPMLHWPDSMASYLTGEEILFSNDAFGQHICTSNPFDDENEIDIMQEAAKYYANILLPYTRLVGGALKKAETVPIKMIAPSHGVIWRS-HITDILKKYEQWGTGVIVYDTMWG. 259
115 0.000e+00gi|769209719|ref|WP_044973718.1| flavodoxin [Ruminococcus sp. HUN007]  clstr ali  16  5..NDIRYIGVNDHVTDLFESQYIIPEGMAYNSYVIFD-EKIAVMDTVEGKFGDEWLGNLKNALDGKTPDYLIVQHMEPDHSANILNFIKAYPEAKIVGNIQTFNMMGQFFETLPEFEKVTVKDGETLSL-GKHELAFVFAPMVHWPEVMLTYDSTDKVLFSADAFGKFGA-----LDAEEDEWDCEARRYYFGIVGKYGMQVQKLLKTAADLDIQTICPLHGPVL-SENIAYYINKYDIWSRGVIAYASIHG. 253
116 0.000e+00JGI.Meta 7066444476 C2693313__gene_115226 hypothetical protein [Human Buccal mucosa microbiome from visit number 2 of subject 159814214]  ali  16  5MHQERLVCDNSDRRLNRFENIFPLPNGVTYNSYLIMD-EKTVLLDTVDKSIVKPFIENLEHTLNGRKLDYLIINHMECDHAASLEEVLFRHPEVTLVGNAKTFALIEQFFDFKGQYNKLEIKEKDTLD-VGSHKFTFLFAPMVHWPEVMVVYEEKNKMVFSADAFGTFGASGNIFSDEVNFEWLDEARRYYTNIVGKYGVQTLNLIKKLTAYEINYICPLHGPIWRKELITKFIEKYTTWASVVIFYGTVYG. 271
117 0.000e+00gi|517534189|ref|WP_018704397.1| MULTISPECIES: hypothetical protein [Veillonellaceae]  clstr ali  19  1MLNQIEIYYVGAVDWDFHG--YNTPRGVTYNAYLVVD-EKICLIDNVKAPYTEELLERISQIVDPSKIDYVITNHVEPDHSGSLPKLMERAPQAKVVLTNQGKDEVIKYYGKEYD--FMTVKQGDVLD-IGRNKLHFVPLPMLHWPDSMATFMEGENILFSNDAFGQHVCTSKRFDDENELPVMYEAAKYYANILMPFGKLVVRALDKVSSLPLNMIAPSHGLIWRS-HIQEILAAYKRWGSGVIVYDTMWG. 259
118 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  19  1MLKTIQIFYVGDKTLDLFESQYPVPDGVSYNAYVIRD-EKTALLDTVDPRATNQWLEQVTEVLDGTAPDYLVISHMEPDHAGSIRAVTERYPDMTLVGSAKALGMLPQFLGDMPGNPTRTVKEGETLEL-GSHTLHFVMAPMVHWPEVMVCYESGEKVLFSADAFGKFGALD------TDQPWTDEARRYYLNIVGKYGAPVQTLLKKAAKLDIRTICPLHGPVLTGD-LAPYLEKYQTWSKGVVAYASIHG. 256
119 0.000e+00gi|524311373|emb|CDA67652.1| uncharacterized flavoproteins [Clostridium sp. CAG:510]  clstr ali  14  6...SVKYVGVNDHQVDLFEGQYRVPNGMAYNSYVIMD-EKTAVMDTVDGSFSEEWLQNLETVLEGKTPDYLVIQHMEPDHSASIPAFLEKYPEVTVVSTAMGFKFMEQFFPEYFARAGIEKKNGGTLEL-GEHTLHFVYAPMVHWPEVMMTYESAEKILFAADGFGKFGALD------VEEDWTDEARRYYIGIVGKYGAQVQAVLKKAATLDIRTICSLHGPVL-KDNLGFYLEKYDKWSSVVIAYASVYG. 256
120 0.000e+00gi|949570226|ref|WP_057002306.1| flavodoxin [Lactobacillus composti]  clstr ali  18  9..NSIQFIGCNDRRLERFENLFPLPNGMSYNSFFI-DDTKTAILDTVDSSVTLQYLENVKYVLKGRDLDYLIINHMEPDHCANIVELAKLYPNMKVVGNATTFEFFEHFYNFDLKPNYYLVKNKDELSL-GQHTLQFVFAPMVHWPEVMFTYEQSEKILFSADAFGTFGANGNLFTDEMDYGEYYACRRYYANIVGKYGKQTTRAMKQVAKLDVAMIAPLHGPIWRS-NLTYILDRYQKWASGVVIYGSAYG. 266
121 0.000e+00gi|499956318|ref|WP_011637052.1| anaerobic nitric oxide reductase flavorubredoxin [Shewanella frigidimarina]  clstr ali  19  8.....NIDWVGQRDWDFHGTEYKTTKGTSYNSYLIR-EQKNVLIDTVDHRFSLQFIQNLEMEIDLDKIDYIVINHAEEDHSGALAALMAKIPNTPIYCTENAIDSITGL-HHHTEWNFNIVKTGDTLDIGNGKQLVFIETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQELMDQCLRYYSNILTPFSSLVTAKINEVLNLPVDMIATAHGVVWRDQIIHQYLQWADNYQEDTIFYDSM... 261
122 0.000e+00gi|571173766|emb|CDK63589.1| Anaerobic nitric oxide reductase flavorubredoxin [Morganella morganii IS15]  clstr ali  18  8.....NVHWVGQRDWDFHGTEYKTLLGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQHLQTQIDLNDIDYIVINHAEEDHAGALTELMAAIPDTPIYCTENAIDSINGH-HHHPEWHFNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAILFSNDAFGQHYCDERLFNDEVDQELFEQCQRYYANILTPFSRLVTPKITEILGLPVDMIATSHGVVWRDQIVEWYLKWAADYQEDTIFYDTM... 261
123 0.000e+00gi|524617257|emb|CDD35922.1| putative uncharacterized protein [Roseburia sp. CAG:309]  clstr ali  17  1.MKDITISDSDDTTLDLFESQYIVPEGVSYNSYVIMD-DKITIMDTVDQRATEEWIANVKNVLKDKTPAYLVVSHMEPDHAANIQKIAEMYPEMKIIGNAKTFSMMPQFFDFDLSDRSVVVKEGDEISL-GAHTLQFFMAPMVHWPEVMVTYEKSEKILFSADGFGKFGALS------VEADWACEARRYYFNIVGKYGAQVQALLKKAATLDIQMICPLHGPIL-KENLGYYIDKYNTWSEGVVAYASIHG. 255
124 0.000e+00gi|780797242|gb|KJS03461.1| lactamase [Peptococcaceae bacterium BRH_c4a]  clstr ali  17  1.MRPVEIYWVGAIDWDFHG--YLTPRGTTYNAYLIVD-DKITLVDTVKNCFFDQMLERIKAIVDPAKIDYLVVNHVEMDHSGSVPDFTEAAPRARIVTSSKGKKGLERHYK--KDWEYLTVNSGDDLSL-GSRTLKFVQTPMVHWPDSMVSYIPEEKLLLPNDAFGQHIAGAGRFDDQLGWDIVEEAAKYYANIVLPYGDQVKKALEIIGRLPIDMIGPSHGVIWRS-YLPRLLEVYSRWEKALIVYDTMWG. 258
125 0.000e+00JGI.Meta 7015944027 SRS014979_WUGC_scaffold_35361__gene_81203 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  16  10....IKYIGADDKTLDLFESQYLIPNGVSYNSYLILD-EKIAVMDTVDMRATGEWLRNMDRELQGKEPDYLIVSHMEPDHAANIEMLARRYPKMQIVANAKTFPMMEQFFNLDVSDRKVVVAEGDTLNL-GKHTLQFFMAPMVHWPEVMVTYEQSEKILFSADGFGTFGSLDA------NEEWIAEARKYYINIVGKYGNPVQALLKKASGLDIQMICPLHGPVL-KENLGYYIEKYQIWSSYLIAYASIHG. 255
126 0.000e+00gi|524148369|emb|CCZ22773.1| rubredoxin-oxygen oxidoreductase putative [Acetobacter sp. CAG:977]  clstr ali  17  1.MKAVEIYWVGVKDWEFHG--YSTSRGSTYNAYLIMD-EKVTLIDGVKAPFTDLMMQKIASVIDPAKIDVVICNHVEMDHSGALPAVMEKAKNATMYCPAAGERGLGLHYDTS-SWKIQTVKTGDTLN-IGKHTLSFTLMPMVHWPDSMMTYMADEKILFPNDAFGQHYASDEIFDDENLDIIMDEAKKYYGNIVMPYGAQVQKVLEAASSLDIETIAPSHGVIWRK-HIPEIVAKYVKWSRAVVVYDSMWG. 259
127 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  16  55..NDIIYVGVNDHQVDLFEGQYVVPNGMSYNSYVIKD-EKIAVMDTVDVNFAEEWLANIAQVLDGAKPDYLIVQHMEPDHSANIYNFMKVYPDTTIVANEKTFVMMANFFEMDLEGRTLEVENGQTLSL-GKHDLTFVFAPMVHWPEVMVTYDSTEKVLFSADGFGKFGAND------VEEDWDDEARRYYIGIVGKYGTQVQNLLKVAATLDIQMICPLHGPIL-KENLGHYIEKYDIWSEGVMIYTSVYG. 303
128 0.000e+00gi|746255420|ref|WP_039303726.1| anaerobic nitric oxide reductase flavorubredoxin [Pectobacterium betavasculorum]  clstr ali  18  8.....NIHWVGQRDWDFHGTEYKTLQGSSYNSYLIR-EEKTVLIDTVDHKFSREFVQNLMAEVDLNTIDYIVINHAEEDHAGALSELMARIPNTPIYCTYNAIDSITGH-HHHPEWNFHTVKTGDTLDIGNGKQLIFIETPMLHWPDSMMTYMTEDAVLFSNDAFGQHYCDEHLFNDEVDQELFEQCQRYFANILTPFSRLVTAKIHEVLGLPLSMVATSHGVVWRDDIIHLYLKWADSYQEDTLFYDTM... 261
129 0.000e+00 GL0034661 [Complete] locus=scaffold11334_1:1577:2767:-  ali  18  6...NVYYVGVNDRTKHRFEGLWPLPYGVSYNSYLIVDHDAIALVDTVDVAFFGEYIDKIKTVIADRPIDYLIINHMEPDHSGSIALIRKYYPGIKLVGNKKTMQMVQGFYDATADGDVC-VADGDTLTL-GHHELKFYLTPMLHWPETMMTFDTTNGTLFSGDAFGCFGANGHVIDTQMEVAPYWSEMRYYACILGKFGAPVQAGLKKLANVPVKMICSTHGPVW-TELIPQAIATYQRLATGVVCYGSMYG. 259
130 0.000e+00gi|544874044|ref|WP_021287090.1| MBL fold hydrolase [Sulfurimonas sp. AST-10]  clstr ali  21  1MYFNIKVYHVGNVDWEIEGFKYSTHRGSSYNAYLIE-EEKTVLIDTVSEPFTDVFIKNLKNKIDLKKIDYIVINHGEKDHTGALPELMSYIPDTPIYCTKNCVKSLKGQY--HKDWNFVVVKSGDTLSL-GKKELTFVEMPMLHWPDSMACYLSQDNILFSNDAFGQHYASSALYNDEVDCELFIECLKYYANILTPYNKLVTRKINEILNLDIDMICTSHGVIWRDQIVELYLKWAENYKENTILYDTMW.. 260
131 0.000e+00gi|524575310|emb|CDC99140.1| flavodoxin [Prevotella sp. CAG:474]  clstr ali  16  6..NNIYYVGVNDRNKSLFEGLWPLPYGVSYNSYLI-DDDKVCLIDTVEVDFFARYISNIREVIGSRPVDYLVINHMEPDHSGSIALLRQYYPDMQVIGNKKTIGMLEGFYGVT--DNCVEVKNAESIAL-GKHNLTFHLTPMVHWPETMMTYESATQTLFSGDAFGCFGANGGVIDDAINTDWCWDEMRYYSNIVGKYGIPVQNALKKLAGLPLAYICSTHGPVWHS-YIDKVVGMYDSMSRYVICYGTMYG. 258
132 0.000e+00JGI.Meta 7055235338 C3687253__gene_220355 flavodoxin/nitric oxide synthase [Human Tongue dorsum microbiome from visit number 1 of subject 76  ali  19  8.....KVTWVGKVDWEFHGKEYSTDKGSSYNSYLIRDK-KTVLMDTVWGPYDREFVERLKEEIDLKDIDYIVMNHNESDHSGALPLLMAEIPDTPIYCTKKGEAIIRGHY--HKDWNFVTVKTGDTLDL-GDSKLVFIEAPMLHWPDTMFTYMTGEEILFSNDGFGQHFASESLYNNKVDQELFHEAMKYYANILNLYSPMVTRKIKEILNVPVKLICPSHGVIWRDEIVEMYQKWADAYQENTLIYDTMWN. 261
133 0.000e+00gi|736459041|ref|WP_034480766.1| flavodoxin [Butyrivibrio sp. AE2015]  clstr ali  16  6...TKKITEDSDRRLSRFENIFPIPEGVSYNSYFV-DDEKTVVFDTADISVSDQYIENLKEVLGDKKLDYLVVLHMEPDHCSLIDTVTAYYPDVTVVGNSKTFTFMEQFFPSAAGFKKLEVKEGDTLST-GKHTFHFVAAPMVHWPEVLLAYDDASKALFSADAFGTFGADGGIFADEYDYEFLDSSRRYYANIVGKYGMQVQAALKKAAGLDIQMILSLHGPVWRK-NIEWLLEKYEKWSTYTLVYGSLYG. 267
134 0.000e+00gi|504544845|ref|WP_014731947.1| flavodoxin [Mesotoga prima]  clstr ali  14  11......IYWVNDFETNLFEALWPLPRGVSYNSYILID-DKVVLIDTVKGPFFSDFLDKIRSLLPGRKVDYLVVNHMEPDHSGSIKVLREAFPEIKIIGNEKTKGMLDAFYGVT--DNVVTVKDSDELE-IGSKTLQFHMTPMVHWPETMMTFEKTTGLLFSGDAFGGFGANGGIFDDEVDVDYFEDELRYFSNIVGRYSSMVQKAFEKLKNVDIKVVCATHGPVWRK-NPSRIIELYDRWSKVVLVYGSMYG. 262
135 0.000e+00gi|739062253|ref|WP_036933664.1| anaerobic nitric oxide reductase flavorubredoxin [Proteus vulgaris]  clstr ali  19  8.....NVNWVGQRDWDFHGTEYKTLLGSSYNSYLIC-EEKNVLIDTVDHKFSREFVQNLRAQINLEEIDYIIINHAEEDHAGALTELMSFIPNTPIYCTANAIDSINGH-HHHPEWNFNIVKTGDSLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAILFSNDAFGQHYCDERLFNDEVDQELFEQCQRYYANILTPFSRLVTPKINEILGLPVDMIATSHGVVWRDQIVELYLKWAADYQEDTIFYDTM... 261
136 0.000e+00gi|496707874|ref|WP_009347583.1| flavodoxin [Alloprevotella rava]  clstr ali  21  1MQLTDKIYGVNDRTKHRFEGQWHLPQGVSYNSYLVVD-EKVALIDTVEADFFLEFLDKLHAVLGDRKIDYLVINHMEPDHSGSISLLRKYYPDVKLVGNKKTFGMVEGFYGEPTADDV-EVTDGSELSL-GSTTLQFHLVPMLHWPETMVSYLKEDKVLFSGDVFGCFGANGNIVDRDMDTESYLPEMRYYAAILGKYGAQVLAGLKKLAPLEIEMICSTHGPVW-TEHISTIIELYRRLGAGVVAYGSMYG. 258
137 0.000e+00gi|655517489|ref|WP_028898542.1| MBL fold hydrolase [Prevotella sp. HJM029]  clstr ali  19  9......VTWVGKIDWEFHGDEYSTEHGSSYNAYLVRD-EKVALLDTVWQPFDKEFVARLKREIDLKQIDYIVMQHNEVDHSGALPELLREIPGTPIYCTKKGEAILRGHY--HQDWNFVNVKTGDTLSL-GRQTLTFIEAPMLHWPDTMMTYLSGDEILFSNDVFGQHFATESLYNDLVKQDLMWEAEKYYANIINMYSPMANRKVKELMNLPLKMICPSHGVMWKKQIIDKYLEWSQGYQENTLVYDTMWN. 261
138 0.000e+00JGI.Meta 7034454162 SRS014459_WUGC_scaffold_35289__gene_49056 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  17  6...DIIYAGVNDHQVDLFEGQYRVPNGMAYNSYVIKD-EKIAVMDTVDGRFTHEWLDNVEKALAGRKPDYLVVQHMEPDHSANIQNFMKAYPEAVIVANAKTFCMVGNFFSMDLEGRTLEVKNGDSLSL-GKHVLNFVFAPMVHWPEVMVTYDSTDKVLFSADGFGKFGA----LDVEEDWD--DEARRYYIGIVGKYGAQVQNLLKAASALDIQTICPLHGPVL-KENLGHYLEKYHTWSSVVIAYTSVYG. 253
139 0.000e+00gi|515982131|ref|WP_017412714.1| anaerobic nitric oxide reductase flavorubredoxin [Aeromonas salmonicida]  clstr ali  19  8.....NIHWVGQRDWDFHGSEYKTHKGTSYNSYLIR-EGKNVLIDTVDHKFSREFVQNLAAEIDLASIDVIVINHAEEDHAGALTELMARIPGTPIYCTHNAIDSITGH-HHHPEWNFHPVKTGDSLDIGNGKQLVFIETPMLHWPDSMMTYMTEDAVLFSNDAFGQHYCDEHLFNDEVDQELMEQCQRYYANILTPFSPLVTAKIKEVLGLPVSMVATSHGIVWRDDIILKYLEWADHYQEDTLFYDSM... 261
140 0.000e+00JGI.Meta 7025278904 C3648069__gene_221443 flavodoxin [Human Tongue dorsum microbiome from visit number 1 of subject 764224817]  ali  21  1MQLTDKIYGVNDRTKHRFEGQWHLPQGVSYNSYLVVD-EKVALIDTVEADFFLEFLDKLHAVLGDRKIDYLVINHMEPDHSGSISLLRKYYPDVKLVGNKKTFDMVEGFYGVPTADDV-EVTEGTELSL-GSTTLQFHLVPMLHWPETMVSYLKEDKVLFSGDVFGCFGANGNIVDRNMDTESYLPEMRYYAAILGKYGTQVLAGLKKLAPLEIEMICSTHGPVW-TEHISTIIELYRRLGAGVVAYGSMYG. 258
141 0.000e+00JGI.Meta 7032382715 SRS023914_Baylor_scaffold_6200__gene_16237 hypothetical protein [Human Stool microbiome from visit number 2 of subject 1  ali  16  24...TIKYVGVNDETIDLFEGQYRMLHGVSYNSYVILD-EKIAIMDTVDRRATEEWLSNLERVLEGRTPDYLIVSHMEPDHAANIQRVAEKYPEMKLVGNAKTFPMIAQFFDLNIEGREVIVKEGDTLSL-GRHTLQFFMAPMVHWPEVMVTYEQSEKVLFSADGFGKFGSLS------VEEPWEDEARRYFINIVGKYGAPVQALLKKAAALDVAMICPLHGPVL-TENLEHYIGLYDTWSKGLIAYASIYG. 270
142 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  20  1MYCVRKVSDDNDRRLAMFEGVYSVPDGVSYNSYLLMD-DYTVLFDTVDPAVSKVFFENIEHVLAGRELNFLVIQHMEPDHSGMIDELLLRHPETVIVCGERVRAMLRQFRTSEVKNSFRVIKEGSVFNT-GHHELTFLAAPMVHWPEVMVTYDITTKTLFSADAFGTFGANGALFADEVDFDYLDEARRYYCNIVGKYGTQVQALLKKAATVEIERICPLHGFVWRRD-IGDFLEKYQKWSTGVMIYASVYG. 265
143 0.000e+00gi|652365239|ref|WP_026761303.1| MBL fold metallo-hydrolase [Selenomonas ruminantium]  clstr ali  20  1.MQAIEIYWVGAIDWSFHG--YQTGRGTTYNAYLILD-EKITLIDTVKEGFAPELLARIKSIIDPAKIDYIISSHVEPDHSGAIPFMMQHCPKAKVITSPNGEKGLKAHYG---DLPYQGVKAGDSLS-IGQRTLQFVPTPMLHWPDSMVTYCPEEKILFSNDAFGQHLASSQRYDDEVDKSIFFECQKYYANILMLYGRQAQTALKALARLDISLIATGHGIIWRS-YIPEIMACYQKWSTAVIVFDSMW.. 257
144 0.000e+00gi|524123053|emb|CCY97086.1| uncharacterized flavoproteins [Ruminococcus sp. CAG:17]  clstr ali  16  6...TIKYVGVNDHQVDLFEGQYKVPNGMSYNSYVILD-EKVAVMDTVDANFTHEWLDNIQQVLGDRKPDYLIVQHMEPDHAANIANFMKVYPDTTVVSNKKAFAMMQNFFDLDLEGQQVIVDNGGTLSL-GKHNLTFVFAPMVHWPEVMVTYDSTEKVLFSADGFGKFGA----LDVEEPWD--DEARRYFIGIVGKYGVQVQNLLKVAATLDIQTICPLHGPVLTED-LGHYISLYDTWSSYVIAYTSVYG. 252
145 0.000e+00gi|960401995|ref|WP_058293987.1| flavodoxin [Clostridium neonatale]  clstr ali  16  9...SIKYIGVNDKTLDLFESQYKIPNGVSYNSYVILDK-KVAIMDTVDSRATDEWIANLEKTLDGRTVDYLVISHLEPDHSANIQNLIERYPDMKLVGNKKTFDMLPQFFDVDITGKTLLVAEGDELNL-GDHTLQFFMAPMVHWPEVMVEYEKTEKILFSADGFGKFGA-----LDVED-EWIDEARRYYLNIVGKYGSPVQVLLKKAATLDIKTICPLHGPIL-KENLSYYIDKYNTWSKVLVAYASIHG. 255
146 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  17  7....VHYVGVNDRTKALFENLWPLPYGVSYNSYLIADDEMVALVDTVDVAFFEVYLKKIRNVIGDRKINYLIINHMEPDHSGSIALIKQYYPDIVLVGNKKTFEMVDGYYGVGGDRY--VVGDGDFLKL-GHHNLRFYLVPMVHWPETMVTFDETEGILFSGDAFGCFGANGGCVDKNINTDIYWEMRRYYANIVGKFGNPVQKALQKCSGLDIKMICSTHGPVW-EEKIPQVVEMYDKLSRVVIAYGTMYG. 258
147 0.000e+00JGI.Meta 7068163205 SRS015782_WUGC_scaffold_41182__gene_98675 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  16  7....VHYVGVNDRTKALFENLWPLPYGVSYNSYLIADDDMVALVDTVDVAFFEVYIKKIRSVIGDRKINYLIINHMEPDHSGSIALIKKYYPEIVLVGNKKTFEMVEGYYGVTGERY--VVGDGDFLKL-GHHNLRFYLVPMVHWPETMVTFDETEGILFSGDAFGCFGANGGCIDRNINTDIYWEMRRYYANIVGKFGNPVQKALQKCGGLPIKTICPTHGPVW-EECIPQVVDMYDKLSRVVIVYGTMYG. 258
148 0.000e+00gi|996047663|gb|KXG77885.1| Nitric oxide reductase [Thermotalea metallivorans]  clstr ali  22  10......VYWVGAIDWHFHGPSYHTHKGTTYNAYLIID-EKVALVDIVDAHFAEEMLENIRQVIDPSKIDYVVVNHVEPDHSGGFPKLMEYIPNAKVFCSKNGKDAMMHHYF--GDYQYEVVKTGDIIRL-GEKTIQFIEAPMLHWPDSMFSYIAEEALLLPNDAFGQHLASSKLFDDENDCEVMEEAKKYFANILMPFGPLVVKKIEEIMGLKIDMIAPSHGIIWRS-NPEKIIEKYMQWRKAVVVYDTMW.. 261
149 0.000e+00 GL0071629 [Complete] locus=scaffold16548_3:3393:4577:+  ali  21  1MLNAIEIWWVGGLDWNFHG--YTTERGITYNAYLIMD-EKVTLIDTAKATFTDEFVQRISQVVDPAKIDVVITNHVEMDHSGSLPKIHELAPNATIYASAAGVNEIRAHYGIEVEG----VKTGDSLS-IGERTLHFVQTPMVHWPDNMVTWCPEDGILFSNDAFGQHFATSKRFDDENDLEVMKQAKKYYANIVWPYGAQVQKAMGALAGLDIKMIAPSHGVIWRS-NIPAILEKYQAWSKAVVVFDSMW.. 257
150 0.000e+00gi|498104435|ref|WP_010418591.1| flavodoxin [Anaerophaga thermohalophila]  clstr ali  18  1MYQPVHLSDDNDRRTGLFENIWPLPRGVAYNSYLIND-EKVALIDTVEIGQVEKFLKKIHAIIGDKAIDYLIINHMEPDHAGAVSIIRELYPQIRIVGNKKTLPMVEGFF--SINDNTIEVKEGDELDL-GKHKLQFYMAPMVHWPETMMTYEASRKILFSADAFGSFGTDGGIFDDEMDFSYFSDEMRYYSNIVGKYGNPVQKVLGKIKELSVNIIASAHGPVIRS-HINEVTEWYDRWSEGVVLFASMYG. 261
151 0.000e+00gi|524284843|emb|CDA42396.1| metallo-beta-lactamase domain protein [Prevotella sp. CAG:5226]  clstr ali  17  6...NVYYVGVNDRTKHRFEGLWPLPYGVSYNSYLIVDHDAVALVDTVDVAFFGEYIEKIKAIIADRPIDYLIINHMEPDHSGSIALIRKYYPGIKLVGNKKTMQMVQGFYDATADGDVC-VADGDTLTL-GHHELKFYLTPMLHWPETMMTFDTTNGTLFSGDAFGCFGANGHVIDTQMEVAPYWAEMRYYACILGKFGAPVQAGLKKLANVPVKMICSTHGPVWTERIPQAI-ATYQRLATGVVCYGSMYG. 259
152 0.000e+00gi|503473577|ref|WP_013708238.1| MBL fold metallo-hydrolase [Coriobacterium glomerans]  clstr ali  21  1MLNAIKIWWVGGIDWNFHG--YTTEQGITYNAYLIMD-ERVTLIDTAKATFSDEFIQRISQIVDPAKIDVVIANHVEMDHSGSLPRIHELAPDAAIYASPAGVKEIKAHFGIDVKG----VKTGDALS-IGERTLTFVQTPMVHWPDNMVTYCPEEQILFSNDAFGQHYATTKRFDDENDCELFKQAKKYYANIVWPYGAQVQKALGALRYLDIKMIAPSHGVIWRSEIMARYQAWYQTERKAVVVYDSMW.. 257
153 0.000e+00JGI.Meta 7068061768 C2697537__gene_86850 hypothetical protein [Human Stool microbiome from visit number 1 of subject 763820215]  ali  16  5..QDIHYIGVNDHQVDLFEGQYVVPNGMAYNSYVIMD-EKIAVMDTVDINFTHEWLDNLDDVLNGKTPDYLIVQHMEPDHSANILNFIKTYPDATIVANAKTFVMMDQFFDLDSSVKRLEVKNGETLSL-GQHDLTFVFAPMVHWPEVMVTYDSKDKVLFSADGFGKFGAND------VEEDWACEARRYYIGIVGKYGAQVQALLKKAANLDIQTICPLHGPVL-TENLGYYLNLYNIWSSYVIAYTSVYG. 252
154 0.000e+00JGI.Meta 7051792745 SRS015209_WUGC_scaffold_32737__gene_64230 flavoprotein [Human Tongue dorsum microbiome from visit number 1 of subject 76  ali  17  11MYSCRKITDDDDRRLPLFENIFPLDRGVTYNSYLLLD-DKTVLMDCCDQTVAHQFLENVNFALGGRTLDYLLIHHMEPDHCGSIEEIFRRYPKMSIIANMKTFQMLDQFFSLAPEEQKLVVKDGEEFSF-GKHSFKFLFAPMVHWPEVMFSYDTTNSILFSADAFGVFGCNGNIFADEQNYDFLDDARRYYANIVGKYGQQTQAALKKTSAYPIKMICPLHGPIWRED-ISFIIDKYDLWSRYVILYNSVYG. 277
155 0.000e+00gi|739017469|ref|WP_036898792.1| MULTISPECIES: flavodoxin [Prevotella]  clstr ali  16  5.KNKIYYVGVNDRNKSLFEGLWPLPSGVTYNSYLI-DDDKVCLIDSVEVDFFSQFIESLHEVLGDRKIDYLVVNHMEPDHSGSIKLLRKYYPEIQVIGNKKSFDLLSGFYGMDDNH--LEVKHGDTLDL-GHHTLKFFMTPMVHWPETMMTLDVEDHVLFSGDAFGCFGANGGLLDSDINTDWAWLEMRYYSNIVGKYGTPVQNALKKLAAEQIDYICPTHGPVWHEQA-NQVVSMYDRMSKYVICYGTMYG. 258
156 0.000e+00 GL0059599 [Complete] locus=scaffold38031_1:1218:2369:-  ali  19  5..KDIRYIGVNDHDIDLFEGQYIVENGMAYNSYVILDDE-ICVMDTVDARFTAEWLSNLQKALDGRKPSYLVVQHMEPDHSAGILAFCEAYGDAKVVASAKAFTMMQQFYGMNFADRRIVIKEGDMLAL-GRHTLSFVAAPMVHWPEVMVTYDSCDKVLFSADGFGKFGALDA------DEDWACEARRYYIGIVGKYGAQVQNLLKKAAALDIQMICPLHGPVL-TENLEYYVNLYNIWSEGVIAYTSVYG. 252
157 0.000e+00gi|166028553|gb|EDR47310.1| metallo-beta-lactamase domain protein [Dorea formicigenerans ATCC 27755]  clstr ali  17  36...DIKYVGVNDHDIDLFEGQHQVENGMAYNSYVITD-DKIAIFDTVDAHFSEEWLANIKNVLGDAKPDYLIIQHMEPDHSASIGIFMENYPDTTIVASAKAFTIMKQFFGCDYAEHQLVVKEKDTLEL-GKHTLTFVAAPMVHWPEVIMTYDSYAKVFFSADAFGKFGALD------VEEDWACEARRYYFGIVGKYGAQVQALLKKAAGLDIQTICPLHGPVL-NENLDFYLNLYQTWSKGVIAYTSVYG. 282
158 0.000e+00 GL0060651 [Lack 5`-end] locus=scaffold61753_2:1:1137:+  ali  17  1....IFYVGVNDHKVDLFEGMYDVPNGMAYNSYVVAD-DKIAVMDTVDINFGDEWLTNIKEILGDRSPDYLIIQHMEPDHSACIDKFLEIYPETAIVGNAKTFAMMTAFFPNLETSNKITVKDGDKLNLA-SHELTFIMAPMVHWPEVMVTYDNTDKVLFSADGFGKFGALDA------DEDWACEARRYYFGIVGKYGAQVQALLKKAAALDIQTICPLHGPIL-KENLGYYLGLYNTWSEGVIAYTSVYG. 246
159 0.000e+00JGI.Meta 7044976824 SRS012273_Baylor_scaffold_38477__gene_102921 beta-lactamase domain protein [Human Stool microbiome from visit number 1 o  ali  20  6...TEKVTWVGKVDWEFHGDEYTTDKGSSYNSYLIRD-EKTVLIDTAWLPYDKEFVANLKKEIDLNKIDYIICNHGEVDHSGSLPELMREIPNTPIYCTANGIKSIQGQYHR--NWNFIPVKTGDTLN-IGESTLTFIEAPMLHWPDTMFTYMDKENILFSNDGFGQHLASEHLYAHEVDQALYQEAIKYYANILAPFSMIANRKIKEILNLPIDLIAPSHGVIWKTQIVEKYLEWSENYQENTILYDTMWN. 261
160 0.000e+00gi|518509535|ref|WP_019679742.1| FprA family A-type flavoprotein [Ruminococcus flavefaciens]  clstr ali  16  6..NDIYYIGVNDHDLDLFEGQYDVPNGMAYNSYIILD-EKTAVCDTVDGNFTDQWLDNITEVLADRKPDYIIVHHMEPDHSANLKSFLEKYPETTVVGNAKTFGMIENFFEDLTIANKLEVKDGDKLSL-GKHELTFVFAPMVHWPEVMLSYDSTDKVLFSADAFGKFGALD------VEEDWACEARRYYFGIVGKYGMQVQNVLKKAAALDIKIICALHGPVLR-ENLDYYLGLYNTWSEGVIAYTSVYG. 253
161 0.000e+00gi|504781558|ref|WP_014968660.1| MBL fold hydrolase [Gottschalkia acidurici]  clstr ali  23  1MKKLKNVYWVGTNDWGFHGDELSTHKGTTYNAYLIKD-DKNVLIDTVSEPLTEIFLERIKKVIDLGDIDYVVINHAEPDHSGALTTIMELCPNAKIVASVKGKESIQRHF--HKNWDVQTVKTGDKIN-IGKRDLMFIEATMLHWPDTMFTYLTEANILFSNDAFGQHYASSELFNDKVDKEVHQEALKYYANILTPFSKFVIKKIDEIKNLPLDIIAPSHGIIWREQIVEKYYEWAKGESEVVIIYNSMYG. 260
162 0.000e+00gi|657059954|ref|WP_029302606.1| anaerobic nitric oxide reductase flavorubredoxin [Aeromonas hydrophila]  clstr ali  18  8.....NIHWVGQRDWDFHGTEYKTHKGTSYNSYLIR-EGKNVLIDTVDHKFSREFVQNLAAEIDLATIDYVVINHAEEDHAGALTELMARIPGTPIYCTHNAIDSITGH-HHHPEWNFHPVKTGDSLDIGNGKQLVFIETPMLHWPDSMMTYMTEDAVLFSNDAFGQHYCDEHLFNDEVDQELMEQCQRYYANILTPFSPLVTAKIKEVLGLPVSMVATSHGIVWREDIILKYLEWADHYQEDTLFYDSM... 261
163 0.000e+00gi|502802999|ref|WP_013037975.1| MBL fold metallo-hydrolase [Methanohalophilus mahii]  clstr ali  19  14......VYWVGVIDWDFHG--YETPRGGTYNAYLIVD-EKITLIDTVKASFADEMIERISRIVDPAKIDYIVANHVEMDHSSALPRILEVAPNARIFATERGKTGLNEYYAESGGWNFETVKTGDELNT-GKRTLMFIEAVMLHWPDSMQTYLKEDNILFSNDAFGQHIATSKRFDDQVE-DVMEDAAIYFANILTPFSSRILKHLETVGGLQIDMIAPSHGVIWRSD-PQRIIDAYAKWQKVLVIYDSMWG. 266
164 0.000e+00JGI.Meta 7051751327 SRS015209_WUGC_scaffold_11050__gene_22812 flavodoxin [Human Tongue dorsum microbiome from visit number 1 of subject 7641  ali  15  4....VYYVGVNDRNKNLFEGLWPLPYGVSYNSYLI-DDEKVCLIDTVEVDFFVQFIERLREVLGDRQIDYLVINHMEPDHSGSLALLRKYYPNIQVIGNKKTFDMMSGFYGI--KDNTIEVKNGEELNL-GNHTLQFYMTPMVHWPETMMTHCKGESYLFTGDAFGCFGANGGLIDKDIDTDWCWLEMRYYSNIVGKYGTPVQNALKKLAGIHFDYICSTHGPVWH-QYVDKVVALYDRMSKYVICYGTMYG. 255
165 0.000e+00JGI.Meta 7027252513 C5271251__gene_274467 uncharacterized flavoproteins [Human Stool microbiome from visit number 1 of subject 765074482] :_  ali  17  1MKITENIYGVNDHEVDLFEGEYTVPGGISYNSYVIMD-ESVAVMDTVDGHFGKQWMENLGKALQGRTPDYLVIQHMEPDHSASIPLFMEKYPDAVIVATPAAFKMMKQFFGEGFTGRQLPAANGGELSL-GQHTLQFLFAPMVHWPEVMMTYEKEEKILFSADGFGKFGALD------VEEAWDDEARRYYIGIVGKYGAQVQNVLKKAAALDIRMICALHGPVL-KENLSHYIGLYDTWSKGVIAYASVYG. 252
166 0.000e+00gi|496989933|ref|WP_009429119.1| FprA family A-type flavoprotein [Oribacterium sp. oral taxon 108]  clstr ali  17  1MYSYRKITDDDDRRLPLFENLFPLERGVSYNSYLLLD-EKTALLDTCDHTVAHQFLENVEHALGGRTLDYLVIHHMEPDHCGSFEDIYRRYPDLCIISNMKTFQMLEQFFSFIPEKNRIVVKDGEEFSF-GKHSFKFLFAPMVHWPEVMFSYDITDSILFSADAFGVFGCNGNIFASEQDKDFVDDARRYYANIVGKYGPQTQAALKKTGACSIKMICPLHGPIW-DEDLSFILEKYDLWSKVVIYYNSVYG. 267
167 0.000e+00gi|740433450|ref|WP_038265773.1| MBL fold metallo-hydrolase [[Clostridium] litorale]  clstr ali  19  1.MKSVEIYWVGGIDWNFHG--YLTQRGSTYNAYLIVD-EKITLVDTVKSHLADELIERISKVVDPSKIDYVVSNHVEMDHSGALPKIMEVAPNAQIVTCASGEKGLTAHYK--KDWNFKVVKSGDVLEL-GKRSLHFLLTPMVHWPDNMVGYMPEEKILFSNDSFGQHIASSERFDDEYPLDIMEEARKYYANIVLPYGSQVKKELEAAGGFDIEIIAPSHGIIWRK-HVGDIVTEYKKWSKALIVYDSMW.. 257
168 0.000e+00gi|837876935|ref|WP_047884481.1| anaerobic nitric oxide reductase flavorubredoxin [Photobacterium ganghwense]  clstr ali  20  8.....NIHWVGQRDWDFHGTEYKMTKGTSYNSYLIR-EEKTVLVDTVDHRFSTQFIQNLEMEIDLADIDYIVINHAEEDHSGALTALMARIPGTPIYCTENAVDSIVGH-HHHPEWNFNVVKTGDTLDVGNGKQLIFIEAPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQELMEQCLRYYSNILTPFSNLVTAKIHEVLNVPVDMIATSHGIVWRDQIIHQYLEWANNYQEDTIFYDSM... 261
169 0.000e+00gi|491440634|ref|WP_005298426.1| anaerobic nitric oxide reductase flavorubredoxin [Photobacterium damselae]  clstr ali  17  8.....NIQWVGQRDWDFHGTEYKTTKGTSYNSYLIR-EEKTVLIDTVDHKFSHAFLQNLEQEIDLNEIDYVVINHAEEDHAGALSALMARIPGTPIYCTANAIDSIVGH-HHHPEWNFNVVKTGDSLDIGNGKSLVFVETPMLHWPDSMMTYMTGDAVLFSNDAFGQHYCDERLFNDEVDQELMEQCLRYYANILTPFSPLVTAKIHEVLGLPVSMVATSHGVIWREQIIEQYLTWANEYKEDTIFYDSM... 261
170 0.000e+00JGI.Meta 7044907832 SRS012273_Baylor_scaffold_14000__gene_33929 hypothetical protein [Human Stool microbiome from visit number 1 of subject  ali  17  7...DIKYIGVNDRKIDLFEGQYEVPNGMAYNSYVILDK-KVAVMDTVDRHFTAEWLKNLESALAGRQPDYLIVQHMEPDHSAGIAEFSAAYPDAVIVGNDKTFTMIKNFYGGDFIKNSLPVKNGDTLSL-GKHELNFVFAPMVHWPEVMMTYDAKDKVFFSADAFGKFGALDA------DEDWACEARRYYFGIVGKYGGPVQTLLKKATGLDIAVICPLHGPVL-SENLGYYLNLYDIWSEGVIAYTSVYG. 253
171 0.000e+00gi|524541088|emb|CDC77060.1| rubredoxin [Firmicutes bacterium CAG:272]  clstr ali  16  1MMSNIHCIGVNDRRIDLFESQYAVPNGVTYNSYVITDR-KIAVMDTVDAAFTHEWLDNLEAVLGGRKPDYLVVQHMEPDHSASIAVFRKNYPDTAIVATSKAFSMMRQFFGKDFSENGITVSDGDTLPL-GTHTLHFVAAPMVHWPEVIVSYESTEKILFSADAFGKFGASDAK------EDWADEARRYYIGIVGKYGRQVQALLKKAAALDIRVICPLHGPVL-SENLGYYLNLYNTWSSYVVAYTSVYG. 251
172 0.000e+00gi|518370114|ref|WP_019540321.1| hypothetical protein [Proteiniphilum acetatigenes]  clstr ali  16  1MYKPIEVTEDNDRTKHLFESLWPLPQGVSYNSYIVRD-EKTTLIDTVDICYSDLFMRKIRSVLGDNPIDYLVVNHMEPDHSGSIEFLVSRYPNIQIVGNKRTLEMLKGFYGIV--DNVVEVKDMDEMSL-GKRTLQFYMTPMVHWPETMMTYVRESRTLFSADAFGTFGTDGGVLDRQLCPERYRDEMRYYSNIVGKFGSPVQTALKKLANVGIDAICSTHGPVWTPENIAGVIALYDRLSRYVIAYGSMYG. 263
173 0.000e+00gi|493766681|ref|WP_006715262.1| MBL fold hydrolase [Desulfitobacterium metallireducens]  clstr ali  20  9......ITYVGKIDWEFHGEEYSTQKGSSYNSYLIRD-EKTVLIDTVWKPFGKEFVENLKQEIDLTKIDFIIMQHSEVDHSGALPYLMQEIPNTPIYCTASGKKIIQGHY--HQNWNFVEVKTGDKLNL-GQREITFIEAKMLHWPDTMFSYLSGDNILFSNDGFGQHYASEHMYNDLVNQDIATEAMKYYANILAPFSKMVVGKINELEKLPIEMICPSHGILWRDQIVKKYMEWATDYQENTIIYDTMWN. 261
174 0.000e+00JGI.Meta 7059684950 C4712008__gene_116425 flavodoxin/nitric oxide synthase [Human Stool microbiome from visit number 2 of subject 158944319]  ali  21  6.....KVTWVGKIDWEFHGDEYSTHRGSSYNAYLIRDK-KTVLIDTVWQPYADEFVSDLRQEIDLSRIDAIVINHGEIDHSGALPTLMREIPDTPIYCTANGIKSLKGQY--HQQWNFIPVKTGDTLEL-GETTLTFIEASMLHWPDTMFTYMDSEKILFSTDGFGQHLATESLYNDTVDGELYAEATKYYANILNPFSPIVARKIKEILDLPIDMICPSHGVIWREQIVEKYLEWAGNYQENSIVYDTMWN. 259
175 0.000e+00gi|269828827|gb|EEZ83079.1| hypothetical protein VMC_20760 [Vibrio alginolyticus 40B]  clstr ali  20  26.....NIHWVGQRDWDFHGTEYKMTKGTSYNSYLIR-EEKTVLIDTVDHRFSQQFIQNLEMEIDLKFIDFIVVNHAEEDHSGALSALMEKIPNTPIYCTEAAIDSIVGH-HHHPEWNFKTVKTGDSIDIGNGKQLVFVEAPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDERLFNDEVDQELMEQCLRYYSNILTPFSSLVTAKIKEVLNLPVDMIATSHGIVWRDQIIEQYLAWADNYQEDTIFYDSM... 279
176 0.000e+00gi|740458499|ref|WP_038290087.1| MBL fold hydrolase [[Clostridium] straminisolvens]  clstr ali  21  1MKKHLKVYWVGKVDWEFHGDSYSTHKGSSYNSYLVQ-EEKNVLIDTVWAPFAEEFVDNLAKEIDLKKIDYIVVNHGEVDHSGALPALMKHIPDTPIYCSANAVKSLKGLY--HQDWNFHVVKTGDRLDVGNGKELVFVEMAMLHWPDSMAAYLTKDNILFSNDAFGQHYATDMLFNDLVDCELFNESIKYYANILTPFSHILRKKLDEILNLQIDMIATSHGIVWRDQIVEKYMKWAQDYQENTIVYDTMWN. 262
177 0.000e+00gi|518043813|ref|WP_019214021.1| hypothetical protein [Fenollaria massiliensis]  clstr ali  17  14......YIGVNDRQTQLFENQWPLERGVSYNSYVIKST-KTALLDTVKITKVDDFVTKLKEVLEGKDLDYLVIHHMEPDHSGAIETIIDLYPNVKLVGNKKTFELLENFY--SVKDNLILVDDFDTLDL-GEVSLKFIKTPMVHWPESMVSYEEKSGILFSQDAFGGFGADGTIFDDEINWDLYRETRRYYSNIVGKFSRQVQTALKKLADLKINMVCPVHGPVWR-ENPDKIIACYDKWSKAVIVYGSMYG. 262
178 0.000e+00gi|493573162|ref|WP_006526369.1| FprA family A-type flavoprotein [Solobacterium moorei]  clstr ali  17  1MYNVRKIQDDSDRRLEKFENTYRVPAGMSYNSYLILD-EKTCLVDGIDYNVAQQFFDNLEYALQGRTLDYMIVNHMEPDHCAIIPQLVQMYPHMKLIGSMQAFKMMNQFYRFETDSRSIVVKENDTLSL-GKHNLKFITAPMVHWPEVIVTYDETAKVLFSADVFGCFGASGNVFADEIDWEHDWECRRYYTCIVGKYGMQAAAVLKKIRNLEIEMICPLHAHIWRKDF-DKIISLYEKWTSVAIFYGSVYN. 265
179 0.000e+00gi|647587271|ref|WP_025864434.1| flavodoxin [Prolixibacter bellariivorans]  clstr ali  17  1MHQVKEIYGVNDRKTHLFENYWPLPHGMAYNSYLIVD-EKVALMDTVERTFIDEYLSNIKNILGDRKVDYLVINHMEPDHSGAIRSIVAEYPDITLVGNKKTFPMLENFYQI--KENTLEIGDGDELPL-GKNTLEFYTIPMVHWPETMVSFEKTNGILFSADAFGAFGTDGGIFDDELNLSFYEEEMRYFTNIVGKYSPHTQRAMKKLSGLDIKMIAALHGPIWRS-HTDFVLSRYDKWSSVVIVYGSMYG. 260
180 0.000e+00gi|499735528|ref|WP_011416262.1| MBL fold hydrolase [Syntrophus aciditrophicus]  clstr ali  21  9......VSWVGKVDWEFHGEEYTMQRGTSYNAYLVRGG-KTALIDAVWGPFAEEFVENLQKEIDLDEIDFIVANHGETDHSGALPALMSRISDRPIYCTANCIKSLKGQY--HQDWDFRTVKTGDKLSLESQ-ELIFIEAPMLHWPDSMFCYLTGDKILFSNDAFGQHLAAEHRFNDLVDQELYQEAIKYYANILTPFSMLVEKKIKEILNLPVEMICPSHGIIWRQDIVNTYLKWAAAWQENTILYDTMWN. 261
181 0.000e+00gi|524788943|emb|CDE87750.1| metallo-beta-lactamase domain protein [Prevotella sp. CAG:891]  clstr ali  17  7....VHYVGVNDRVKHRFEGLWFLPQGVSYNSYLI-DDEKVALVDTVDVAFFAEFLDKIKAVIGDRPIDYLIVNHMEPDHSGALALIRKYYPNIRLIGNKKTFEMVQGYYGACSE-NDIVVTDGDSLDL-GHHKLRFYLTPMLHWPETMMTYCETDKILFSGDAFGCFGANGNIIDMQMDTDDYWPEMRYYAAILGKFGAPVQAGLKKLGGLELQMICSTHGPVWVKE-IQRAIDTYHRFSAGVICYGSMYG. 259
182 0.000e+00JGI.Meta 7060990211 SRS019125_WUGC_scaffold_7042__gene_21094 flavodoxin [Human Attached/Keratinized gingiva microbiome from visit number 2 o  ali  18  5.KNNVYYVGVNDRNKAKFEGLWPLPEGVSYNSYLIVD-DKVALIDTVDLAFFPQFLDNIREVIGDRPIDYIVINHMEPDHSGSMSLMRKYYPNVEVIGNKKSFNLLKGFYGPPFKE--IEVKNGDEISL-GKHNLKFFITPMVHWPETMMTLDLTDNILFSGDAFGCFGANGGVLDDNINCDEFWLEMRYYSNIVGKYGTPVQNALKKFNGVQLDYLCSTHGPVWHT-HLQRVLNEYDRMSEGVVIYGTMYG. 258
183 0.000e+00 GL0021825 [Complete] locus=scaffold4272_15:974:2182:+  ali  17  24...TIKYVGVNDETIDLFEGQYRMLHGVSYNSYVILD-DKIAIMDTVDRRATEEWLSNLERVLEGRTPDYLIVSHMEPDHAANIQRVAEKYPEMKIVGNAKTFPMIAQFFTLNVEGREVIVKEGDTLSL-GRHTLQFFMAPMVHWPEVMVTYEQSEKVLFSADGFGKFGSLS------VEEPWEDEARRYFINIVGKYGAPVQALLKKAAALDVAMICPLHGPVL-TENLEHYIGLYDTWSKGVIAYASIYG. 270
184 0.000e+00gi|566224509|gb|ETI89269.1| Beta-lactamase protein [Clostridium butyricum DORA_1]  clstr ali  21  1.MKELKVYWVGATDWYFHGYELSTHRGSTYNSYLIKD-EKTVLIDTVWEPLTDRFIENLSEVTDISKIDYVVMNHGEPDHSGALPAIMEYIPNATIIVSKKGLETITRHY--HKEWNFKVVSTGDRIN-IGKNDLVFIEATMLHWPDSMFTYLSGENILFSNDAFGQHYASSSIFNDEVDEEVYQEALKYYANILTPFSKFVTRKIDEIKKLPVDMIAPSHGIIWRKDIVEKYYEWAAGNSSVVVVYNSMWG. 260
185 0.000e+00gi|524805391|emb|CDF02402.1| putative uncharacterized protein [Ruminococcus sp. CAG:624]  clstr ali  13  1MKKTIEYTGVDDKSIDLFESQYIVPNGISYNSYIIKD-EKTAVMDTVDTRKADEWLANLKSALNGKAPDYLVISHVEPDHAGCVELFTRTYPDAKLIGNAKTFTMIKQFFGIELTDKTVTVKEGDTVSL-GSHTLTFIMAPMIHWPEVMVTYESSEKVLFSADAFGKFGAID------TNEDWDCEARRYYINIVGKYGVQVQALLKKAAALDIQIICPLHGPVL-SENLGHYIEKYNIWSKGIIAYASIHG. 255
186 0.000e+00gi|654586030|ref|WP_028053082.1| MBL fold hydrolase [Carboxydothermus ferrireducens]  clstr ali  21  9......VTYVGKIDWEFHGEELSTHRGSSYNSYLIRD-EKVALIDTAWIKFDKEYVKKLSEEIDLNKIDYVIALHGEIDHSGALPELMRHIPDKPIVCSANAVKSLKGHY--HQDWNFQVVKTGDTLEL-GSKKLIFIEAPMLHWPDSMMAYLTGEEILFSNDAFGQHYASESLFNDLVDQELFEEALKYYANILAPFSARVVKKIEEVLNLPVKMIAPSHGIIWRDQIVNKYLEWAKDYKENTIIYDTMW.. 260
187 0.000e+00gi|504236962|ref|WP_014424064.1| MBL fold metallo-hydrolase [Selenomonas ruminantium]  clstr ali  19  1.MQALEITK-GIYWVGAIDWSYQTSRGSTYNAYLIID-EKITLIDTVKECFAEELLTRIKSVIDPAKIDYIISSHVEPDHSGAIPFMMKHCPQAKIITSPNGAKGLKAHYG---DLPYQGVKAGDSLS-IGSRTLQFVPTPMLHWPDSMVTYCPEEKILFSNDAFGEHLATSQRFDDEVDLALMYECQKYYANILMLYGRQAQTALKTLSSLDIKLIATGHGIIWRS-HIAEIMAKYQQWSRAVIVFDSMW.. 257
188 0.000e+00gi|639141261|ref|WP_024484755.1| anaerobic nitric oxide reductase flavorubredoxin [Serratia fonticola]  clstr ali  18  8.....NIQWVGQRDWDFHGTEYKTLKGSSYNSYLIR-EEKTVLIDTVDHKFSREFVQNLSAEIDLQTLDYIIINHAEEDHAGALSELMVQIPNTPIYCTENGIDSINGH-HHHPEWNFHVVHTGDSLDIGNGKQLIFVETPMLHWPDSMMTYITGDAVLFSNDAFGQHYCDEHLFNDEVDQELFEQCQRYYANILTPFSRLVTPKITEILGLPVDMIATSHGVVWRDQIVQRYLEWAADYQEDTIFYDTM... 261
189 0.000e+00gi|764932904|ref|WP_044503428.1| MBL fold hydrolase [Megasphaera massiliensis]  clstr ali  19  6...TEKVTWVGKIDWEFHGHEYSTEKGSSYNSYLVRDQ-KVALIDTVWKPFDEEFVDYLKQEIDLNKIDYIVMNHNENDHSGALPALMREIPDVPIYCTQKGEAILRGLY--HQDWNYVNVKTGDTLDL-GDSKLVFIEAPMLHWPDTMFTYMTGDNILFSNDGFGQHFASEWMYNDCVNQELYHEAMKYYANILNLYSPMVIRKIDEILNVPVNMICPSHGVIWRDQIVETYQKWAKEYQENTIIYDTMWN. 261
190 0.000e+00gi|987377161|gb|KXB88709.1| metallo-beta-lactamase domain protein [Veillonella sp. DNF00869]  clstr ali  18  8MHCAQKIYWIGSNDWERFENLFPIPNGVSYNSYFI-DDEKTCIVDSVDDSIRQEFFDNVEHLLNGRELDYLIVNHMEPDHCATLVELLDRYPNVKMVGNKTTFRFFEQFYGRPAPDNYYEVKEGDTIDL-GHHKLHSYTMPMVHWPEVTCTYESTTGTLFSADAFGTFGTNGNIFADQLDFDRVYEARRYYTNIVGKYGAQVQNALKKASSLNVNIIAPLHGPIWRTPIISKYMHWYNAEKKGVVIFGSMYG. 274
191 0.000e+00JGI.Meta 7043002263 C3182134__gene_259662 hypothetical protein [Human Stool microbiome from visit number 1 of subject 158802708]  ali  16  6..KDIIYVGVNDHKVDLFEGQYDVPNGMAYNSYVVLD-EKVTVFDTVDANFNDEWLENVHKALDGRKPDYLVVQHMEPDHSANIFNFAKVYPDAKIVANTKTFVMMKQFFGTDFSDRQIVVKDGESL-CTGKHTFTFVFAPMVHWPEVMVTYDSFDKVLFSADGFGKFGALD------VEEDWADEARRYYIGIVGKYGKPVQALLKKASALDIQIICPLHGPIL-TENLGYYLNLYNIWSSYVLAYTSVYG. 253
192 0.000e+00gi|1015805018|dbj|GAT63094.1| flavorubredoxin [Paludibacter jiangxiensis]  clstr ali  20  1MYKARHITDDNDRQKVLFENLIPLPHGVSYNSYLIMD-EKTVLVDTVEVSFAEVFLDKLLSVLGDRHLDYLVINHMEPDHSGAIRAIRRMFPDIKIVGNARTFKMLDGFYGINDG--LHEVKDGDKLVL-GKHTLQFFLTPMIHWPETMMTYDINDKLLFTGDAFGAFGTDGGVLDTDIETGNHLEERRYFSNIAGKYGSAVQNALNKLKDIEIKTICPTHGPVWR-EKVNKIIEITDKLSRVVIIYGSMYG. 261
193 0.000e+00 GL0099600 [Complete] locus=scaffold32151_2:1893:3068:+  ali  17  1MHIQDKIYGVNDRTKHRFEGLWPLPYGVSYNSYLIADDDKVALVDTVDVAFFTEYIEKIKSIIGERPIDYLIINHMEPDHSGAISLIRQYYPEIKLVGNKKTMEMVEGFYSVSKSDDLTI-ADGDTLAL-GHHHLKFYLTPMLHWPETMMTYDETTQTLFSGDAFGCFGANGCVVDTNMDTTIYWAEMRYYACILGKYGIQVQAGLKKLANVDIQMICSTHGPIWTEQIPQA-LATYTRLATGVICYGSMYG. 259
194 0.000e+00gi|503126307|ref|WP_013360968.1| MBL fold hydrolase [[Clostridium] sticklandii]  clstr ali  20  1MKKHLKVHWVGKVDWEFHGDDYSTHKGSTYNSYLIQ-EEKTVLVDTVWMPFANEFVENLKSEIDLNSIDYIVINHGEVDHSGALPELMKHIPNTPIYCSANAVKSLKGQY--HQDWNLNVVKTGDTLDVGNNKQIIFVEMPMLHWPDSMASFLTGDNILFSNDAFGQHYATEMLYNDLVDCELFSEALKYYANILTPFSAILKKKLEEVLNLPIEIIATSHGVIWRDQIVEKYAKWCDNYQENTIIYDTMWN. 262
195 0.000e+00 GL0049651 [Complete] locus=scaffold5345_2:1173:2339:+  ali  16  12...DIKYIGVNDREIDLFEGQYEVPNGMAYNSYVILD-EKVAVMDTVDRHFTAEWLKNLESALAGRQPDYLIVQHMEPDHSAGIAEFSAAYPDAVIVGNDKTFTMIKNFYGGDFIKNSLPVKNGDTLSL-GEHELNFVFAPMVHWPEVMMTYDAKDKVFFSADAFGKFGALDA------DEDWACEARRYYFGIVGKYGGPVQTLLKKAAGLDIAVICPLHGPVL-SENLGYYLNLYDIWSEGVIAYTSVYG. 258
196 0.000e+00gi|496425753|ref|WP_009134600.1| flavodoxin [Alistipes indistinctus]  clstr ali  18  1MYCNQQITDVNDRRKQLFENLWPLPGGVSYNSFLIRDQ-KCALMDTVEAGSDRGYLDWIGSVLGDRPLDYLIIHHMELDHSGEIENLLQRYPDVKIVGNIKTFKVLCGYLGQLP--NLVEVKDGDTLDL-GHHRLKFIFTPWVHWPETMMTYDQTDGILFTGDAFGSFGADGGVFDDQVVFSEHLEARRYYSNIVGKYSNMVQKALAKLSGENIRTICPLHGLVWRS-NPGKAIELYQRWSSVVVVYASMYG. 262
197 0.000e+00gi|493346393|ref|WP_006303164.1| FprA family A-type flavoprotein [Atopobium vaginae]  clstr ali  17  1MYNVRKVVDDQDRRLELFENTYRVPAGMSYNNYVIMDN-KTCLMDGIDAAVEHQFHDNLDHVLNGRPLDYMVVDHMEPDHCAAIPYLAEKFPDMKIVATQKAFRMMEQFYDFDVQSRAVVVKEGDTLSL-GKHVLRFIMAPMVHWPEVMVTYDTTDHVLFAADAFGAYGAHGSLFADEVNWEKDWETRRYYTNIVGKYGPQTHALLKKASRLDISYICPLHGFVWRQDF-NMLIDRYEKWSTYTIFYGSVY.. 264
198 0.000e+00gi|503042398|ref|WP_013277374.1| MBL fold metallo-hydrolase [Acetohalobium arabaticum]  clstr ali  19  1.MQPIEIYWVGGIDWNFHG--YSTDRGSTYNAYLIID-DQITLVDTVKSNLYDEMIERISKVIDPAEIDYIVSNHVEMDHSGGLPELMEVVEDATVITSPKGEEGLKLHY--DGDWDFKAVNPGESLDL-GTKSLEFVLTPMVHWPDNMVTYLPEDKILFSNDAFGQHYASSERFDDQTPYDIMEEAKKYYANIVLPYSSQVQNVLGTVGDLEIETIAPSHGIIWRS-NIGEIIQKYKKWSEAVIIYDTMW.. 257
199 0.000e+00 GL0056656 [Complete] locus=scaffold3444_3:9657:10832:-  ali  17  7....VHYVGVNDRVKHRFEGLWFLPQGVSYNSYLI-DDEKVALVDTVDVAFFAEFLDKIKAVIGDRPIDYLIVNHMEPDHSGALALIRKYYPNIRLIGNKKTFEMVQGYYGACSE-NDIVVTDGDSLDL-GHHKLRFYLTPMLHWPETMMTYCETDKILFSGDAFGCFGANGNIIDMQMDTDDYWPEMRYYAAILGKFGAPVQAGLKKLGGLELQMICSTHGPVWGKE-IQRAIDTYHRFSAGVICYGSMYG. 259
200 0.000e+00gi|551041538|ref|WP_022785168.1| FprA family A-type flavoprotein [Lachnospiraceae bacterium NK4A179]  clstr ali  19  1MYNVKLINDDSDRRIELFENAYPLKNGVSYNSYMIMD-EKTVLIDTEDWSVGRTFMENVRHVLNGRPLDIIIVNHMEPDHAASLALVLREYPDAKVYGSMKVKDFIFQFHGLDVSDRFVMIKEGDSL-TTGKHVLNFVAAPMVHWPEVMMTFDSTDGVLFSADAFGRFGASGNIFEDEAGLEDLADARRYYTCIVGKYGLNVQAVLKKAAGLDIKMICPLHGTVIRKDF-GKFIDLYSKWSTVMIAYGSIYG. 265
201 0.000e+00JGI.Meta 7004866123 C3857351__gene_234383 flavodoxin [Human Tongue dorsum microbiome from visit number 1 of subject 159268001]  ali  16  16..NKVYYVGVNDRNKSLFEGLWPLPYGVSYNSYLI-DDDKVCLIDTVEVDFFVQFIENLHAVLGDRQIDYLVINHMEPDHSGSLALLKKYYPNIQVIGNKKTFDMMSGFYGI--RENTIEVKNGETLEL-GHHTLQFFMTPMVHWPETMMTLSKGEAILFTGDAFGCFGANGGFIDKDIDTEGYWLEMRYYSNIVGKYGIPVQNALKKLAGIHIDYICSTHGPVWH-ENVEKVVNLYDRMSKYVICYGTMYG. 269
202 0.000e+00gi|494269970|ref|WP_007156062.1| FprA family A-type flavoprotein [Oribacterium sinus]  clstr ali  16  1MYSCRKLRDDEDRRLHLFENLFPLDRGVSYNSYLLLD-EKTVLLDTCDQTVSRHFIENIEFALAGKALDYLVINHMEPDHCGSIQDLYEKYPKLSIISNAKTFQMLDQFYQMTIPDRKVEVKEGDEFS-VGRHTLKFVFAPMVHWPEVMFTYDMTDKTLFSADAFGVFGCNGNILAHEQDKDFLDDARRYYSNIVGKYGPQTQAALKKALSLEVEMLCPLHGPIWTED-LSFIIDKYDKWSRVVILYNSVYG. 267
203 0.000e+00gi|1007491711|gb|KYH34034.1| nitric oxide reductase [Clostridium tepidiprofundi DSM 19306]  clstr ali  19  1.MKAVEIYWVGAIDWDFHG--YLTQRGSTYNAYLVID-EKITLIDTVKAHLASEMIERISSIIDPEKIDYIVSNHVEMDHSGALPEIMKIAKNAKIITSPNGIKGLKAHYK--KDWDFEVVNSGDTIN-IGKRNIQFVLTPMVHWPDNMVSYIEEEKIIFSNDAFGQHIASAERFDDEFAIDIIEEARKYYANIVLPYGSQVQKALEQIKNYAIDIIAPSHGIIWRS-HVNKIIQEYVKWSKAVIVYDTMWG. 258
204 0.000e+00gi|524772769|emb|CDE71169.1| putative uncharacterized protein [Subdoligranulum sp. CAG:314]  clstr ali  15  1MYCYKQIYWIGDRRLALFENVYPLTNGVAYNSYVLLD-EKIVVFDTVDKEISARYFDNLAALLKDKSPDFLVVHHMEPDHAACIAEFLLRYPDVTIVCNAKTQAMIAEFFGAKAALNVRTVTEQDTLET-GRHSFRFVFAPMVHWPEVMVSFDVTDGTLFSADAFGTFGADGNLFADEINFEKLPEARRYYANIVGKYGAPVQALLKKAAALPVKTVCPLHGPVWR-ENIAWFVDKYDKWSSYIIFYGSVYG. 265
205 0.000e+00JGI.Meta 7050425960 SRS063603_LANL_scaffold_80380__gene_94236 flavodoxin [Human Supragingival plaque microbiome from visit number 2 of subje  ali  16  35..KDTYYVGVNDRKKEKFEGLWPLPNGVSYNSYLIVD-EKVCLIDTVEADFFSQFIENIREVIGDRPIDYIVTHHMEPDHSGSFALMRKYYPEVQVVGNKKSFDLLKGFYGLSGGE--VEVKNGDTL-CLGRHTLKFFLTPMVHWPETMMSLDEASQTLFTGDAFGCFGANGGLVDSEINCEPFWLEMRYYSNIVGKYGTPVQNALKKLAGEQFDYICSTHGPVWH-EHLQRVVGLYDRMSRYVICYGTMYG. 287
206 0.000e+00gi|511032007|ref|WP_016286095.1| hypothetical protein [Lachnospiraceae bacterium 3-1]  clstr ali  16  1.MKDVTITDNDDKDLDLFESQYIIPNGVSYNSYVILD-EKVAVMDTVDARKKEEWLANLEQALVGRTVDYLVISHMEPDHAANIQVLAEKYPEMKLVGNAKTFPMMQQFFAMDLSERSVVVKEGDTLHL-GTHELTFVMAPMVHWPEVMVSYEKSEKILFSADGFGKFGA----LDAEEDWA--CEARRYYFNIVGKYGAQVQALLKKAANLDIAMICPLHGPIL-KENLAYYLGKYEIWSSVLVAYASIHG. 255
207 0.000e+00gi|640532851|ref|WP_024966653.1| anaerobic nitric oxide reductase flavorubredoxin [Pantoea sp. IMH]  clstr ali  19  9......ITWVGQRDWDFHGTEYKTLKGSSYNSYLIQ-EEKNVLIDTVDHKFSREFVTNLAQEIELSKIDYIVINHAEEDHAGALTELMSHIPGTPIYCTENAIDSINGH-HHHPEWNFHIVKTGDTLAVGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQELFEECQRYYANILTPFSRLVTPKINEILGLPVSMIATSHGVVWRDQIVQHYLNWAADYQEDTLLYDTM... 261
208 0.000e+00 GL0038877 [Complete] locus=scaffold22339_3:47:1243:+  ali  16  18..NDIYYVGVNDHQIDLFEGQYVVPNGMSYNSYVIMD-EKIAVMDTVDANFKDEWLENVARVLDGAKPDYLVVQHMEPDHAANIENFMKAYPDTTVVANTKTFTMMGNFFNLNLDGKKLVVANGDSLTL-GKHVLTFVFAPMVHWPEVMVTYDSTDKVLFSADGFGKFGA----LDVEEDWD--CEARRYYIGIVGKYGAQVQKLLKAAATLDIQTICPLHGPIL-TENLGHYIEKYDIWSSVVIAYTSVYG. 266
209 0.000e+00gi|504857239|ref|WP_015044341.1| MULTISPECIES: MBL fold metallo-hydrolase [Dehalobacter]  clstr ali  17  12.....NVYWVGGVDWNFHG--YLTQRGSTYNAYLIID-EKITLIDTVKHYLFDEMLERISDVIDPADIDYVISNHVEQDHSGSLPEIMEIATKATLVTSPNGEKGLKAHFR--EDWNYRIVKSGDVLN-IGKRNLTFVQTPMVHWPDNMVTYLEEDKILFSNDAFGQHIASTERFDDELPLGILEEARKYYANIVLPYGGQVQKALGTLGGLDVEVIATSHGLIWRS-NIPAILNEYQKWSKAVIVYDTMWN. 261
210 0.000e+00gi|547332152|ref|WP_022062819.1| hypothetical protein [Alistipes inops]  clstr ali  16  11....VYLIGVNDRRTALFENIWPIPYGVSYNSYLIRD-DKCALLDTVEFGSEGAYLDRIEEILGERELDYLVVNHMEPDHSGEIGTVLKRYPSVKLIGNAMTRKILLGYTG-DLGDRFMEVKDGDSLSL-GKHTLHFYMTPWVHWPETMMTYESTEKILFSADAFGTFGADGAMTDALTDLAEYREEMRYYSNIVGKYGGMVQKALAKLSSLDVKTLCSLHGPVWSRQA-GEVIGLYDKWSEAVIIYASMYN. 262
211 0.000e+00 GL0047724 [Lack 3`-end] locus=scaffold5067_13:264:989:+  ali  18  1MYNVRKIIDDNDRRIALFENVYPVPNGMSYNNYLIKD-EKTCLMDGIDESVSRQFLENLTYALEGRKLDYMVVQHMEPDHCSVIPDLFKMYPEMKIVSSVQAFKMMENFYHIDTKDRSIVIKEGDTLSL-GKHELHFISAPMVHWPEVMMTYESTTGTLFSADAFGAFGASGNIFADEVRWDHDWEARRYYVNIVGKYGPQTQAVLKKASTLDIKMICPLHAHIWRKDF........................ 236
212 0.000e+00gi|494106395|ref|WP_007047181.1| FprA family A-type flavoprotein [Subdoligranulum variabile]  clstr ali  18  5..KDILYVGVNDHDVDLFEGQYKVPNGMAYNSYLIQD-EKVAVMDSVDAHFTDAWLTNIAGILGGRTPDYLVVQHMEPDHSGSVYAFSQAYPDAKIVASAKAVAIMQQFFDIDFTSRSIIVKEGDTLEL-GKHTLHFVTAPMVHWPEVIMTYDAADKVLFSADAFGKFGALD------VEEEWLPEARRYYIGIVGKYGQQVQGVLKKAAGLEIETVCSLHGPVLHKEQLGDVLAAYDTWSEGVVAYSSIYG. 253
213 0.000e+00gi|544228182|gb|ERK41504.1| metallo-beta-lactamase domain protein [Eubacterium ramulus ATCC 29099]  clstr ali  17  43...DIIYVGVNDHDVDLFEGQYIVPNGMAYNSYVIRD-EKIAVMDTVDGRFAEEWLANIEKALDGATPDYLIVQHMEPDHAANIQVFAEKYPSAQIVGNAKTFTMMKNFFHLELDGKTVEVKNGETLNL-GKHELTFVFAPMVHWPEVMVTYDSSDKVLFSADGFGKFGA----LDVEEDWD--CEARRYYIGIVGKYGAQVQNLLKAAATLDIQIICPLHGPVL-TENLGHYIEKYNIWSEGVMIYASVYG. 290
214 0.000e+00gi|489379987|ref|WP_003286684.1| anaerobic nitric oxide reductase flavorubredoxin [Pseudomonas stutzeri]  clstr ali  19  8.....NIHWVGQRDWDFHGTEYKTLKGTSYNSYLIR-EEKTVLIDTVHHRFSREFILNLASQIDLASIDYIVINHAEEDHAGALSELMARIPSTPIYCTANAIDSITGHHHQPH-WNFIPVKTGDSLDIGNGKQLVFIETPMLHWPDSMMTYLSGDAVLFSNDAFGQHYCDEHLFNDEVDQELLEQCLRYYANILTPFSPLVTAKINEVLGLPLSMIATAHGVVWRTDIIGKYLEWADHYQENTLFYDSM... 261
215 0.000e+00gi|736133797|ref|WP_034265309.1| flavodoxin [Aminiphilus circumscriptus]  clstr ali  16  1MHGGIAITKDNDRETDLFEAIWPLPRGVSYNTYCVADQ-KTALIDTVKNGYFPQFLEKIRSILGGRKIDYLVINHMEPDHSGAVKVLRESFPDVTIVGNAKTKDLLANFYGLTE--NFLVVKDGEELDL-GRHKLRFHFIPMVHWPETMVCYDETDKVLFSSDAFGGFGSDGGVFDDEVDMSYYEDEIRYFSNIVGRYSFQVQKAIKKVRTLDLNVIAPAHGPILRK-HPWHVVDLYDKWSRVVVVYGSMYG. 262
216 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  19  6...SIKYVGVDDKDIDLFESQYVVPDGVSYNSYIIFD-EKITIMDTVDARATDEWVKNIEEALDGKEPSYLVISHLEPDHAANIGLIAHKYPNMQLIGNAKTFQMLPQFFDEDFADRQVVVKEGDEISL-GSHSLTFVMAPMVHWPEVMVAYEKTEKILFSADGFGKFGA----LDSEDDEGWACEARRYYFNIVGKYGAQVQNLLKKASALDIQTICPLHGPVL-KENLGYYLDLYNTWSEGVVAYASIHG. 254
217 0.000e+00 GL0095084 [Complete] locus=scaffold3655_11:345:1535:+  ali  18  9..RNIHYVGVNDRTKHLFEGLWPLPLGVSYNSYLIVDKS-VVLIDTVDHCYTDLFFEKIKNILGERPIDYLVVNHMEPDHSASINDLCRVYPDIKIIGNSKTIGMIEGFYGIFDK--FHEVKDCDQLPL-GEKVLTFYMTPMVHWPETMMTYCEDDKILFSGDAFGCFGTDGGIIDYQMNTEKYWDEMRYYSNIVGKYGAPVQKALAKLSGIDIQIICSTHGPIWKEE-IQKVISIYNKLSEGVVIYGSMYG. 261
218 0.000e+00 GL0019187 [Complete] locus=scaffold12382_2:7083:8255:-  ali  15  8...SVKYIGVDDTTIDLFESQYVVPEGVSYNSYVILD-EKVAVMDTVDPRGMEQWEKNLLDTLNGRKVDYLVVQHLEPDHSGSIARLVELFPDVTLVGNAKTFAMLPQFFNIPLEGHTMTVKEGDTLSL-GEHTLTFVMAPMVHWPEVMVIYESKEKILFSADGFGKFGALSKT---EGEDDWACEARRYYFNIVGKYGAPVQTLLKKAAGLDIATICPLHGPVL-KDNLGYYLDLYNTWSKGIVAYASIHG. 257
219 0.000e+00gi|506348961|ref|WP_015868680.1| flavodoxin [Kosmotoga olearia]  clstr ali  19  1MDQGIPVTKDNDFETHLFESLWPLPMGVSYNAYMILD-EKVALIDTVKGSFFATFLDKVKALLDGKPVDYLIINHMEPDHSGAIKVLVEAFPEIKIVGNKKTRDFLEGFYGIS--DNFMVINDGDVLDL-GKHKLKFYLTPMVHWPETMMTYDLTDGILFSGDAFGGFGANGGIFDDVVDIEFYEDELRYFSNIVGRYSPMVQRAFKKLENVDIKIIAATHGPVWR-DNPKQIIELYDKWSKGVVVYGSMYG. 262
220 0.000e+00gi|510895444|ref|WP_016228571.1| hypothetical protein [Lachnospiraceae bacterium 10-1]  clstr ali  16  9...TIKYVGVNDRKIDLFESQYVVPNGVSYNSYVIMD-EKIAVMDSVDKRGTAEWFENLEKVLEGKEPDYLIVNHLEPDHSGNIQNFLEKYPKAQLVSNAKTLSMMPQFFSIDLGGRSVVVKEGEELSL-GKHVLTFVMAPMVHWPEVMVTYDKTEKVLFSADAFGKFGA----LDTQEDW--TCEARRYYMNIVGKYGAQVQVLLKKAAVLDIQIICPLHGPVLSENSLSYYFEKYQTWSSYVIAYASIHG. 260
221 0.000e+00JGI.Meta 7017372897 C3445221__gene_278146 uncharacterized flavoproteins [Human Stool microbiome from visit number 1 of subject 160765029] :_  ali  17  10....IHYVGVNDRTTARFEGLWSLPAGVSYNSYLVVD-EKIALIDTVEEGFGSRLFENIHEAIGDRKIDYLVVNHMEPDHSSSIRALRTLYPDIRIVGNAKTLQMIQGFYGIDAG--TMEVKEGDTLSL-GAKTLSFYMAPMVHWPETMVTWCAEAGALFSGDAFGTFGTDGGITDSQLDVSRYWDEMRYYACIVGKYGVPVQSALKKVRGLNPTTICSTHGPVWQREIPQ-VMDIYDRLSGVVLAYGSMYG. 260
222 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  17  24...TIKYVGVNDETIDLFEGQYRMLHGVSYNSYVILD-EKIAIMDTVDRRATEEWLSNLERVLEGRTPDYLIVSHMEPDHAANIQRVAEKYPEMKLVGNAKTFPMIAQFFDLNIEGREVIVKEGDTLSL-GRHTLQFFMAPMVHWPEVMVTYEQSEKVLFSADGFGKFGSLSA----EEPWE--DEARRYFINIVGKYGAPVQALLKKAAALDVAMICPLHGPVL-TENLGHYIGLYDTWSKGVIAYASIYG. 270
223 0.000e+00JGI.Meta 7067466883 SRS024435_LANL_scaffold_6274__gene_15860 uncharacterized flavoproteins [Human Stool microbiome from visit number 2 of su  ali  17  10....IHYVGVNDRVKTRFEALWSLPFGVSYNSYLVAD-EKVALIDTVEEGFGSRFFHNIHEAIGDRKIDYLVVNHMEPDHSSSISALKRLYPEIKIVGNAKTLQMIGGYYGIEAD--TVEIREGESLSL-GNRTLTFYMAPMVHWPETMVTYCPEQKTLFTGDAFGTFGADGGILDRQLELGHFWDEMRYYACIVGKYGAPVQKALQKIRTLEIETICSTHGPVWEQEK-ERVIALYDRLSRYVIAYGSMYG. 260
224 0.000e+00gi|654647317|ref|WP_028108369.1| anaerobic nitric oxide reductase flavorubredoxin [Ferrimonas futtsuensis]  clstr ali  21  8.....NIHWVGQRDWDFHGTEYKMTKGTSYNSYLIR-EEKTVLIDTVDHRFSQEFIQNLAMEVDLGQIDAIVINHAEEDHAGALAALLEKIPGTPIYCTENAIDSITGHHHRP-DWNFQPVKTGNSLDLGNGKQLVFVEAPMLHWPDSMMTYMTGDAVLFSNDAFGQHYCDERLFNDEVDQELYEQCLRYYSNILTPFSALVVAKIKEVLNLPVDMIATSHGIVWRDQIIEKYLEWASDYQEDTLFYDTM... 261
225 0.000e+00JGI.Meta 7004257495 C4255035__gene_328424 flavodoxin/nitric oxide synthase [Human Stool microbiome from visit number 1 of subject 160400887]  ali  25  1MMPMEIIYDVGATDWDFHG--YKTERGASYNSYLIVD-EKICLIDTVKACYADELLEKIRRVADPAKIDYVVVNHVEPDHAGALPEVLKAAPNAKFVITMQGKNEALRHYGDGFD--FMVVKEGDKISL-GSRELTFVPMPMLHWPDNMVTYCPQDGILFSNDAFGQHYASSKRFDDEVDYVLFYEAKKYFANILWPYARLIGGALKKASALDIKMIAPAHGVIWRSK-IAQILEKYASWGTGVIAYDTMWG. 258
226 0.000e+00gi|739518287|ref|WP_037377840.1| MBL fold hydrolase [Smithella sp. D17]  clstr ali  21  8.....NITWVGKIDWEFHGEEYSTHRGSSYNSYLVQD-EKTALIDTVWGKFSKEFVQNLEKKISLDKIDIVIANHAESDHSGALPELMSHIPDVPIYCTKNGVNSLKGHY--HQDWNFQVVKTGDKLSL-GSKDLIFIEAQMLHWPDSMMSYLTKDNILFSNDAFGQHIASELMYNDLVDQELFQEAIKYYANILTPFSSLVDKKIKEVLALKVDMICPSHGVIWRKNPLEKYLQWAGNYAENTIAYDSMW.. 260
227 0.000e+00 GL0042874 [Complete] locus=scaffold2209_2:13784:14944:-  ali  17  9...DIRYIGVNDHDIDLFEGQYVVENGMAYNSYVVLD-EKIAVFDTVDARFGDEWLGKLADTIGARRPDYLIVQHMEPDHSANIARFMEAYPETQVVASAKAFAMMKQFFGTDYAQRQIVVGEGSTLAL-GRHTLTFVTAPMVHWPEVIVTYDSADKVLFSADGFGKFGALD------VEEDWTCEARRYYIGIVGKYGAQVQALLKKAAALDIQMICPLHGPVLR-ENLGYYIGKYDAWSEGVIAFTSVYG. 255
228 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  17  5...DIRYIGVNDHDIDLFEGQYQVPNGISYNSYVIMD-EKIAIMDTVDKRKQTEFLENLETALAGRTPDYLVISHMEPDHASSIQAVVERYPEITLVGNAKTFPMLKLYFDLDTSR-ALTVKEGDTLKL-GRHELTFVMAPMVHWPEVMVSYDSCDKVLFSADGFGKFGALD------VDEDWDCEARRYYFNIVGKYGMQVQALLKKEAGLEIQIICPLHGPVL-KETIGHVLEKYQIWSEGVIAYASLHG. 250
229 0.000e+00gi|518057215|ref|WP_019227423.1| MBL fold hydrolase [Sedimentibacter sp. B4]  clstr ali  21  1MKKLVKVYWVGKMDWEFHGADYSINNGSSQNAYLIQ-EEKTVLIDTVWKPHSTEFVDNLESEIDLQKIDFIVMNHGEIDHSGSLPALMEKIPNTPIYCTANAVKSLTGQYH-HPEWNYKVVKTGDSIDIGNGKKLVFVEMRMLHWPDSMATYLTEDNILFSNDAFGQHYAVEELFNDKADQCRLWEAMKYYANILNPLSPLVTKKVEEVLNLPIEIIAPSHGAIWRDQIVNKYYEWSKEYQEDTIAYDTMW.. 262
230 0.000e+00gi|524445239|emb|CDB88861.1| putative uncharacterized protein [Clostridium sp. CAG:253]  clstr ali  18  13...SIKYVGVDDKDIDLFESQYVVPDGVSYNSYIIFD-DKITIMDTVDARATEEWVKNVEEALDGKKPEYLVISHLEPDHAANIKLIADKYPDMKLIGNAKTFQMLPQFFDEDFSDRQVVVKEGDEISL-GKHSLTFVMAPMVHWPEVMVAYEKTEKILFSADGFGKFGA----LDTEDEEGWACEARRYYFNIVGKYGAQVQNLLKKAAALDIQTICPLHGPVL-KENLGYYLNLYNTWSEGVVAYASIHG. 261
231 0.000e+00gi|511081199|ref|WP_016322518.1| hypothetical protein [Oscillibacter sp. 1-3]  clstr ali  19  1MYNYRMVTDDDEHRLALFENIHPLYHGVSYNAYVLLD-EKTVLFDTADWAVGRQFIANVKAVLNGRPLDYLVINHVEPDHAASIEEILLRWPKVKIITTPKAVTLLNQFGFGLDPNQIEEVKEGDTKSF-GKHTVAFVYAPMVHWPEAMVTFDTTNGVLFSADAFGSFRSDGKLFADEFDFDREWDARRYYTNIVGKYGPQVVALLNKAAGLDIKYLCPLHGPVWRKDIIDKYTHWYEPEEKGVIVYASMYG. 269
232 0.000e+00gi|517275119|ref|WP_018463937.1| MBL fold hydrolase [Prevotella paludivivens]  clstr ali  18  8.....KVSWVGKIDWEFHGDELSTMHGSSYNAYLIQD-EKTALIDTVWQPYDKEFVARLKKTIDLKKIDYIVMNHNEIDHSGALVELMREIPGTPIYCTKKGESIIRGHYH-PQDWNFVNVKTGDTLNL-GQNTLTFIEAPMLHWPDTMFSYLSGENILFSNDAFGQHFATESLYNDTVKQDLMWEAQKYYANIINPFSMMVSRKVKELMNLTIKMICPSHGIIWKKQIIDKYIDWCNEYKENTIIYDTMW.. 261
233 0.000e+00gi|1016784763|emb|CVI71143.1| Nitric oxide reductase [Alistipes sp. CHKCI003]  clstr ali  17  10....IRYVGVNDRTTTRFEALWSLPYGVSYNSYLVLG-EKVALIDTVEESFGSRYLENIRRELGDRKVDYLIVNHMEPDHSSSVVALRRIYPDVQIVGNAKTLQMLGGYYGIDSG--TIEVKEGQTLPLGGGLTLAFCMIPMVHWPETMATYCPELKTIFPGDAFGTFGADGGITDSQLRLDHFWDEMRYYACIVGKYGAPVQKALSKVGTLEIDTVCSTHGPVWQRE-IARVVEIYDKLSRAVIAYGSMYG. 261
234 0.000e+00gi|987353258|gb|KXB65984.1| anaerobic nitric oxide reductase flavorubredoxin [Peptoniphilus coxii]  clstr ali  20  1MKKQIKVYWVGKIDWEFHGTEYSVHNGSSQNAYLIK-EEKTVLIDTVWTPHKEEFVKNLKSEIDLKKIDYIVINHGEPDHSGSLLEIMEEIPNTPIFCTANGKKSLIGQYH-HPEWDYRVVKTGDSVDIGNGKQLVFVEMRMLHWPDSMATYLTGDNILFSNDAFGQHYALSELFNDKADPTILWEAMKYYANILNPFSSFAKKKIEEIMNLPIDIIATSHGSIWREEIIEKYAEWADAYKEVTIIYDSMWG. 263
235 0.000e+00gi|503391425|ref|WP_013626086.1| MBL fold metallo-hydrolase [Syntrophobotulus glycolicus]  clstr ali  20  1.MKPIQVYWVGGIDWNFHG--YLTPRGMTYNAYLIVD-EKITLIDTVKHYMFEEMIERISAIVDPSKIDYVVSNHVEMDHSGALPKLMEICPQAVVFTSVNGEKGLKAHYR--PDWNFRVMKSGETINL-GRKSLAFVHTPMVHWPDNMVTYCPEDKILFSNDAFGQHIASTQRFDEELPCDIIEEAARYYANIVLPYGAQVGKALEALRDIAIEIIAPSHGLVWRT-HIPEILREYEKWEKAVIVYDTMWG. 258
236 0.000e+00gi|739033183|ref|WP_036914298.1| flavodoxin [Prevotella sp. FD3004]  clstr ali  16  6..NKIYYVGVNDRNKNLFEGLWPLPNGVSYNSYLI-DDEKVCLIDTVEVDFFVQFLENIHEVIGDRKIDYLVINHMEPDHSGSLALIRKYYPEIQIIGNKKTFQMAEGFYGVIDG--LLEVKNGDTLEL-GSHTLNFVMTPMVHWPETMVTLESVSHVLFSGDAFGCFGANGGVVDSQINTDTFWLEMRYYSNIVGKYGTPVQNALKKLEGIQLDYLCATHGPVWH-EYVEKVIGIYDTLSKYVICYGTMYG. 258
237 0.000e+00gi|494010964|ref|WP_006953378.1| flavodoxin [Prevotella micans]  clstr ali  17  8....VYYVGVNDRNKALFEGLWPLPNGVSYNSYLI-DDDKVCLIDAVEVDFFVQFIENVHEVLGDRKIDYLVINHMEPDHSGGLALLRKYYPDIQVIGNKKTFDMMSGFYGI--RENTLEIKNGDTLDL-GHHTLRFFLTPMVHWPETMMTLCEGQKILFSGDGFGSFGANGGLIDSEINTDWCWDEMRYYSNIVGKYGIPVQNALKKLAGIHIDYICSTHGPVWH-QHVEKVVEMYDRMSKYVICYGTMYG. 259
238 0.000e+00 GL0058806 [Complete] locus=scaffold20203_1:1327:2475:+  ali  17  5...DIRYIGVNDHDIDLFEGQHQVPNGISYNSYVIMD-EKIAIMDTVDKRKQTEFLGNLETALAGRTPDYLVISHMEPDHASSIQAVVERYPEITLVGNAKTFPMLKLYFDLDTSR-VLTVKEGDTLKL-GRHELTFIMAPMVHWPEVMVSYDSCDKVLFSADGFGKFGALD------VDEDWDCEARRYYFNIVGKYGMQVQALLKKAAGLEIQIICPLHGPVL-KETIGHVLEKYQIWSEGVIAYASLHG. 250
239 0.000e+00JGI.Meta 7046713382 SRS014287_WUGC_scaffold_34480__gene_62017 uncharacterized flavoproteins [Human Stool microbiome from visit number 1 of s  ali  18  1.MNITEIVGVNDRTTTRFEGLWSLPQGVSYNAYLVAD-EKVALIDTVEEGFGSRLTENIREAIGDRKIDYLVINHMEPDHSSSVRALRMLYPDIQIVGNAKTLQMLQGFYGIDTG--TLEVKEGDSISL-GSKTLSFYMAPMVHWPETMVTWCAEAGTLFSGDAFGTFGADGGITDSQVDPSRYWDEMRYYACIVGKYGVPVQKALAKVRGLNPTTICSTHGPVWQREIPQ-VMDVYDRLSRVVIAYGSMYG. 260
240 0.000e+00JGI.Meta 7058548317 SRS011529_WUGC_scaffold_20337__gene_38492 flavodoxin [Human Stool microbiome from visit number 1 of subject 159166850] :  ali  19  1MHIQGKVYGVNDRTKHRFEGLWPLPMGVSYNSYLIADEEAVALVDTVDVAFFAEYLAKIRAIIGERPIEYLIINHMEPDHSGAIALIRKYYPNIKLIGNKKTMEMVQGFYAATSAED-ITVADGDTLSL-GHHQLKFVLTPMLHWPETMMTYDLTDKILFSGDAFGCFGANGQVIDSKMDVTPYWPEMRYYACILGKFGAPVQAGLKKLAGTDIQMICSTHGPVW-TEHTPEAIEIYKRLATGVICYGSMYG. 259
241 0.000e+00JGI.Meta 7049405248 SRS051031_LANL_scaffold_7465__gene_11415 hypothetical protein [Human Stool microbiome from visit number 2 of subject 764  ali  17  30...SVIYIGADDHDIDLFESQYVVPNGVSYNSYVIID-EKIAVMDTADPRVTDVWFDNLEKALDSRKPDYLVVQHMEPDHAGNIKKLAEKYPEMKIVGNAKTFPMMKQFFTIDLDDRSVVVKEGDTLSL-GSHTLQFVMAPMVHWPEVMVTYEQSEKLLFSADGFGKFGALD------VEEDWACEARRYYFNIVGKYGAQVQALLKKASALDIKMILPLHGPIL-KEDLGYYLGLYSTWSKGVVAYASIHG. 277
242 0.000e+00gi|740842479|ref|WP_038627732.1| anaerobic nitric oxide reductase flavorubredoxin [Pantoea sp. PSNIH2]  clstr ali  18  8.....NITWVGQRDWDFHGTEYKTLKGSSYNSYLIR-EEKNVLIDTVDHKFSRDFVTNLMQEIDLDKIDYIIINHAEEDHAGALTELMSRIPHTPIYCTENAIDSINGH-HHHPEWNFNVVKTGDTLDIGNGKKLIFVETPMLHWPDSMMTYMTEDAVLFSNDAFGQHYCDEHLFNDEVDQELFEQCQRYYANILTPFSRLVTPKINEILGLPVSMIATSHGVVWRDQIVELYLKWAADYQEDTILYDTM... 261
243 0.000e+00JGI.Meta 7062862112 C5343942__gene_370308 flavodoxin [Human Supragingival plaque microbiome from visit number 1 of subject 159814214]  ali  20  5..NNIHYVGVNDRVKHRFEGLWLLPHGVSYNSYLVVD-EKVALIDTVEADFFPIFLDKIREILGERPIDYLVVNHMEPDHSSSIAYIRKYYPEVKLVGNKKTFDMIGGFYGLTTEDDV-EVKEGSELSL-GNTTLRFHLVPMLHWPETMVTYCVEQKVLFSGDAFGCFGANGHVLDTTMDIERYIPEMRYYAAILGKYAKPVQAALKKLGGLEMNMICSTHGPVW-TENIPRIIETYHRLSAGVICYGSMYG. 258
244 0.000e+00JGI.Meta 7041463196 SRS019327_WUGC_scaffold_4514__gene_5691 flavodoxin [Human Tongue dorsum microbiome from visit number 1 of subject 765337  ali  17  13..KDLYYVGVNDRKKEKFEGLWPLPNGVSYNSYLIVD-EKVCLIDTVEADFFSQFIENLREVLGDRPIDYVVTNHMEPDHSGSFALLRQYYPNLKVVGNKKSFDLLKGFYGLS--GCEHEVKHGDELSL-GKHTLRFYLTPMVHWPETMMTLDLSNHVLFTGDAFGCFGANGGLLDTEINCEPFWLEMRYYSNIVGKYGTPVQNALKKLANEKFEYLCSTHGPVWH-EHLEKVVGMYDRMSKYVICYGTMYG. 265
245 0.000e+00gi|916634153|ref|WP_051241244.1| anaerobic nitric oxide reductase flavorubredoxin [Vibrio litoralis]  clstr ali  21  8.....NIHWVGQRDWEFHGTEYKITRGTSYNSYLIK-EEKTVLIDTVDHRFSQQFVQNLEMEIDLNQIDYIVINHAEEDHAGALGALLAKIPNTPIYCTENAVDSITGHHHQP-DWNFNVVKTGDSIDLGNGKALVFVESPMLHWPDSMMTYMTGDAVLFSNDAFGQHYCDEHLFNDEVDQELYEQCLRYYANILTPFSPLVTSKIKEVLSLPVDMIATAHGIVWRTQIIHQYLEWADNYQEDTLFYDSM... 261
246 0.000e+00gi|490465904|ref|WP_004336445.1| flavodoxin [Prevotella bivia]  clstr ali  19  1MKKADKVYGVNDRHKILFEGVWPLPYGVSYNSYLIVDKEKVCLIDTVEADFFMQFLENLHEVLGDRPIDYVVINHMEPDHSSSLKLLKKYYPNVQLVGNKKTFGMLAGFYGIEDD--TYEVKDGDTIEL-GNYTLKFYLTPMVHWPETMVTSCVGTKFLFTGDAFGAFGANGAIVDDDMDTEMWWEEMRYYSNIVGKYGMQVQNALKKLLGVPIEYICSTHGPIWHKE-VDRVVKTYDRLSKYVICYGSMYG. 260
247 0.000e+00gi|524668453|emb|CDD84770.1| metallo-beta-lactamase domain protein [Bacteroides sp. CAG:462]  clstr ali  18  8....VHYVGVNDRIKTLFEGLWPLPYGVTYNSYLIAD-EKVALIDTVDVNYFDLFLDKIKEVIGDRPIDYLVINHMEPDHSGSIRLLRQFYPELTVVTNKKALEMVEGYYGTAPSSK--VIDEGDTLEL-GHHVLRFHMIPMVHWPETMVSYDLTDHIVFSGDAFGCFGANGTPLDYQMDPTIYWSEMRYYSNIVGKYGSPVQRALQKLKGLEIDMICATHGPVWTGENVPRVISVYDRLSRVVIAYGSMYG. 259
248 0.000e+00gi|489502629|ref|WP_003407522.1| FprA family A-type flavoprotein [Clostridium butyricum]  clstr ali  17  9...SIKYIGVNDKTLDLFESQYKIPNGVSYNSYVILD-EKVAVMDTVDKRAGSEWLKNLETTLDGRNIDYLVVSHLEPDHAANIKNLADKYPDMKIVGNAKIFNMLPQFFDMDIEDKKIVVGEGDELSL-GSHTLQFFMAPMVHWPEVMVEYEKTEKILFSADGFGKFGALD------IDEDWTPEARRYYINIVGKYGAPVQTLLKKAATLDIKTICPLHGPIL-KDNLGYYIDKYDKWSSYVVAYASIHG. 255
249 0.000e+00JGI.Meta 7063376434 C2730048__gene_245072 beta-lactamase domain protein [Human Stool microbiome from visit number 1 of subject 159551223] :_  ali  16  25......IYWVNDRRTHIFENYWPLPKGVAYNSYIIVD-EKVVVIDTIERSKMDDYVENIEQLLNGRKVDYLVINHMEPDHTGAIKALLCHYPDVKIIGNAKTFPMLKNFYGVCE--NLMEVKEGDSLDL-GKHKLNFYMAPMLHWPETMVTFESTEGILFSGDIFGAFGTDGGIFDDEVDLDYLEEEIRYYSNIVGKYGQPAQTALKKLGGLPIKMVCATHGPI-RRSHIADIVAKYDKWSKVVIVFSSMYG. 275
250 0.000e+00gi|1008836732|gb|KYK20228.1| MBL fold metallo-hydrolase [Thermoplasmatales archaeon SM1-50]  clstr ali  20  1MNIPVKVSWVGKIDWEFHGNELSTHRGSTYNSYLIK-EEKIALIDTVWGPFAKEFVRNLTREIDLEKIDYVIANHGETDHSGALPELMKQIPNTPIYCTSNAVKSLKGQY--HEDWDFQVVKTGDRLNL-GKKDLVFIEAPMLHWPDSMFCYLTGDNILFSNDAFGEHYASEFMFNDLVDQELISEAMKYYANILTPFSALVEKKIKEVLNLPVDVICTSHGVIWRKQIIETYLKWAKSYKENTILYDTMWN. 261
251 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  17  30..NDIYYVGVNDHQVDLFEGQYVVPNGMSYNSYVIKD-EKIAVMDTVDAGFTEEWLGKVAEVLDGAKPDYLVVQHMEPDHAANIENFMKAYPDTTVVANTKTFTMMENFFGMNLEGKKLVVANGDTLTL-GKHVLTFVFAPMVHWPEVMVTYDSTDKVLFSADGFGKFGA----LDVEEDWDR--EARRYYIGIVGKYGPQVQKLLKAAATLDIQTICPLHGPIL-TENLGHYLEKYDIWSEGVMIYTSVYG. 278
252 0.000e+00JGI.Meta 7005404628 SRS013687_Baylor_scaffold_533__gene_1094 flavodoxin [Human Stool microbiome from visit number 1 of subject 159268001] :_  ali  18  8...SIHYVGVNDRHKTLFEGLWPLPYGVSYNSYIILD-DKIALVDTVEVDFFPQFLDNIRRVIGDRQIDYIIVNHVEPDHSGSIALIKKYYPEAVIVGNKKTFDMLSGYYGVGNKGDILEVKQGDTLSL-GHHELAFTMVPMVHWPETMVTLDTTAATLFSGDAFGCFGASGAVIDEDMCCDIFWDEMRYYSNIVGKYGVQVQQALKKLAGVKLDYICSTHGPVWHK-HIERVVSMYDSMSRYVVCYGSMYG. 261
253 0.000e+00 GL0102772 [Complete] locus=scaffold18382_1:2849:4039:-  ali  17  11......IYWVNDRRKQLFENIWPLPNGVSYNSYLIRD-EKCALMDTVESGSDRSYADWVSESLDGRPLDYLIIHHMELDHSGEIENLVQRYPDVKIVGNCKTFRVLEAYFG--KRDNLIEVKDGDTLSL-GYHNLKFVFTPWVHWPETMMTFDQTDGVLFSGDAFGMFGADGGVYDDQTDFAFYEDEMRYYSNIVGKYSPMVQKALAKLRDYPIRTICPLHGLVWRTD-PCKVIGLYDRWSSVVVIYASMYG. 261
254 0.000e+00gi|517173345|ref|WP_018362163.1| flavodoxin [Prevotella nanceiensis]  clstr ali  17  5.KNSVYYVGVNDRNKALFEGLWPLPDGVSYNSYLIVD-EKVCLIDTVDVAFFPQFLDNIRAVIGDRPIDYIVINHMEPDHSGSLGLMRKYYPDVEIVGNKKSFHLLKGFYGISDKE--LEVKNGDELNL-GSHNLKFFMTPMVHWPETMMTLDTTDNMLFSGDGFGCFGANGGIIDEEINCEEFWLEMRYYSNIVGKYGIPVQNALKKFVNEQIDYICPTHGPVWH-QYKEKVMAEYDRMSRYVICYGTMYG. 258
255 0.000e+00gi|524340680|emb|CDA93476.1| flavodoxin [Prevotella sp. CAG:1320]  clstr ali  17  6..NETYYVGVNDRNKNLFEGLWPLPDGVSYNSYLIVD-EKVCLIDTVEVDFFSQFLENIQEVIGDREIDYLVVNHMEPDHSGSLALIKKYFPGIKILGNKKTFGMIEGFYGIDNDG--QEVKNGEVLSL-GKHELQFHLTPMVHWPETMMTLDITTHTLFSGDAFGCFGANGGVIDSEICCDNFWLEMRYYSNIVGKYGTPVQNALKKLAGTQIDYICSTHGPVWH-DYKDKVIAMYDRMSKYVICYGTMYG. 258
256 0.000e+00gi|543001150|gb|ERI96074.1| metallo-beta-lactamase domain protein [Blautia sp. KLE 1732]  clstr ali  18  30..NDIYYVGVNDHQVDLFEGQYVVPNGMSYNSYVIKD-EKIAVMDTVDAGFTEEWLGKVAEVLDGAKPDYLVVQHMEPDHAANIENFMKAYPDTTVVANTKTFTMMENFFGMDLEGKKHIVANGDTLTL-GKHVLTFVFAPMVHWPEVMVTYDSTDKVLFSADGFGKFGA----LDVEEDWD--CEARRYYIGIVGKYGPQVQKLLKAAATLDIQTICPLHGPIL-TENLGHYLEKYDIWSEGVMIYTSVYG. 278
257 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  17  3MYCTRKITWVGARRLALFEGVFGVPDGVSFNSYLLTD-EKTVLFDTVDNAVRTTFRENVTHALAGRTPDYLVVHHMEPDHAAEMADMARLYPDMTILCSAAAKNMIAQFFDAELAARVTVVKEGDTL-CTGRPTLRFIAAPMVHWPEVLMTYDETDKLLLSADAFGSFGANGALFADEVDFDRDDEARRYYANIVGKYGAQVQAVLQKAAGLDVQMLLPLHGHVWRRD-LGYILGKYDLWSRGVMIYASVYG. 267
258 0.000e+00JGI.Meta 7035558565 SRS016495_LANL_scaffold_6498__gene_10536 hypothetical protein [Human Stool microbiome from visit number 1 of subject 159  ali  16  7...TIRYIGVNDHQIDLFEGQYPVPNGMAYNSYVILDQ-KIAVMDTVDINFTQEWLRNLETELGGRKPDYLVIQHMEPDHSASIRHFLEAYPDTTVVATAKAFAMISQFFDLDLADHALTAENGATLSL-GAHELNFIFAPMVHWPEVMMTYDSTDKVLFSADAFGKFGA----LDVEEDWD--CEARRYYIGIVGKYGAQVQNVLKKAAGLDIQTICPLHGPVL-KDNLAHYIEKYNIWSEGVMIYTSVYG. 253
259 0.000e+00 GL0059694 [Complete] locus=scaffold8508_1:196:1413:-  ali  18  3MYCIRKVTWVGARRLALFEGVFGVPDGVSFNSYLLMD-DKTVLFDTVDSAVRTTFRENVAHVLNGKAPDYLVVHHMEPDHAAEMADLARQYPDMGILCSAAAKNMIAQFFDAELAGRVTVVKEGDTL-CTGRHTLRFIAAPMVHWPEVLMTYDETDKLLLSADAFGSFGANGTLFADEVDFDRLDEARRYYTNIVGKYGAQVQAVLQKAAGLDIRMLLPLHGHVWRQD-LGYILGKYDLWSRGVMIYASVYG. 267
260 0.000e+00 GL0079447 [Complete] locus=scaffold7605_8:2078:3271:-  ali  18  7...NIYYVGVNDRNKELFEGLWPLPNGVSYNSYLIVD-EKVCLVDTVEVDFFMPYIKNIKEVIGNRKIDYLVINHMEPDHSGAIELIRKYYPEIKIVANKKTFGMIEGFYGITT--NEVEVKNGSKLSL-GRHELNFVLTPMVHWPETMVTLDTTSNVLFSGDAFGCFGANGGIIDSDINCDTFWLEMRYYSNIVGKYGVPVQNALKKLEGVQLDYICSTHGPVWH-EHISKVIDIYDRLSRYVICYGTMYG. 258
261 0.000e+00 GL0184067 [Complete] locus=scaffold14210_3:3734:4948:+  ali  19  1MYCTRKVTDDDDRRLACFEGVYGVPDGVSYNSYVMLD-EKTAIFDTVDKAVYQTYFENVAHALGGRRPDYLVISHMEPDHAYTIEALLLRYPELKLVCNSKIETMLKNFFGVDFTDRLHIVKEGDVLEL-GRHKISFVMAPMVHWPEVMMSYDSTDGILFSADAFGTFGANGRLFADETDFENVDEARRYYTNIVGKYGVQVQAVLKKAAGLALNYVCPLHGFVWRRDFLDKYLKWYAAEENSVMLYASVYG. 266
262 0.000e+00gi|503126214|ref|WP_013360875.1| flavodoxin [[Clostridium] sticklandii]  clstr ali  15  9.HEDVHYIGVNDRETHLFENMWPLDNGISYNSYLLTG-EKNVLLDTVKITKVDSFLVKIQNILKDKPLDYLVIHHMEPDHSGSIKSVIDMYPDVKLVGNKKTQDFLEAFYGVT--GNFIEVKEGDTLDL-GDKKLTFYMTPMVHWPESMVSYESKHKILFSQDAFGGFGADGPIFDDEINWDFYEETRRYYSNIVGKHSKQVQVAIKKLAGLDISMICPVHGPVWRSK-PEKIVSLYDKWSKVVIVYGTMYG. 262
263 0.000e+00 GL0111770 [Complete] locus=scaffold13012_10:2786:4006:-  ali  17  6.MSIRKITDDSDRRLALFESAYPVPEGVSYNAYLLRD-EKNVLFDTVDKAVADTFLTATAEALDGADLDYVVVQHMEPDHCATLGAVLTRWQNAVVVCNKKTVTLLNQFFGLDLTGRTRLVAEGEEL-CTGRHTFTFVMAPMVHWPEVMMTYDKTDGTLFSADAFGGFGASGNLFADEADLGYMEEMRRYYTNIVGKYGVQVQAVLKKAAALDIRRICPLHGYIWRGE-LGMVLEKYSLWSSVLVAYASVYG. 270
264 0.000e+00gi|524785160|emb|CDE84602.1| beta-lactamase domain protein [Clostridium sp. CAG:273]  clstr ali  21  1.MNTKIITWVGKTDWEFHGDEFTTEHGSSYNSYLIKD-EKTVLIDTVWLPYDREFVSNLKKEIDLNKIDYIIMQHGEVDHSGALIELMDEIPNIPIYCTANAVKSIKGQY--HKDWNFNVVKTGDKLN-IGKHTLTFIETPMLHWPDTMFTYMDNEGILFSNDGFGQHLASEFLYADEVEQDKLWEAITYYANILAPFNMMVKNKINEILNLEINMICPSHGLIWRKQILTKYLEWADNYNENTILYDTMWN. 261
265 0.000e+00 GL0107185 [Complete] locus=scaffold2020_1:2138:3343:-  ali  15  1MYCYKQIYWIGDRRLALFENVYPLTNGVAYNSYVLLD-EKIVVFDTVDKEISARYFDNLAALLKDKSPDFLVVHHMEPDHAACIAEFLLRYPDVTIVCNAKTQAMIAEFFGAKAALNVRTVTEQDTLET-GRHSFRFVFAPMVHWPEVMVSFDVTDGTLFSADAFGTFGADGNLFADEINFEKLPEARRYYANIVGKYGAPVQALLKKAAALPVKTVCPLHGPVWR-ENIAWFVDKYDKWSSYTIFYGSVYG. 265
266 0.000e+00 GL0140106 unmapped_[Complete]_[mRNA]_locus=scaffold8993_3:2416:3570:-  ali  17  5..KDIKYVGVNDHKIDLFEGQYIVPNGMAYNSYIIMD-EKVAVMDTVDANFNDEWLANIKGVLADREPDYLVIQHMEPDHSANIANFMEVYKNTKIVSNTKAFVMMKQFFGTDFAERQVVVNDGDTLSL-GNHMLTFVFAPMVHWPEVMVTYDSTDKVLFSADGFGKFGALDA------DEEWDCEARRYYIGIVAKYGKQVQTLLNKAAALDIKAICPLHGPVL-AEDLGHYINLYDIWSSYVIAYTSVYG. 252
267 0.000e+00JGI.Meta 7066233241 SRS056519_LANL_scaffold_27990__gene_58835 hypothetical protein [Human Stool microbiome from visit number 2 of subject 76  ali  17  9...SIQYIGVDDKTIDLFESQYIVPHGISYNSYVILD-EKIAVMDTVDARATGPWLKNLADVLGDRKPDYLVVSHMEPDHASNIQTLAEKYPDMKIVASAKALSMIPQFFTFDISDRSIVAKEGETLSL-GQHTLQFFMAPMVHWPEVMVSYEQHEKVLFSADGFGKFGA----LDAEEDWD--CEARRYYFNIVGKYGMQVQALLKKAATLDIQTICPLHGPIL-KENLGHYIGKYDVWSEGVIAYASIHG. 255
268 0.000e+00gi|493298504|ref|WP_006256127.1| flavodoxin [Alloprevotella tannerae]  clstr ali  20  5..NNIHYVGVNDRVKHRFEGLWLLPHGVSYNSYLVVD-EKVALIDTVEADFFPIFLDKIREILGERPIDYLVVNHMEPDHSSSIAYIRKYYPEVKLVGNKKTFDMIGGFYGLTTEDDV-EVKEGSELSL-GNTTLRFHLVPMLHWPETMVTYCVEQKVLFSGDAFGCFGANGHVLDTTMDIERYIPEMRYYAAILGKYAKPVQAALKKLGGLEMNMICSTHGPVW-TENIPRIIETYHRLSAGVICYGSMYG. 258
269 0.000e+00gi|543218105|ref|WP_021023449.1| anaerobic nitric oxide reductase flavorubredoxin [Salinivibrio costicola]  clstr ali  19  8.....NIRWVGQRDWEFHGTEYKVTKGTSYNSYLIQ-EEKTVLIDTVDHRFSQQFLQNLEREIDLESIDFIVVNHAEKDHSGAMSALMERIPDTPIYCTEAAIDSIVGH-HHHPEWNFNTVKTGDSIDIGNGKQLIFVEAPMLHWPDSMMTYLTEDAVLFSNDAFGQHYCDERLFNDEVDQELMEQCLRYYSNILTPFSRLVTAKIKEVLNLPVDMIATSHGVVWRDQIIEQYLAWADDYQEDTIFYDSM... 261
270 0.000e+00gi|505139376|ref|WP_015326478.1| flavoprotein [Halobacteroides halobius]  clstr ali  18  1.MEAIKIT-DNIYWVGGIDWDYSTQRGSTYNAYLIVD-DKVTLIDTVKHYLYDEMIERISKVIDPAEIDYVVSNHVEMDHSGGLSKLMKVASDATIITSPKGKSGLQKHYQ--GDWDFQLAKPGEELDL-GSRSLNFVFTPMVHWPDNMVTYLPEEKILFSNDAFGQHLASSERFDDQYPLDILEEAKKYYANIVLPYGAQVQRALDTVSDLDVEMIAPSHGIIWR-DNITKIIKQYQKWSKAVIIYGTMW.. 257
271 0.000e+00gi|571051996|gb|AHF25675.1| putative flavoproteins [uncultured bacterium Contigcl_30]  clstr ali  17  5.KKDIFYIGVNDHEIDLFEGQYIVPEGMAYNSYVIMD-EKIAVMDTVDQHFGEIWLKNLEEALQGRKPDYLIVQHMEPDHSANIAAFMARYPQAQAVATAKAFTMMKQFYGEDYADRRIVAAEGSTLEL-GSHTLRFVTAPMVHWPEVMMTYDAQAKVLFSADAFGKFGA----LDTEDEEGWACEARRYYFGIVGKYGAQVQAVLKKAAALEIETICPLHGPVL-KEDLPYYLGLYNTWSEGVVIYTSVYG. 255
272 0.000e+00gi|524468198|emb|CDC12084.1| uncharacterized flavoproteins [Clostridium sp. CAG:413]  clstr ali  18  5..NDIKYVGVNDHEIDLFEGQFTVPNGMAYNSYVITD-EKTAVMDTVDARFTAEWLGNIESVLGGRKPDYLVVQHMEPDHSANIVNFLTAYPEATVIANSKTLTMMKNFFDYDFDGKVQLVEDGSSISL-GRHELTFVFAPMVHWPEVMFTYDKADKVLFTADGFGKFGALD------VDEEWDCEARRYYFGIVGKYGAQVQSVLKKAAALDINIICPLHGPVL-SEDLGHYIEKYDIWSEGVMIYTSVYG. 252
273 0.000e+00gi|655060268|ref|WP_028508578.1| flavodoxin [Ruminococcaceae bacterium AB4001]  clstr ali  16  5..NDIIYAGVNDHKIDLFEGQYVVPNGMAYNSYVIKD-DKIAVMDTVDRNFTHEWLDNLEKALDGRKPDYLVVQHMEPDHSANIANFVKAYPEAKIVSSAKAFTMMGNFFGTSFEDRQVVVAEGSTLEL-GKHTLHFVAAPMVHWPEVIMTYDSTDKVLFSADGFGKFGALD------VEEDWACEARRYYIGIVGKYGAQVQSVLKKAANLDIQIICPLHGPVL-SENLGYYIGLYQTWSTYVIAYTSVYG. 252
274 0.000e+00JGI.Meta 7079499185 SRS064276_LANL_scaffold_39123__gene_81035 uncharacterized flavoproteins [Human Stool microbiome from visit number 2 of s  ali  17  10....IHYVGVNDRTTTRFEALWSLPMGVSYNAYLVAG-EKIALIDTVEESFGSRLEANIREAIGERKIDYLVVNHMEPDHSSSIAALRRIYPDIEIVGNAKTLQMIEGFYGIAGG--TVEVKEGDTLDL-GGKTLSFHMIPMVHWPETMVTWCAGDRTLFSGDAFGTFGADGGITDSQVETDRYWDEMRYYACIVGKYGGPVQKALQKVRTLPVGTICSTHGPVWQRQ-IAKVLDIYDRLSRVVVAYASMYG. 260
275 0.000e+00gi|836601780|ref|WP_047754684.1| flavodoxin [Kosmotoga pacifica]  clstr ali  18  1MHKGIKIHDVNDNETHLFESLWPLPKGVSYNAYMILD-EKVALIDTVKGGYFSQYLNKIKALLPGKAVDYLIINHMEPDHSGAIKVLVEAFPELKIIGNKKTLQFLEGFYGVTK--NTISVEDGEVLEL-GKHKLKFYLTPMVHWPETMMTYDITSRTLFSGDAFGGFGANGGIFDDQVDLEYYEDEIRYFSNIVGRYSGMVQRAFKKLEGLEIKIIAATHGPVWRS-NPSKIIELYDRWSKVVLVYGSMYG. 262
276 0.000e+00gi|655474753|ref|WP_028857591.1| flavodoxin [Psychrilyobacter atlanticus]  clstr ali  18  1MHNVENISEDNDRKTQRFENYLPLDKGVSYNSYLILD-EKVALIDTVEIGTSENFIEKIEGVLQGRKIDYLIINHMEPDHAGAIKDVIRLYPEITLVGNIKTFPMLDAFNDCSKERNRLVVKEGDTLEL-GKHTLTFAMVPMVHWPESMVSYESATGTLFSNDAFGSFGSDGGIFDDQLNLSFYEDEMRYYSNIVGKYGAPTQAAIKKLGGLDIKCIAPCHGPVWRTE-IARVLGHYDAWSKVVIVYGSMYG. 267
277 0.000e+00gi|928868797|ref|WP_053907787.1| anaerobic nitric oxide reductase flavorubredoxin [Moellerella wisconsensis]  clstr ali  19  8.....NIQWVGQRDWDFHGTEYKTLRGSSYNSYLIQ-EEKTVLIDTVDHKFSREFVQNLSREVDLKAIDYIIINHAEEDHAGALSELMTHIPNTPIYCTANGVDSINGH-HHHPEWDFHIVKTGDSLDIGNDKKLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQELFEQCQRYYANILTPFSRLVTPKINEILGLPVDMIATSHGVVWRDQIVELYLKWAADYQEDTIFYDTM... 261
278 0.000e+00gi|524317827|emb|CDA76856.1| metallo-beta-lactamase domain protein [Bacteroides sp. CAG:530]  clstr ali  18  6...NVHYVGVNDRNKTLFENLWPLPYGVSYNSYLIADDDAVVLVDTVDVAFFEVYLKKIRAVIGDRKIDYLIINHMEPDHSGSISLIKQYYPDIVLVGNKKTFDMVDGYYGVGGERK--VVAEGDSLK-VGRHDLHFYLIPMVHWPETMVTFDSTDGILFSGDAFGCFGANGGCIDKNINTEIYMEMRRYYSNIVGKFGNPVQKALQKCSGLDIKMICPTHGPVW-EEQISEVVAMYDKLSRVVIAYGTMYG. 258
279 0.000e+00gi|524644145|emb|CDD54533.1| metallo-beta-lactamase superfamily protein [Clostridium sp. CAG:43]  clstr ali  17  5...DIRYIGVNDHDIDLFEGQYQVPNGISYNSYVIMD-EKIAIMDTVDKRKQTEFLENLETALAGRTPDYLVISHMEPDHASSIQAVVERYPEITLVGNAKTFPMLKLYFDLDTSR-ALTVKEGDTLKL-GRHELTFVMAPMVHWPEVMVSYDSCDKVLFSADGFGKFGALD------VDEDWDCEARRYYFNIVGKYGMQVQTLLKKVAGLEIQLICPLHGPVL-KETIGHVLEKYQIWSEGVIAYASLHG. 250
280 0.000e+00gi|914319170|ref|WP_050571245.1| anaerobic nitric oxide reductase flavorubredoxin [Cronobacter dublinensis]  clstr ali  18  18......IFWVGQRDWDFHGTEYKTLKGSSYNSYLIR-EEKNVLIDTVDHKFSRDFVNNLRSEIDLADIDYIIINHAEEDHAGALTELMNCIPDTPIYCTANGVDSINGH-HHHPEWNFHVVKTGDTLDIGNGKKLIFVETPMLHWPDSMMTYMTGDAVLFSNDAFGQHYCDEHLFNDEVDQELFEQCQRYYANILTPFSRLVTPKITEILGLPVEMIATSHGVVWRDQIVELYLKWAADYQEDTIFYDTM... 270
281 0.000e+00gi|499148806|ref|WP_010862133.1| anaerobic nitric oxide reductase flavorubredoxin [Plesiomonas shigelloides]  clstr ali  19  1MHIQVKIHWVGQRDWDFHGTEYKTTKGTSYNSYLIR-EEKTVLIDTVDHKFSHAFVANLKQEIDLRSIDYIVINHAEEDHAGALSALMAEIPNTPIYCTRAAIDSITGH-HHHPEWNFRTVKTGDTLDIGNGKALVFVEAPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDERLFSDEVDQELMEQCLRYYANILTPFSQLVTAKIQEVLNLPVTMIATSHGIVWRDQIIEQYLRWADQYQEDTLFYDSM... 261
282 0.000e+00gi|505227384|ref|WP_015414486.1| anaerobic nitric oxide reductase flavorubredoxin [Desulfovibrio piezophilus]  clstr ali  19  9......VSWVGKIDWEFHGEEYSTFKGSSYNSYLIQD-EKTVLIDTVYGPFGKEFIENLENEIDLGSIDYVIANHAEVDHSGALPELMRRIPNVPIYCTQQATKSLKGYY--HQDWNFQVVKTGDTLSL-GERTLNFISAPMLHWPDSMFTYLDKENMLFSNDAFGHHLASDTMFNDLVDQDLFKECIKYYANILTPFSKMVTKKINEIVGLPVDFILPSHGVIWRDDIVHKYLEWADDYQENTIIYDTMWN. 261
283 0.000e+00gi|736151227|ref|WP_034282693.1| flavodoxin [Candidatus Alistipes marseilloanorexicus]  clstr ali  17  1MYCGQKIYWTGDRRKHLFENMWPLPEGVSYNSYLIKD-EKCALMDTVESGSDRSYLDWLADTLEGRPLDYLVIHHMELDHSGEIENLIRQYPDVRIVGNAKTFRVLEAYFGKLP--NLVEVKDGDTLSL-GYHNLKFVFTPWVHWPETMMSYDTTDGVLFSGDAFGMFGADGGVFDDQVDFARYEEMRRYYSNIVGKYSGMVQKALAKLSSARIGAICPLHGLVWRSD-PARVIGLYDRWSRAVVIYASMYG. 261
284 0.000e+00gi|992021536|ref|WP_061000637.1| nitric oxide reductase [Photobacterium aquimaris]  clstr ali  18  8.....NITWVGQRDWDFHGTEYKTTRGTSYNSYLIR-EGKNVLIDTVDHKFTLAFLQNLEQEINLNDIDYIVINHAEEDHAGALTELMSRIPNTPIYCTENAIDSIVGH-HHHPEWNFNTVKTGDTLDIGNGKALVFVETPMLHWPDSMMTYMTEDAVLFSNDAFGQHYCDERLFNDEVDQELLDQCLRYYSNILTPFSPLVTNKIHEVLGLPVDMVATSHGVIWRDQIIEKYLEWANQYQENTIFYDSM... 261
285 0.000e+00gi|987318705|gb|KXB32862.1| metallo-beta-lactamase domain protein [Bacteroidales bacterium KA00251]  clstr ali  19  1MTDQIKITDVNDRTKALFENLWPLTRGVSYNSYLIVD-EKVTLIDTVDICYSEQFFRQIQRIIGDRPIDYLIVDHMEPDHSGSIGMLKKWYPNISIVGNKLTFKMLQEYY--DISDNLITVKEGDTLN-IGSRELTFAMAPMVHWPEVMFTYDPKDKVLFSADAFGTFGSDGNVFDYATNLDFFMEEMRYYACIVGKYGKFVQKTLKKLDSLDVKTICATHGPVWTDFGFKKALEVYDRLSKAIVLYGSMYG. 262
286 0.000e+00gi|523980764|emb|CCX66372.1| flavodoxin [Prevotella sp. CAG:1058]  clstr ali  18  8....IYYVGVNDRNKELFEGLWPLPNGVSYNSYLI-DDEKVCLIDTVEVDFFMPYLKNIREILGDRQIDYLVINHMEPDHSGAIELIRKYYPGVKIVANKKTFGMIDGFYGITTDE--VEVKNGSKLSL-GRHELTFVLTPMVHWPETMVTLDTTTNTLFSGDAFGCFGANGGIIDSEINCDTFWLEMRYYSNIVGKYGTPVQNALKKLEGVQLDYICSTHGPVWH-EHISKVIGIYDRLSRYVICYGTMYG. 258
287 0.000e+00gi|497284386|ref|WP_009598603.1| MULTISPECIES: flavodoxin [Alistipes]  clstr ali  17  1.MNITEIVGVNDRTTTRFEGLWSLPHGVSYNAYLVAD-EKVALIDTVEEAFGSRLFENIRETIGDRPIDYLVVNHMEPDHSSSIRALRLLYPDIRIVGNAKTLQMIQGFYGIDTG--TLEVKEGDTISL-GAKTLSFYMAPMVHWPETMVTWCAEAGTLFSGDAFGTFGADGGITDSQLDPSRYWDEMRYYACIVGKYGGPVQKALAKVRGLNPTTICSTHGPVWQRQIPQ-VMDIYDRLSRVVLAYGSMYG. 260
288 0.000e+00gi|557309268|ref|WP_023385054.1| MBL fold hydrolase [Youngiibacter fragilis]  clstr ali  20  8.....NVTWVGKIDWEFHGDEYSIHRGTHYNSYLVRD-EKTVLIDTVWDPFDKEFVENLKKEIDLNKIDMIVANHAEIDHSGSLPLLLKEIPNVPVYCTANGMKNLKGHF--HEDWNFVTVKTGDSIE-IGERKLIFVEARMLHWPDSMMTYMTKDNILFSNDAFGQHFASDLMYNDLVKCELFEEAIKYYANILTPFSALVTNKIKELLNLPVDMICPSHGIIWRGQIIEKYMEWANRYKENTLVYDSMW.. 260
289 0.000e+00gi|315620619|gb|EFV00600.1| rubredoxin [Pseudoramibacter alactolyticus ATCC 23263]  clstr ali  19  8.....KVTWVGKVDWEFHGDEFSTDRGSSYNAYLIQD-EKTVLIDTVWGPYDREFVKRLAETVDLNRIDYIVMNHNESDHSGALPELMRRIPDTPIVCTKKGEAILRGHY--HEDWHFIPVKTGDTLNL-GETTLTFVEAPMLHWPDTMFSYLSGENILFSNDGFGQHFATESLYDDTVDPSALYEAEKYYANILNLYSPMVTRKINEILALPLDMICPSHGVIWKNDIVNQYLKWADAYQENTLVYDTMW.. 260
290 0.000e+00 GL0018635 [Complete] locus=scaffold1937_5:20292:21446:-  ali  18  1MFKVIIYVGVNDHEVDLFEGQYDVPNGMAYNSYVVLD-EKVAVFDTVDAHFKDEWLANLEEAFAGRTPDYLIVQHMEPDHAANIANFAEKYPEAKIVGNAKTFPMMKQFFGTDFADRQVIVKEGETLST-GKHNLTFVMAPMVHWPEVMMTYDTTDKIFFSADAFGKFGALD------VEEEWDCEARRYYIGIVGKYGPMVQKLFGKVGSLEIKAICPLHGPVL-TENLEHYLNLYNIWSSYVIAYTSVYG. 253
291 0.000e+00gi|350278796|gb|AEQ21986.1| metallo-beta-lactamase [Acidaminococcus intestini RyC-MR95]  clstr ali  19  63......VTWVGKVDWEFHGHEYSTEKGSSYNAYLIRDK-KTVLMDTVWKPYDDEFVENLKKEIDLHQIDYIVMNHNENDHSGALPALMAEIPDTPIYCTKKGEAILRGLY--HKDWNFVNVKTGDTLDL-GTHQLIFIEAPMLHWPDTMFTYMTGENILFSNDGFGQHFASEDLFNDQADQAALYEAMKYYANILNLYSPMVTRKIDEILNVPVSMICPSHGVIWRKDIVKAYQKWAQAYQENTILYDTMWN. 315
292 0.000e+00gi|671531844|ref|WP_031515652.1| MBL fold hydrolase [Desulfotomaculum alkaliphilum]  clstr ali  20  1MKKTLKVHWVGKVDWEFHGDEYSTHNGSTYNAYLIQ-EEKNVLIDTVWSPFAAEFVDNLAKEIDLNKIDYIVVNHGEVDHSGALPELMKRIPSTPIYCTANAVKSLKGQY--HQEWNFNVVKTGDKLDIGNGKELVFVEMPMLHWPDSMAAYLTKDNILFSNDAFGQHYATEKMFNDLVDCDLYKEAIKYYANILTPFSHILRRKLDEILNLAIDIIAPSHGVIWRDQIVEKYSQWANDYQQNTIIYDTMWN. 262
293 0.000e+00gi|766664388|ref|WP_044824282.1| flavodoxin [Clostridium aceticum]  clstr ali  17  1MLNTVEVTKVNDRETHLFENLWPLDKGVSYNAYLIND-DKVAIIDTVKNTKMDAFMDKVEGIIGDKSVDYLIINHMEPDHSGAIKAVRERYPKVMLVGNKKTFEFLENFYGKM--DNYYIIDDGDTLDL-GEHQLKFYLTPMVHWPETMMTYEVNNKVLFSADAFGGFGTDGGIFDDEVNLEFYTDERRYYSNIVGKYGAMVQKALKKLAAIDIKIIAPTHGPVWRT-NPSCIIDYYDRWSKAVIVYGSMYG. 263
294 0.000e+00gi|746429335|ref|WP_039469765.1| nitric oxide reductase [Photobacterium gaetbulicola]  clstr ali  20  8.....NIHWVGQRDWDFHGTEYKMTKGTSYNSYLIR-EEKTVLIDTVDHRFSQQFIQNLEMEIDLQAIDYIVINHAEEDHSGALSALMARIPNTPIYCTENAVDSIVGH-HHHPEWNFHVVRTGDTLDIGNGKQLIFVEAPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDERLFNDEVDQELMEQCLRYYSNILTPFSSLVTAKIHEVLNVPVDMIATSHGIVWREQIVHQYLEWANDYQEDTIFYDTM... 261
295 0.000e+00JGI.Meta 7058189188 SRS049959_WUGC_scaffold_21140__gene_40139 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  18  3MYCIRKVTWVGARRLALFEGVFGVPDGVSFNSYLLMD-DKTVLFDTVDSAVRTTFRENVAHVLNGRAPDYLVVHHMEPDHAAEMADLARQYPDMGILCSAAAKNMIAQFFDAELAGRVTVVKEGDTL-CTGRHTLRFIAAPMVHWPEVLMTYDETDKLLLSADAFGSFGANGTLFADEVDFDRLDEARRYYTNIVGKYGAQVQAVLQKAAGLDIRMLLPLHGHVWRQD-LGYILGKYDLWSRGVMIYASVYG. 267
296 0.000e+00gi|640330940|ref|WP_024866016.1| flavodoxin [Butyrivibrio sp. FCS014]  clstr ali  17  1MKGIRKIYWIGDRRLSRFENIFPIPEGVSYNSYFV-DDEKTAVFDTADVSVADQYLENLGEALSGKKLDYLIVLHMEPDHCSQIANVTALFPEVTVVGSKQTFTFMEQFFPEAKDYKRLEVKEGDTLST-GAHTFKFVAAPMVHWPEVLFAYDETSKALLSADAFGTFGADGGLFADEYDFEKDFSARRYYANIVGKYGVQVQAVLKKAAGLDIGMILPLHGPVWRKD-IAWFVDKYNKWSTAIVVYGSLYG. 265
297 0.000e+00JGI.Meta 7045821900 C3118339__gene_245112 hypothetical protein [Human Stool microbiome from visit number 1 of subject 159207311]  ali  17  5..KDIRYIGVNDHEVDLFEGQYVVPNGMAYNSYVIID-EKIAVMDTADVHFKDEWMANLKTALEGRSPDYLVVSHMEPDHSANIAAFLQEYPEAKVVATRMAFTMMGQFFGDDYASRRIIAAEGSTLPL-GKHTLTFYTAPMVHWPEVMVTYDSTDKVLFSADGFGKFGALDA------DEDWACEARRYYIGIVGKFGPQVQALLKKASALDISIICPLHGPIL-TENLGYYLNLYNTWSSVVIAYTSVYG. 252
298 0.000e+00gi|518270629|ref|WP_019440837.1| anaerobic nitric oxide reductase flavorubredoxin [Moritella marina]  clstr ali  20  8.....NISWVGQRDWDFHGTEFKTEKGTSYNSYLIQ-EEKTVLIDTVDHKFCYEFIQQLELEIDLNKIDYIVINHAEEDHAGALAALLNRIPNTPIYCTENAIDSIVGHHHQP-DWNFNVVKTGDSLDLGNGKQLVFIETPMLHWPDSMMTYMTGDAVLFSNDAFGQHYCDERLFNDEVDTELMDQCLRYYANILTPFSALVTAKIKEVLNLPVDMIATAHGVVWRDQIIEQYLTWADKYQEDTIFYDSM... 261
299 0.000e+00gi|495213102|ref|WP_007937882.1| MULTISPECIES: MBL fold metallo-hydrolase [Pelosinus]  clstr ali  20  1MMNNIEIYSVGAVDWDFHG--YGTPRGITYNAYLIVD-EKICLIDTVKAPFASELLERISQIVDPAKIDYIVCNHTEPDHASALPIIMEKTPQAKVVLTSQGKDSIVKHYNKEYD--FQVVKEGDSLDL-GAKQLKFITMPMLHWPDSMATYLTGEEILFSNDAFGQHISTTKRFDDENEIDVMQEAAKYYANILMPYSRLVGTALTKAETVKIKMIAPSHGVIWRS-HIEDILKKYEQWGSGVIIYDTMWG. 259
300 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  16  1MHNVRKVTDDDDHRLHLFENIHPIPRGVSYNSYLLMDK-KTVLFDTVDWAIGRQFLENLEYVLNGKKLDYMVINHMEPDHAAMIEEILLRYPDVRIISNEKAFYLMNQFGYHIHPEKCETVVEGDTKSF-GKHKVVFVAAPMVHWPEAMVTFDTTNGVLFSADAFGSFGADGRLFNDEVNFDRDWDARRYYTNIVGKYGPHVQFLLKKAPVDQIKFICPLHGPVWRNDF-AYLLDKYNKWSKYIIVYASMYG. 265
301 0.000e+00 GL0109875 [Complete] locus=scaffold817_6:1493:2839:+  ali  17  1MYCTRKVTWVGARRLAMFEGVFDVPNGISFNSYLLRD-EKTVLFDTADAAVRRTFRENLLHALEGRPLDCVVVHHMEPDHTAELEELVLRFPEVQIYCSAMAKTMMTQFFGPGFQERIHVVKEGDTL-CTGRHTLRFIAAPMVHWPEVLMTYDETDRLLLTADAFGCFGANGRLFADEVDFDRDYEARRYYTNIVGKYGSQVQAVLKKAAELDIAMLLPLHGFVWRKELLHKYDLWYEPEERGVIAYASVYG. 265
302 0.000e+00gi|494007234|ref|WP_006949703.1| flavodoxin [Prevotella marshii]  clstr ali  17  6..NKVYYVGVNDRHKALFEGLWPLPNGVSYNSYLI-DDDKVCLIDTVEVDFFVQFMENLREVIGNRPVDYIVINHMEPDHSGSLSLIRKYYPNVQIVGNKKTFDMLKGFY--DIESGTVEVKNGDTLEL-GHHTLNFFMTPMVHWPETMMTLDTTAGTLFSGDAFGCFGANGGIIDKDIDCSSFWLEMRYYSNIVGKYGTPVQNALKKLKDVSFDYICSTHGPIWH-EHIERVVSLYDAMSKYVICYGTMYG. 258
303 0.000e+00gi|524034483|emb|CCY15989.1| metallo-beta-lactamase domain protein [Prevotella sp. CAG:755]  clstr ali  19  7....VHYVGVNDRVKHRFEGLWLLPQGVSYNSYLI-DDEKVVLIDTVDVAFFTEYLDNIRAVIGDRPIDYLVINHMEPDHSGSIALIRKYYPEIRLVGNKKTFEMVEGFYGVPTEGD-LVVAEGDSLPL-GHHRLRFHLVPMLHWPETMVSYDETEHILFSGDAFGCFGANGNVVDEQMDTTPYWPEMRYYASILGKFSPMVKRALAKLGGLQIDMICSTHGPVWKKE-VARAVGVYDRMSRGVVCYGSMYG. 258
304 0.000e+00 GL0096789 [Lack 5`-end] locus=scaffold95911_1:97:1281:-  ali  17  5.MKAVEIYWVGVKDWEFHG--YTTSRGSTYNAYLIID-DKVTLIDGVKAPFTDLFMQRISSVIDPAKIDVVVCNHVEMDHSGALPAIMEKAKNATLYCPPAGERGLKMHYDTT-GWKMQIVKTGDTLN-IGKHTLTFVQMPMVHWPDSMMTYVADEKLLFPNDGFGQHYASDELFDDENLDIIMDEAKKYYGNIVWPYGAQVQKVLETAATLDIEMIAPSHGVIWRK-HIPEIVEKYKLWSKAVVVYDSMWG. 263
305 0.000e+00gi|917058911|ref|WP_051665623.1| hypothetical protein [Erysipelotrichaceae bacterium NK3D112]  clstr ali  19  1MHCTKKILDDDDRRLTCFEGVYGVPDGVSYNSYLMLD-EKTVLFDTVDKAVARTFFDNVAYGLNGRKLDYLVIHHMEPDHAATIEDLIYRYPDTTIVCSDKIKAMLAQFFDYDMSGKIHLVKEGDVLNT-GKHELTFVNAPMVHWPEVMMSYDKTDGILFTADAFGTFGANGRIFADEVDFDWLDEARRYYTNIVGKYGMQVQMVLKKAAALDIKYVCPLHGFVWRK-HFGDFLEKYNLWSKGVLAYASVYG. 265
306 0.000e+00gi|503952696|ref|WP_014186690.1| MBL fold metallo-hydrolase [Desulfosporosinus orientis]  clstr ali  19  1.MKPIQIYWVGGIDWNFHG--YSTPRGTTYNAYLIID-EKVTLIDTVKHYLIDEMLARISEIIDPTKIDYVVSNHVEMDHSGGLPRIMALTPNAKLFTSPNGEKGLKAHYK--GNWDYTIMKSGETL-CLGNRNLTFVNTPMVHWPDNMVCFVPEEKILFSNDAFGQHIATSERFDDQLPLGIMEEAAKYYANIVLPYGSQVQKALESVGGLEIETIAPSHGIIWRTNIISEYQKWYETEEKAVIVYDTMWN. 258
307 0.000e+00gi|837765505|ref|WP_047873611.1| anaerobic nitric oxide reductase flavorubredoxin [Photobacterium aphoticum]  clstr ali  20  8.....NIHWVGQRDWEFHGTEYKMTKGTSYNSYLIR-EEKTVLIDTVDHRFSQQFIQNLETEIDLADIDFIVINHAEEDHSGALSALMTRIPNTPIYCTENAIDSIVGH-HHHPEWNFNVVKTGDSLDLGNGKQLIFVEAPMLHWPDSMMTYMTEDAVLFSNDAFGQHYCDERLFNDEVDQELMEQCLRYYSNILTPFSGLVTAKIHEVLNLPVDMIATSHGIVWRDQIIHQYLAWADNYQEDTIFYDTM... 261
308 0.000e+00gi|490184419|ref|WP_004083031.1| hypothetical protein [Clostridium sp. ASF502]  clstr ali  17  5..NDIKYVGVNDHEVDLFEGQYVVENGMAYNSYVILD-EKTAVMDTVDARFTHEWLDNVQAALGSRKPDYLIIQHMEPDHSANIANFMQVYKDTTIVSSEKAFVMMKQFFGTDFEDRQIVIKEGDSLSL-GKHELAFVAAPMVHWPEVMVTYDSYDKVLFSADGFGKFGALD------VEEDWACEARRYYIGIVGKYGSQVQNLLKKAAGLDIRIICPLHGPVL-TENLGYYLGLYQTWSEGIMIYTSVYG. 252
309 0.000e+00gi|655355116|ref|WP_028761590.1| anaerobic nitric oxide reductase flavorubredoxin [Shewanella putrefaciens]  clstr ali  20  8.....NIHWVGQRDWDFHGTEYKITKGTSYNSYLIR-EEKTVLIDTVDHRFSQQFLQNLEAEINLTDIDYIVMNHAEEDHSGALTALMAKIPNTPIYCSENAVDSIVGH-HHHPEWNFITVKTGDSLAIGNGKQLIFIEAPMLHWPDSMMTYLTEDAVLFSNDAFGQHYCDEHLFNDEVDQELMEQCLRYYSNILTPFSSLVTAKIHEVLNLPVDMIATSHGIVWRDQIIHQYLAWADAYQEDTILYDSM... 261
310 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  17  1MYFCTKITGVNDRKTERFENYIPLPYGVTYNSYFI-DDEKTCVIDAVEIGSASTLLDKIADCLEGRKLDYIIINHVEPDHSSGLKEVIKIYPDIKVVGNSKTIGMLRAFCFDFPEENFITIKEGEILDL-GKHKLTFTMMPMVHWPESMTTYDITDKILFSNDAFGSFGADGGIFDDQVNFDFYEEMRRYYSNIVGKYGMQVTNVIKKLANIEIKYICPSHGLLWRDD-IPKVISLYESWAKVVIVYGSMYG. 264
311 0.000e+00 GL0136770 [Complete] locus=scaffold1630_2:6853:8067:+  ali  19  7MKNTKLVAKDSDRRLALFENLFPLPNGVSYNSYVVLD-EKITLFDTADVSVADQYLENLHSVLGEKKPDYLVVLHMEPDHCSLLQTVLNQYPETTVVSSMQTFKFISQFFPELKIENQQIVKEGDTL-CTGAHTFHFVAAPMVHWPEVLLAYDDADKALFSADAFGTFGAEGGIFADQYDFEAHYDARRYYANIVGKYGAQVQAVLKKAAGLEIEEILPLHGPVWR-ENLGWFLEKYQTWSSYLVVYGSLYG. 271
312 0.000e+00 [EC:1][KEGG:K00540]|[COG0426] Uncharacterized flavoproteins  ali  16  30...SVIYIGADDHDIDLFESQYVVPNGVSYNSYVIID-EKIAVMDTADPRVTDVWFDNLEKALNGRKPDYLVVQHMEPDHAGNIKKLAEKYPEMKIVGNAKTFPMMKQFFTIDLDDRSVVVKEGDTLSL-GSHTLQFVMAPMVHWPEVMVTYEQSEKLLFSADGFGKFGALD------VEEDWACEARRYYFNIVGKYGAQVQALLKKASALDIKMILPLHGPIL-KEDLGYYLGLYNTWSKGVVVYASIHG. 277
313 0.000e+00gi|973118738|gb|KUK74227.1| Beta-lactamase domain protein [Clostridiales bacterium 38_11]  clstr ali  19  1MFKITEVSWVGKIDWEFHGEEYTTNRGSSYNSYLIRDK-KTVLIDTVWLPFSREFVADLKKEIDLKAIDYIIVNHGEVDHSGALIDLMKEIPETPIYCTKKGVESLKGQYHT--DWNLNIVKTGDTLDL-GEGTLTFIEATMLHWPDTMFTYYSKDAILFSNDGFGQHYASEAMYNDKVDQELYQEALKYYANILTPFSSQVTRKIKEILNLPLKMICPSHGVIWRDQIVDQYLKWADSYQENTILYDTMW.. 259
314 0.000e+00gi|780919992|gb|KJS87287.1| metallo-beta-lactamase [Peptococcaceae bacterium BICA1-8]  clstr ali  21  1MMEAKNIYWVGIKDWEFHGEEYTTHRGSTYNSYLIKD-EKIALVDTVWTPFREEFISELENNVGLDNIDLIVVNHTEIDHAGSLTLLLEKIPDTPIYCTKKGAEMIKQHF--HKDWNFKIVKTGDTIDL-GEYKLVFIEAPMLHWPDSMMTYVAGAGVLLSNDAFGQHYATPLFYNDQVDCELYQEAIKYYANILTPFSKMVRSKIEEVKALPVNMIAPSHGVIWRDQIVEKYDEWANNYDEGTILYNTMWG. 260
315 0.000e+00gi|524258646|emb|CDA21349.1| putative uncharacterized protein [Bacteroides sp. CAG:144]  clstr ali  20  11....IYYVGANDRKTHKFEALWPLPYGVSYNSYLIVD-EKVALIDTIEASCTETYLDNIQKILNGRTIDYLVINHMEPDHSASIAAVKRAYPQIEIVGNAKTLDMVKGFYGIT--DNTITMKEGDSL-CLGSKELVFYLIPMVHWPETMVSYCPQEKILFSGDAFGCFGAEGGIVDTQLDCEIYWDEMRYYANIVGKYGAPVQKALSKLSGVPLEMICSTHGPVW-KENIAKVIGIYDKLSRVVIAYGSMYG. 261
316 0.000e+00gi|769995891|ref|WP_045111498.1| anaerobic nitric oxide reductase flavorubredoxin [Moritella viscosa]  clstr ali  19  8.....NISWVGQRDWDFHGTEFKTEKGTSYNSYLIQ-EEKTVLIDTVDHKFCYEFIQQLELEVDLNKIDYIVINHAEEDHAGALAALLNKIPNTPIYCTENAIDSITGH-HHHPEWNFNVVKTGDSLDLGNGKQLVFIETPMLHWPDSMMTYMTGDAVLFSNDAFGQHYCDERLFNDEVDTELMDQCLRYYANILTPFSPLVSAKIKEILGLPVDMIATAHGVVWRDQIIEQYLAWADKYQEDTIFYDSM... 261
317 0.000e+00 GL0013840 [Complete] locus=scaffold25872_3:117:1466:+  ali  17  1MYCTRKITWVGARRLAMFEGVYDVPQGISFNSYLLTD-EKTVLFDTVDSAVRHTFRENLTHALAGRELDYVVVHHMEPDHAAELADLLRDYPRTQVLCSAMAKTMIGQFFGPELAGRITVIKEGETLST-GRHTLHFVAAPMVHWPEVMLTYDATDKLLLSADAFGCFGANGALFADEVNFDRDYEARRYYTNIVGKYGPQVQAVLKKAETLDIQMLLPLHGFVWRGELLGKYDLWYEPEVRGVMIYASVYG. 265
318 0.000e+00JGI.Meta 7074686710 SRS019582_WUGC_scaffold_92451__gene_149031 putative flavoprotein [Human Stool microbiome from visit number 2 of subject  ali  17  8..KNIHYVGVNDRVKQKFEGLWPLPNGVSYNSYLITD-EKTALIDTVDLCYGERFLAKIQAILGDKPIDYLIINHMEPDHSASISLIRQVYPKMKIVGNAKTLSMIEGFYGIC--DYFMEIKDGDVLPL-GKKKLRFYLTPMVHWPETMMTYCENDALLFSGDAFGCFGADGGVTDEQMNTDRYWSEMRYYSNIVGKYGSPVQKALAKLAEVKIETICSTHGPVWQK-NVEKVISIYDKLSRVVIAYGSMYG. 260
319 0.000e+00gi|490474145|ref|WP_004344578.1| MULTISPECIES: flavodoxin [Prevotella]  clstr ali  17  2....IKITDVNDRKKALFEGLWPLPNGVSYNSYLIVD-DKVCLIDTVEVDFFTQLIENIREVIGDRPIDYIVVNHMEPDHSGSLSLMRKFYPDVKVIGNKKSFDMLCGFYG--ERGCEHEVKNGDTVAL-GRHTLQFYMTPMVHWPETMMTLDTTTRAIFTGDAFGCFGANGGLIDSEINCDRFWREMRYYSNIVGKYGTPVQNALKKLAGVQLDYICPTHGPVWH-EHADKVVGMYDQMSRYVICYGTMYG. 258
320 0.000e+00gi|503607158|ref|WP_013841234.1| MBL fold metallo-hydrolase [Desulfotomaculum ruminis]  clstr ali  21  1MLSAVEIYWVGAVDWNFHGPAFSTHQGTTYNAYLIKD-EKTALVDTVYQPFTQDLIKNIEEVSSLSSIDYIVVNHIESDHSGAFPEIMRLAPQAQVYCTQKAAEGLNKLYG--GNWEFNIIKTGDEISL-GGKTLRFIEAPMLHWPDSMFTYCPEASLLLPNDAFGQHIASSSRFDDGVDLQLMDEAAKYYANILYPFSALVARKLNELSGLEIKMIAPSHGVIWRS-HPDKIVEAYSRWSKAVVVYDTMWG. 261
321 0.000e+00 GL0058433 [Complete] locus=scaffold3868_1:19654:20847:+  ali  19  9......VKWVGKTDWEFHGEEYNTINGSSYNSYLIQD-EKTVLIDTAWKPFDEEFVENLKKEIDLNKIDYIIANHGEIDHSGSLPKLMKEIPNTPIYCTANGVKSIKGQY--HEDWNFVTVKTGETLN-IGKHTLTFIEAPMLHWPDTMFTYMDKENILFSNDAFGQHIASEYLYADEVSQCLYNEAIKYYANIVAPFGMMVKNKINEIKNIPINMICPSHGLIWREDIINKYYTWADNYKEDTILYDTMWN. 261
322 0.000e+00gi|557698530|ref|WP_023438763.1| MBL fold hydrolase [Clostridium tetani]  clstr ali  20  8.....KVTWVGKIDWEFHGDEYSTHRGTSYNSYLIKDK-KIVLIDTVWEPFSKEFVENLKKEVDLNKIDYIIMNHNEIDHSGALPLLMKEIPNTPIYCTADGAKILKAHY--HKDWNFVEVKTGDTLD-IGESKLTFVEAKMLHWPDSMFTYMSGENILFSNDAFGQHYASDLMYNDLVDQELYQESMKYYANILTPFNSFVIKKIEEVLNLPLNIIATSHGVIWRDQIIEQYIKWANGYEENTVLYDTMWN. 261
323 0.000e+00gi|736572159|ref|WP_034583800.1| MBL fold hydrolase [Clostridium acetobutylicum]  clstr ali  21  9......VTWVGKIDWEFHGEEYSTNRGTSYNSYLIRD-EKTVLIDTIWQPFAKEFVANLKKEIDLNKIDYIVANHSEIDHSGALPYIMKEIPNTPIYCTKNGAKFLKAH--HHKDWNFVEVKTGDTLE-IGKNKLIFVEARMLHWPDSMFTYLTGENILFSNDAFGQHYASERMYNNKVDAELFQEAIKYYANILTPFSPLVVRKIEEILNLPVDMICPGHGIVWKEQIVNKYMEWAKNYKENTLIYDTMWN. 261
324 0.000e+00gi|652369657|ref|WP_026765678.1| MBL fold metallo-hydrolase [Selenomonas ruminantium]  clstr ali  21  1.MQAVEIYWVGAIDWSFHG--YQTGRGTTYNAYLIID-EKITLIDTVKAAFAPELLARIKSVIDPAKIDYIISSHVEPDHSGAIPFMLEHAPQAQVITSPNGEKGLKGHYG---DLPLQGVKAGSSLS-IGQRTLQFVPTPMLHWPDSMVTYCPEEKILFSNDAFGEHLASSSRFDDEVDFGLMFECQKYYANILMLYGRQAQTALKALSGLDIDMIATGHGVIWRK-HIQEIMARYEKWERAVVVFDSMW.. 257
325 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  23  4MEIAPQIYDVGVTDWDFHG--YKTERGASYNSYLIMD-EKICLIDTVKACYAEELLEKISRVTDPARIDYVVVNHVEPDHAGALPQVLKAAPNAKFVITMQGKNEALRHYGDGFD--FMVVKEGDTIDL-GQRKLTFVPVPMLHWPDNMVTYCPQDGILFSNDAFGQHYANSNRFDDLVNEDLFYEAKKYFANILWPYARLIDGALKKVSALDIKMIAPAHGVIWRSK-IKEIVARYAEWGVGVIAYDTMWG. 258
326 0.000e+00gi|524461949|emb|CDC04280.1| rubredoxin [Clostridium leptum CAG:27]  clstr ali  16  5..NDIKYVGVNDHEIDLFEGQYVVENGMAYNSYVIMD-EKIAVMDTVDARFTHEWLDNIENIIGSCQPDYLVIQHMEPDHSANIANFMNVYQNTKIVSTEKAFAMMRQFFGTDFEGRKIVVGEGDTLSL-GKHNLTFVLAPMVHWPEVMVTYDSADKVLFSADGFGKFGALD------VEEDWACEARRYYIGIVGKYGVQVQNLLKKASGLDIQIICPLHGPVL-TENLGYYLNLYQTWSSYVIAYTSVYG. 252
327 0.000e+00gi|402276404|gb|EJU25514.1| putative nitric oxide reductase [Selenomonas sp. CM52]  clstr ali  21  31.MQAIEIYWVGAIDWSFHG--YETGRGSSYNAYLILD-EKITLIDTVKEPFRDELISRISSVIDPAKIDIIVSNHVEPDHSGSIPAMMKLCPKAEIYTSPNGFKGLTAHYG---DLPYHGVKAGDTLSL-GKRTLTFVPTPMLHWPDSMVTYCPEEKILFSNDAFGQHLAASKLFDDEVDCALMEEAKKYYANILMLYGRQAQTALKALAGIDIEMIATGHGRLWRS-HIPDILAAYQKWSKAVVVFDSMW.. 287
328 0.000e+00gi|500053892|ref|WP_011733809.1| MBL fold hydrolase [Pelobacter propionicus]  clstr ali  19  1MSVPIKISWVGKVDWEFHGEEYSTHRGSSYNSYLVR-EEKTALIETVWAPFAKEFVQNLQKEIDLNIIDYVIVNHGEIDHSGALPELMRLIPDTPIYCTANAVKSLKGQY--HQDWNFKVVKTGDRLSL-GSKELIFIEAPMLHWPDSMFCYLTGDNVLFSTDAFGQHYATEKLFNDLVDQELLQECIKYYSNILTPFSSFVDRKIKEFLNLPLDMICTSHGVIWRDQIVTKYLEWSASYQENTIIYDSMW.. 260
329 0.000e+00gi|554920782|gb|ESL03773.1| metallo-beta-lactamase domain protein [Catonella morbi ATCC 51271]  clstr ali  18  9MKCTRQITDDSDRRIALFENCFPVPDGVAYNSYLLTD-EKTVLFDTVDYAIGRQFIDNLTSLLDNRKLDYLVVNHMEPDHCSLITQIISLYPDLKLIANKKTIGLISQFYNIDMAERTVFVGDGDSFST-GKHNLKFFTAPMVHWPEVMFTYDETDKVLFSADAFGTFGADGRIFNDEFDYEFINEARRYYANIVGKYGAQVQAVFKKLPS-EIAYICPLHGPVWRRD-IPFILEKYQAWSTGVIAYASMYG. 272
330 0.000e+00gi|496674384|ref|WP_009316874.1| flavodoxin [Tannerella sp. 6_1_58FAA_CT1]  clstr ali  19  9..RNIHYVGVNDRTKHLFEGLWPLPLGVSYNSYLIVDKS-VVLIDTVDHCYTDLFFEKIKNILGERPIDYLVVNHMEPDHSASINDLCRVYPDIKIIGNSKTIGMIEGFYGIFDK--FHEVKDGDRLPL-GEKVLTFYMTPMVHWPETMMTYCEDDKILFSGDAFGCFGTDGGIIDYQMNTEKYWDEMRYYSNIVGKYGAPVQKALAKLSGIDIQIICSTHGPIWKEE-IQKVISIYNKLSEGVVIYGSMYG. 261
331 0.000e+00gi|524032514|emb|CCY13516.1| metallo-beta-lactamase domain protein [Eubacterium sp. CAG:146]  clstr ali  18  1MFKVIIYVGVNDHEVDLFEGQYDVPNGMSYNSYVVLD-EKVAVFDTVDAHFKDEWLANLEEAFAGRTPDYLIVQHMEPDHAANIANFAEKYPEAKIVGNAKTFPMMKQFFGTDFADRQIVVKEGETLST-GKHNLTFVMAPMVHWPEVMMTYDTTDKIFFSADAFGKFGALD------VEEEWDCEARRYYIGIVGKYGPMVQKLFAKVGSLEINAICPLHGPVL-TENLGHYLNLYTIWSSYVIAYTSVYG. 253
332 0.000e+00gi|545305618|ref|WP_021584894.1| MBL fold hydrolase [Prevotella pleuritidis]  clstr ali  16  8....VYYVGVNDRKKTLFEGLWPLPSGVSYNSYLI-DDDKICLIDTVEVDFFTQFLENIREVIGDRPIDYIVINHMEPDHSGSLSLMRKYYPDIQVVSNKKAFDMLRGFYGISGGEY--EVKNGDTLEL-GHHTLQFFLTPMVHWPETMMSLDVTDNIIFTGDAFGCFGANGGLIDSEINCDDFWLEMRYYSNIVGKYGTPVQNALKKLAGIPLDYICSTHGPVWH-EHLNKVVALYDQMSRYVICFGTMYG. 258
333 0.000e+00gi|657826268|ref|WP_029542806.1| MBL fold hydrolase [Selenomonas ruminantium]  clstr ali  18  8.....KVTWVGKIDWEFHGHEFTTRKGSSYNSYLIRD-EKTALIDTVWKPFDEEFVANLKREVDLSSIDYIIMNHNEIDHSGALPALMREIPDTPIYCTRKGEEIIRGHY--HADWNFVNVKTGDRLSL-GAAELIFIEAPMLHWPDTMFTYLTGENILFSNDGFGQHYATESLYNDAADQGELWEAVKYYANILNPFSPMVARKLAEIQKLDLQLICPSHGVIW-KDNPAQIVEAYAKWAAATLIYDSMWN. 261
334 0.000e+00gi|524769470|emb|CDE70356.1| putative uncharacterized protein [Clostridium sp. CAG:277]  clstr ali  15  8...SVKYIGVDDTTIDLFESQYVVPEGVSYNSYVILD-EKVAVMDTVDPRGMEQWEKNLLDTLNGRKVDYLVVQHLEPDHSGSIARLVELFPDVTLVGNAKTFAMLPQFFNIPLEGHTLTVKEGDTLSL-GEHTLTFVMAPMVHWPEVMVTYESKEKILFSADGFGKFGALSKT---EGEDDWACEARRYYFNIVGKYGAPVQTLLKKAAGLDIATICPLHGPVL-KDNLGYYLDLYNTWSKGIVAYASIHG. 257
335 0.000e+00gi|494790211|ref|WP_007525619.1| MBL fold hydrolase [Desulfovibrio sp. A2]  clstr ali  21  1MQLTNRVHWVGKIDWEFHGQEYSTHKGSSYNAYLVRDGGRTALIETVWGPYAREFVDNLARVVDLSSIDYVVANHGEPDHSGALPELMRHIPRTPVYCSANGIKSLKGQY--HADWDFRVMRTGDTLSL-GSCELVFVEMPMLHWPDSMMCYLTGENVLFSNDAFGQHYASELMFADLVDECELWEAIKYYANILTPFSPLVTKKIDEVLGLGVDMICPSHGVIWRKDIVRRYQEWAANYAEHTVVYDTMWN. 261
336 0.000e+00 GL0061382 [Lack 3`-end] locus=scaffold34731_1:765:1565:+  ali  15  1MYQNRLVTKDSDRRLALFENIYPLTDGVSYNSYLIRDK-KTAVLDGVDVSIQEIFLEKLKSALDGKPLDYLIVQHMEPDHSGSLKELMRLYPDVTLVLNALTLQMFKNYNPDIEIKNVLLVKEGDTLTL-GDHVLTFVMAPMVHWPEVMVTYDSYTKTLFSADAFGTFGASGNLFADRVSFEFEDEARRYYTNIVGKYGDQVQALLKKAQGIQIENICPLHGPIWRQDLV-YLMNLYDKWSRVLIIYGSIYG. 265
337 0.000e+00gi|740867324|ref|WP_038652575.1| flavodoxin [Mucinivorans hirudinis]  clstr ali  16  6...TEKIYWVNDRRKHLFENIWPLPNGVSYNSYLIKD-EKTALVDTVEMGADSGYIGWIEMLLEGRELDYLIVNHMELDHAGEIGAIVRRYPNVQIIGNSKTFKILEGYYGIT--DNLLEVCDGAELEL-GHHKLKFVFTPWVHWPETMMTYDLTEKVLFSADAFGTFGTDGAIFDDEIDFEVYREEMRYYSNIVGKFSNMVQKALAKLCELEVKYLCPLHGPIWR-NNPSRVIELYDRWSRVVIIYASMYG. 259
338 0.000e+00JGI.Meta 7037928313 SRS014923_WUGC_scaffold_56682__gene_112064 hypothetical protein [Human Stool microbiome from visit number 1 of subject 7  ali  17  1MYCTKKIYWVNDRRLSMFEGVYSVPRGVSYNSFLLLD-DVNVLFDTVDKAVGGTFFQNLEHTLAGRNLDFVVIQHMEPDHSATLMELLLRYPDVKIVCNQKILTMIDQFFNMDLSKKAFVVKEGDTLNT-GHHVLKFIFAPMVHWPEVMVTFDETTRTLFSADAFGTFGANGAIFADEVDFDYMDEARRYYCNIVGKYGPQVQSLLKKVHGLDIKRICPLHGFVWREDYFDKYVKWYTPEETGVMIYASVYG. 265
339 0.000e+00JGI.Meta 7049454674 SRS051031_LANL_scaffold_30555__gene_60841 hypothetical protein [Human Stool microbiome from visit number 2 of subject 76  ali  15  8...SVKYIGVDDTTIDLFESQYVVPKGVSYNSYVILD-DKVALMDTVDKRGMEQWEKNLTAALDGRAVDYLIIQHLEPDHAGSIARLVELYPEVTLVGNAKTFQMLPQFFDLPLEGHTLTVKEGDTLSL-GSHTLTFVMAPMVHWPEVMVTYESSEKILFSADGFGKFGALSL----TENEDWACEARRYYFNIVGKYGIPVQTLLKKAAGLDIATICPLHGPIL-TENLGYYLDLYNTWSKGIIAYASIHG. 256
340 0.000e+00gi|291522879|emb|CBK81172.1| Uncharacterized flavoproteins [Coprococcus catus GD/7]  clstr ali  15  6...DIRYVGVNDHDIDLFEGQYVVENGMAYNSYVIMD-EQIAVMDTVDGNFTDEWLKNISDVIGDRKPSYLIVQHMEPDHSANIANFLDLYKDAKVVATAKAFVMMKQFFGTDYPERQIVVKEGDTLSL-GTHTLTFVLAPMVHWPEVMVTYDSKDKVLFSADAFGKFGALD------VEEDWTCEARRYYFGIVGKYGVQAQALLKKAAGLDIQTICALHGPIL-KENLGYYLDLYNTWSSVVIAYTSVYG. 252
341 0.000e+00JGI.Meta 7043711900 SRS024381_LANL_scaffold_62663__gene_79668 beta-lactamase domain protein [Human Supragingival plaque microbiome from visi  ali  19  14MHCVQKIYWINDRRLERFENMFPIPKGVSYNSSLILD-EKTAIIDTVDASIRAQYLENIKYLLQGRELDYLIINHMEPDHCGNIEDLLMLYPNLKIVGNKKTFAFFEQFYNTSASENYYEIKEGDVLDL-GENKLRFIGAPMVHWPEVTMTYEETKGILFSADAFGTFGTNGNIFKDEVDFEGYYEMRRYYTNIVGKYGMQVQNVFKKLKDITINMIVPLHGPIWRTEDVNYLLDLHNKWSTNVLIYGSMYG. 280
342 0.000e+00JGI.Meta 7009781812 SRS022137_LANL_scaffold_4870__gene_11604 beta-lactamase domain protein [Human Stool microbiome from visit number 1 of su  ali  18  1MSKVINVKWVGKTDWEFHGDEYNTINGSSYNSYLIED-EKVVLIDTAWKPFDEEFVENLKKEIDLNKIDYIIANHGEVDHSGSLPKLMKEIPNTPIYCTANGVKSIKGQY--HEDWNFVTVKTGDTLN-IGKHTLTFIEAPMLHWPDTMFTYMDKENILFSNDAFGQHIASEYLYADEINCVLYSEAIKYYANIVAPFSMMVKNKINEILNIPINMICPSHGLIWRSDIINRYYKWADNYSENTILYDTMWN. 261
343 0.000e+00gi|545660781|ref|WP_021767386.1| MBL fold hydrolase [Leptotrichia sp. oral taxon 215]  clstr ali  18  1MHCVQKIYWINDRRLERFENMFPIPKGVSYNSSLILD-EKTAIIDTVDASIRAQYLENIKYLLQGRELDYLIVNHMEPDHCGNIEDLLMLYPNLKIVGNKKTFAFFEQFYNTSAAENYYEIKEGDVLDL-GENKLRFIGAPMVHWPEVTMTYEETKGILFSADAFGTFGTNGNIFKDEVDFEGYYEMRRYYTNIVGKYGMQVQNVFKKLKDTTINMIVPLHGPIWRTEDINYLLDLYNKWSTVVLIFGSMYG. 267
344 0.000e+00gi|445951747|ref|WP_000029602.1| Anaerobic nitric oxide reductase flavorubredoxin homolog [Escherichia coli]  clstr ali  18  8.....NIHWVGQRDWDFHGTEYKTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGH-HHHPEWNFNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQELFEQCQRYYANILTPFSRLVTPKITEILGLPVDMIATSHGVVWRDQIVELYLKWAADYQEDTIFYDTM... 261
345 0.000e+00gi|490165961|ref|WP_004064608.1| hypothetical protein [Eubacterium plexicaudatum]  clstr ali  16  8...AIKYIGVDDRDIDLFESQYVVPDGVTYNSYLILD-EKTALMDTVDTRGMEEWEQKLKDALNGRNLDFLVISHLEPDHAGSIGRLLELYPDVVIVGNAKTFNMLPQFFDVALDDRSIEVREGDTLSL-GTHTLHFYMAPMVHWPEVMVTYESSEKILFSADGFGKFGAMDA----EDDEGWACEARRYYFNIVGRYGTSVQALLKKAAGLDIAMICPLHGPIL-KEDLGYYIGLYDTWSSVLIAYASIHG. 256
346 0.000e+00gi|653024182|ref|WP_027276047.1| anaerobic nitric oxide reductase flavorubredoxin [Leminorella grimontii]  clstr ali  20  8.....NIHWVGQRDWDFHGTEYKTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRAEIDLEDIDYVVINHAEEDHAGALTELMSYIPNTPIYCTANGIDSINGH-HHHPEWNFNVVKTGDSLDIGNGKKLIFIETPMLHWPDSMMTYITGDAVLFSNDAFGQHYCDERLFNDEVDQELFEQCQRYFANILTPFSRLVAPKVNELLGLPVDMIATSHGVVWRDQIVERYLEWANDYQEDTIFYDTM... 261
347 0.000e+00gi|501094267|ref|WP_012144387.1| anaerobic nitric oxide reductase flavorubredoxin [Shewanella sediminis]  clstr ali  20  8.....NIQWVGQRDWDFHGTEYKTEKGTSYNSYLIQ-EEKTVLIDTVDHKFSHEFVQKLEMEIDLKQIDYIVINHAEEDHAGALAVLLAKIPGTPIYCTENAIDSITGH-HHHPEWNFHIVKTGDSLDIGNGKQLIFIETPMLHWPDSMMTYMTGDAVLFSNDAFGQHYCDERLFNDEVDQELMDQCLRYYANILTPFSPLVTAKIHEVLNLPVDMIATAHGVVWREDIIHKYLEWADEYQEDTIFYDSM... 261
348 0.000e+00gi|654650695|ref|WP_028111708.1| anaerobic nitric oxide reductase flavorubredoxin [Ferrimonas kyonanensis]  clstr ali  20  8.....NIHWVGQRDWDFHGTEFKMPKGTSYNSYLIR-EEKTVLIDTVDHRFSHEFVHNLSQEVDLNSIDFIVINHAEEDHAGALAALLEKIPGTPIYCSENAIDSITGHHHRP-DWNFHTVKTGDSVDIGNGKQLVFIEAPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQAELEECLRYYSNILTPFSALVTAKIKEVLNLPVDMIATSHGIVWRDQIIEKYLKWADDYQEDTLFYDSM... 261
349 0.000e+00gi|973039714|gb|KUK16257.1| Beta-lactamase domain protein [Petrotoga mobilis]  clstr ali  18  1MNGSIKISDVNDRDTKLFEGLWPLERGVSYNSYLILD-EKTALIDTVKEWKVTEFFDKIRHLLNAKPLDYLIINHMEPDHSGAIPELLQEFPNLKIVGNRTTFQFIENLYKI--KDNFYEIKDGESLNL-GKHNLKFYLTPMVHWPETMVTYDETDKILFSGDAFGGFGTDGGIFDDEVKIDFFEDERRYFSNIVGKFSPMVQRALNKLANIDIKIIASTHGPIWRK-NPERIYSLYDKWSKVVIAYGSMYG. 263
350 0.000e+00JGI.Meta 7053847915 SRS017521_Baylor_scaffold_11111__gene_19165 rubredoxin [Human Stool microbiome from visit number 1 of subject 160502038]  ali  18  8.....NIHWVGQRDWDFHGTEYKTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGH-HHHPEWNFNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQELFEQCQRYYANILTPFSRLVTPKITEILGLPVDMIATSHGVVWRDQIVELYLKWAADYQEDTIFYDTM... 261
351 0.000e+00gi|524532954|emb|CDC65906.1| f420H2 oxidase [Ruminococcus sp. CAG:57]  clstr ali  16  9...SVIYIGADDHDIDLFESQYVVPNGVSYNSYVIID-EKIAVMDTADPRVTDVWFDNLEKALGGRKPDYLVVQHMEPDHAGNIKKLAEKYPEMKIVGNAKTFPMMKQFFTIDLDDRSVVVKEGDTLSL-GSHTLQFVMAPMVHWPEVMVTYEQSEKLLFSADGFGKFGALD------VEEDWACEARRYYFNIVGKYGAQVQALLKKAAALDIKMILPLHGPIL-KEDLGYYLGLYNTWSKGVVAYASIHG. 256
352 0.000e+00JGI.Meta 7010940417 SRS042628_WUGC_scaffold_34941__gene_76199 hypothetical protein [Human Stool microbiome from visit number 2 of subject 76  ali  19  5..KDIIYIGVNDHDIDLFEGQYAVPTGMAYNSYVIKD-EKIAVMDTVDAHFGEQWLANLRNALDGRTPDYLVVQHMEPDHSANIAAFAQAYPDATIVASAKAFTMMKNFFGTDYAERRTVVGDGSTLPL-GEHTLTFVTAPMVHWPEVIVTYDNRDKVLFSADGFGKFGA----LDTEEDWA--CEARRYYFGIVGKYGAQVQALLRKASALDIAVICPLHGPVL-TENLGYYLGLYNTWSCGVIAYTSVYG. 252
353 0.000e+00gi|974224591|gb|KUO65346.1| MBL fold metallo-hydrolase [Gracilibacter sp. BRH_c7a]  clstr ali  21  2...TIKITWIGKVDWEFHGEEYSTHKGSTYNAYLVQD-EKNILIDTVWRPFNHEFIAELQQQISLDKIDYIVANHAEPDHSSALPELMKLIPDTPIICTANGVKSLRGLY--HQDWNFKIVKTGDKINIGGRKELIFIEAPMLHWPDSMFTYLTEEAILFSNDAFGQHYATELLYNDLVDQAELYECLKYYANILNPFNRLVDKKIKEVLDLPIRYICPSHGVIWRDQIVQRYQEWANNYQENTILYDTMW.. 261
354 0.000e+00JGI.Meta 7074045746 SRS049389_WUGC_scaffold_8244__gene_8127 hypothetical protein [Human Tongue dorsum microbiome from visit number 1 of subj  ali  20  1MHCVKKITNDNDRRLAMFEGVYSVPKGVSYNSYLLLDKDVTVLFDTVDKAVFEVFFENIEHLLAGRHLDYLVIHHMEPDHSATLSELLLRYPDVQIICSSRAYTMIKQFCCKNQDVNVRIVAENDSLKTA-SHEYKFIMAPMVHWPEVMMSYDLNDKIIFSADAFGAFGANGAIFADEVDFDFMDEARRYYCNIVGKYGTQVQAVLKKMDTLDVKMICPLHGFVWRSDFVDKYRKWYEPEETGVMIYASVYG. 266
355 0.000e+00JGI.Meta 7075614336 C4870329__gene_142231 hypothetical protein [Human Stool microbiome from visit number 1 of subject 158458797]  ali  17  1........GVNDHQIDLFEGQYVVPNGMAYNSYAIMD-EKIAVMDTVDRKFTHEWLDNLAKVFGDRKPDYLIVQHMEPDHSANIVSFMNTYPEATVVSSSKAFTMMKNFFGTDFADRRIVVGEGDTLSL-GKHTLTFVTAPMVHWPEVIVTYDSTDKVLFSADGFGKFGA----LDAEEDWA--CEARRYYFGIVGKYGAQVQALLKKASALDIQTICPLHGPIL-SENLGYYLNLYNTWSSYVIAYTSVYG. 242
356 0.000e+00gi|497951796|ref|WP_010265952.1| flavodoxin [Alistipes timonensis]  clstr ali  17  10....IHYVGVNDRTTTRFEALWSLPIGVSYNAYLVVG-EKIALIDTVEEAFGSRLEANIREAIGERKIDYLVVNHMEPDHSSSITALRRLYPDLEIVGNAKTLQMIDGFYGIAGG--TVEVKEGDTLDLGSRKVLSFHMIPMVHWPETMVTWCAGDKTLFSGDAFGTFGADGGITDSQVEADRYWDEMRYYACIVGKYGGPVQKALQKVRTLPVETICPTHGPVWQRE-IPRVMDIYDKLSRVVVAYASMYG. 261
357 0.000e+00gi|503024641|ref|WP_013259617.1| MBL fold hydrolase [Desulfarculus baarsii]  clstr ali  18  8.....NVRWVGQIDWEFHGEEYTTKRGSTYNSYLVRDG-KTALIDTVWGPFGDQFVENLRREIDLNELDFVVANHAESDHSGALPALMKLIPDKPVYCTANAVKSLKGHY--HADWNFQVVKTGQRLSL-GRMELVFIEAPMLHWPDSMFCYLTEAGVLFSNDAFGQHVAAQRPFNDLVDCELYQEAIKYYANILTPFSKMVAKKIEEVVGLPVNMICPSHGVIWRDDIVNQYAKWAADYQENTVIYDTMWN. 261
358 0.000e+00gi|553308262|ref|WP_023053344.1| anaerobic nitric oxide reductase flavorubredoxin [Megasphaera sp. BV3C16-1]  clstr ali  19  6...TEKVTWVGKIDWEFHGDEYSTDKGSSYNSYLIRDQ-KTVLMDTVWKPFDKEFVENLKAEIDLNDIDYIVMNHSESDHSGALPLLMKEIPHTPIYCTAKGEAIIRGHY--HQDWNFVNVKTGDTLDL-GESRLVFIEATMLHWPDTMFTYMTGENILFSNDGFGQHYASELLFNDKVDQELYREAMKYYANILNLYSPMVTKKIKEILNVPVSMICPSHGVIWRDQIVEAYQQWAAAYQENTIIYDTMWN. 261
359 0.000e+00 GL0074817 [Complete] locus=scaffold1179_1:788:1990:+  ali  21  1.MNTKIITWVGKTDWEFHGDEFTTEHGSSYNSYLIKD-EKTVLIDTVWLPYDREFVSNLKREIDLNKIDYIIMQHGEVDHSGALIELMDEIPNTPIYCTANAVKSIKGQY--HKDWNFNVVKTGDKLN-IGKHTLTFIETPMLHWPDTMFTYMDNEGILFSNDGFGQHLASEFLYADEVEQDKLWEAITYYANILAPFNMMVKNKINEILNLEINMICPSHGLIWRKQILTKYLEWADNYSENTILYDTMWN. 261
360 0.000e+00gi|364560317|gb|EHM38258.1| nitric oxide reductase family protein [Anaeroglobus geminatus F0357]  clstr ali  20  8.....KVTWVGKVDWEFHGKEYSTERGSSYNSYLIRDK-KTVLMDTVWAPYGREFVESLKEEIDLNEIDYIVMNHNESDHSGALPFLMEEIPDTPIYCTKKGEAIIRGHY--HKDWNFVTVNTGDTLDL-GDSKLVFIEAPMLHWPDTMFTYMTGEEILFSNDGFGQHYASEALYNDRVDQELYHEAMKYYANILNLYSPMVTKKIKEILNVPVKMICPSHGVIWRDQIVEKYQQWAANYRENTLIYDTMWN. 261
361 0.000e+00gi|515620825|ref|WP_017053425.1| anaerobic nitric oxide reductase flavorubredoxin [Vibrio genomosp. F6]  clstr ali  20  8.....NIHWVGQRDWDFHGTEYKMTKGTSYNSYLIR-EEKTVLIDTVDHRFSHQFIQNLEMEIDLKSIDYIVMNHAEEDHSGALSALMEKIPNTPIYCTEAAIDSIVGH-HHHPEWNFKTVKTGDSLDIGNGKQLVFVEAPMLHWPDSMMTYITGDAVLFSNDAFGQHYCDEHLFNDEVDQELMDQCLRYYSNILTPFSSLVIAKIKEVLNLPVDMIATSHGIVWRDQIIEKYLEWADNYQEDTIFYDSM... 261
362 0.000e+00gi|517541193|ref|WP_018711401.1| flavodoxin [Bacteroides barnesiae]  clstr ali  16  7....VHYVGVNDRNKALFENLWPLPYGVSYNSYLIADDEMVALVDTVDVCFFEVYLKKIRSIIGDRKIDYLIINHMEPDHSGSIALIKQYYPEIVLVGNKKTFDMVEGYYGVTGERY--VVGEGDFLKL-GHHNLRFYLVPMVHWPETMVTYDETEGILFSGDAFGCFGANGGCIDRNINTDIYWEMRRYYANIVGKFGNPVQKALQKLGGLKINTICPTHGPVW-EEEIPRVVDLYDKMSRVVIAYGTMYG. 258
363 0.000e+00JGI.Meta 7037827936 SRS014923_WUGC_scaffold_9022__gene_11687 rubredoxin [Human Stool microbiome from visit number 1 of subject 763860675] :_  ali  17  1MYCTRKVTWVGARRLAMFEGVFDVPNGISFNSYLLRD-EKTVLFDTADAAVRRTFRENLLHALEGRSLDYVVVHHMEPDHTAELEELVLRFPEVQIYCSAMAKTMMTQFFGPGLQERIHVVKEGDTL-CTGRHTLRFIAAPMVHWPEVLMTYDETDRLLLTADAFGCFGANGRLFADEVDFDRDYEARRYYTNIVGKYGSQVQAVLKKAAELDIAMLLPLHGFVWRKELLHKYDLWYEPEERGVIAYASVYG. 265
364 0.000e+00gi|503590024|ref|WP_013824100.1| MBL fold metallo-hydrolase [Desulfotomaculum kuznetsovii]  clstr ali  19  8....TKIYWVGGIDWDFHG--YLTPRGTTYNAYLIVD-EKIVLVDTVKHYLFDEMLSRIKKVVDPAKIDYLVVNHVEMDHSGSVPKIMDLAPGAKIVTSPQGKKGLERHYKR--NWDFVVVNSGDELN-IGSRTLKFVHTPMVHWPDSMVTYIPEEKLLLPNDAFGQHIASIERFDDELGWDVHEEAAKYYANIVLPYGDQVNKALEVVSQLPIDVIAPSHGVIWRS-FLPRILQVYRRWKKALIVYDTMWG. 258
365 0.000e+00JGI.Meta 7051495149 C3127704__gene_242424 putative flavoprotein [Human Stool microbiome from visit number 1 of subject 160704339]  ali  20  6...TEKVTWVGKVDWEFHGDEYSTHHGSSYNSYLIRDTEKTVLVDTVWKPYDKEFVQNLKQEVELSQIDAIIVNHGEVDHSGALPLLMKEIPDTPIYCTANGVKSLTGQY--HENWNFIPVKTGDTLDL-GTVTLTFIEAPMLHWPDTMFTYMSGENILFSNDGFGQHYATESLYNDMVDSELMAEARKYYANILCPFSMMVARKIREIQNLPLDMICTSHGVIWRNQIVEKYLEWAADYQQVSIVYDTMW.. 261
366 0.000e+00JGI.Meta 7009835817 SRS022137_LANL_scaffold_27419__gene_65609 beta-lactamase domain protein [Human Stool microbiome from visit number 1 of s  ali  21  1.MNTKIITWVGKTDWEFHGDEFTTEHGSSYNSYLIKD-EKTVLIDTVWLPYDREFVSNLKKEIDLNKIDYIIMQHGEVDHSGALIELMDEIPNTPIYCTANAVKSIKGQY--HKDWNFNVVKTGDKLN-IGKHTLTFIETPMLHWPDTMFTYMANEGILFSNDGFGQHLASEFLYADEVEQDKLWEAITYYANILAPFNMMVKNKINEILNLEINMICPSHGLIWRKQILTKYLEWADNYSENTILYDTMWN. 261
367 0.000e+00gi|517150217|ref|WP_018339035.1| flavodoxin [Butyricimonas synergistica]  clstr ali  16  11......IYWVNDRRTHIFENYWPLPKGVAYNSYIIVD-EKVVVIDTIERSKMDDYVENIEKLLNGRKVDYLVVNHMEPDHTGAIKALLCCYPDVKIIGNAKTFPMLKNFYGVHE--NLIEVKEGDSLDL-GRHKLNFYMAPMLHWPETMVTFESTEGILFSGDVFGAFGTDGGIFDDEVDLDYLEEEIRYYSNIVGKYGQPAQTALKKLGGLPIQMICATHGPI-RRSHIAEIVAKYDKWSKVVIVFSSMYG. 261
368 0.000e+00gi|516361656|ref|WP_017751689.1| MBL fold hydrolase [Clostridium tyrobutyricum]  clstr ali  19  8.....KVTWVGKVDWGFHGDEYSTHKGSSYNSYLIRDK-KTVLIDTVWQPYDKEFVSRLKEEIDLKEIDYIIANHNEIDHSGALPELMREIPGTPIYCTKNGAKIIKGHY--HEDWNFVEVKTGDTLD-IGQNKLIFVEAPMLHWPDTMFTYLTGENILFSNDGFGQHFATELLYNDKVDQELYEQAIKYYANILNPFSTFVKKKINEILNLPLSMICPSHGVIWREQIVEQYLKWADSYQEDQIIYDTMWN. 261
369 0.000e+00gi|544742353|ref|WP_021171247.1| MULTISPECIES: anaerobic nitric oxide reductase flavorubredoxin [Sporomusa]  clstr ali  19  8.....NVKWVGKIDWEFHGEEYSTHKGSTYNSYLIRD-EKTVLIDTVWMPFAREFVTKLKEEIKLKEIDYIIANHGEIDHSGALPELMRLIPDTPIYCTANAVKSLKGQY--HQEWNFRVVKTGDRLN-IGSKEIIFVEAPMLHWPDSMMCYLTEDNILFSNDAFGQHYASEYMFNDLVDQDLYKECIKYYANILTPFSRLVDKKIKEVVGLPVSMICPSHGVIWRDQIVNKYAQWAAEYQENTILYDTMW.. 260
370 0.000e+00 GL0106609 [Lack 5`-end] locus=scaffold72171_1:1:1098:+  ali  19  1.............................YNSYVILD-EKTAVLDTADSEVTQQFLENVKRTLNGRDLDYIVVNHMEPDHCANIETLMRLYPGAKVVGNAKTFQMIGQFYDMDLADRTVTVKEGDVLDL-GAHKLQFVFAPMVHWPEVMMAYEQTEKILFSADAFGSFGAVDALFNDEQDFADLAEMRRYFSNIVGKYGPQVQAVLKKAAGLDIAMICPLHGQIWKKDILEKHDKWYEAEEKAVIFYGSMYG. 229
371 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins[COG1773] Rubredoxin  ali  18  8.....NILWVGQRDWDFHGTEYKTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRREIDLADLDYIVINHAEEDHAGALTELMMQIPDTPIYCTANAIDSINGH-HHHPEWNFHVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQELYEQCQRYYANILTPFSRLVTPKITEILGLPVEMIATSHGVVWRDQIVEKYLEWAADYQEDTIFYDTM... 261
372 0.000e+00gi|757185814|ref|WP_042735728.1| flavodoxin [Lachnospiraceae bacterium TWA4]  clstr ali  16  5..NDIKYVGVNDHQVDLFEGQYVVKNGMAYNSYVIMD-EKIVVMDTVDQNFTHEWLDNIQNVLEGRKPDYLVVQHMEPDHAANIANFMSTYPEATVVSSAKAFTMMGQFFGTDYPDRQIVIKEGDTLSL-GKHTLAFVAAPMVHWPEVMVTYDVCDKVLFAADGFGKFGALD------VEEEWADEARRYFIGIVGKYGKQVQNLLKKAATLDIQMICPLHGPVL-KENLGYYINLYDKWSSYVVAYTSVYG. 252
373 0.000e+00gi|972379404|ref|WP_059032819.1| MBL fold metallo-hydrolase [Tepidanaerobacter syntrophicus]  clstr ali  19  8.....NVKWVGKIDWEFHGEDLSTHRGSSYNSYLVQD-EKTVLIDTVWEPFADEFIEQLKKEVDLKKIDYIIANHGEIDHSGALPALMREIPGTPIYCTNNGIKSLKGQY--HEDWNFIPVKTGDRLSL-GKKEIIFIEAPMLHWPDTMFSYLTEDNILFSNDAFGQHYASEHMYNDLVDQELYGEALKYYANILAPFSKLVDKKITEVLNLNIDMICPSHGVIWRKDIVKIYQEWANAYQENTIIYDTMWN. 261
374 0.000e+00gi|655079917|ref|WP_028528032.1| flavodoxin [Ruminococcus gauvreauii]  clstr ali  17  1.MKDITITDSDDRTLDLFESQYHIPNGVSYNSYVILD-EKTAVMDTVDARATQEWLTNLERELAGRDADYLIISHLEPDHAANIQVLAEKYPNMKLVGNAKTFKMMPQFFTLDLTGRTVEVKEGDSLSL-GKHELHFVMAPMVHWPEVMVEYESTEKILFSADGFGKFGALDA------EEDWTCEARRYFINIVGKYGAQVQALLKKAAGLDISMICPLHGPIL-KENLGYYIEKYDIWSEGVVAYASIHG. 255
375 0.000e+00gi|651366482|ref|WP_026478788.1| MBL fold hydrolase [Alkaliphilus transvaalensis]  clstr ali  20  1.MKKLKIYWVGANDWEFHGYELSTHRGTTYNAYLIKD-EKNVLIDTVWEPLTENFLERLKEVIDIKEIDYVVINHAEPDHSGALPVIMEYCPNAIIVASKNGEESIKRHY--HKEWNIKVVKTGDKLN-IGKNDLIFVEAPMLHWPDSMFAYLTGENILFSNDAFGQHFASSGIFNDEVDEEVYQEALKYYANILTPFSKLVTKKIEELKNLPVDMIAPSHGVIWR-ENPMRIVEKYYEWASGVIFYNSMWG. 260
376 0.000e+00gi|930601551|ref|WP_054253875.1| flavodoxin [Clostridiales bacterium SIT11]  clstr ali  18  14......YIGVNDRYTHLFENMWPLPDGVSYNSYILDGGEETCLLDCVKIPSVGEFLDNISSVLNGRKLDYVIVNHMEPDHTSSLPTLLEIYPDIKIIGNKKTTRFLKNFYHIT--DNIIEVKEGEEVQ-IGSTSLTFYMTPMVHWPESMVAYEKSTGILFSQDAFGGFGTDGSIFDDEINFEFYDETIRYYTNIVGKYSVQVIRALDKLAGLDIQMICPDHGPIWRK-NPEVIIDLYAKLSKVLIVYGSMYG. 263
377 0.000e+00gi|302481224|gb|EFL44299.1| metallo-beta-lactamase domain protein [Atopobium vaginae PB189-T1-4]  clstr ali  18  1MYNVRKVWWTGDRRLALFENTYEVPAGMSYNNYVIVD-EKTCLMDGIDAAVEQQFHENLAHVLAGRPLDYMVVDHMEPDHCAAIPALVEKYPAMKIVATAKAFRMMEQFYDFDVDSRKIVVKEGDTL-CLGAHTLQFIMAPMVHWPEVMVSYETTSKILFAADAFGAYGASGGIFADEVEWERDWETRRYYTNIVGKYGPQTNALLKKAGKLEINYICPLHGVIWRKDF-HLILDRYKKWATYTIFYGSVY.. 264
378 0.000e+00gi|652796719|ref|WP_027095303.1| MBL fold hydrolase [[Clostridium] viride]  clstr ali  19  1MKKLINVYWVGKVDWEFHGEEYSTHKGSSYNSYLIQ-EEKNVLIDTVWIPYAEEFVENLSKEIDLNQIDYIIVNHGEIDHSGALPELMKRIPDKPIFCTENAVKSLKGQF--HQAWNFHVVKTGDKLEIGNGKELIFVEMRMLHWPDSMATYLTKDNILFSNDAFGQHYASDKLFNDLVDCDLFNEAIKYYANILTPFSSMLRKKLEEVLNLQIDMIATSHGIIWREQIIERYSQWANDYQENTIVYDTMWN. 262
379 0.000e+00gi|518443630|ref|WP_019613837.1| anaerobic nitric oxide reductase flavorubredoxin [Psychromonas ossibalaenae]  clstr ali  19  8.....NINWVGQRDWDFHGTEYKTEKGTSYNSYLIR-EEKTVLIDTVDHKFSHEFVQNLEMEINLSDIDYIVINHAEEDHAGALSALLNKIPNTPVYCTENAIDSIVGHHHQP-DWNFITVKTGDTLDIGNGKQLIFIETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDERLFNDQVDQELMDQCLRYYANILTPFSPLVTAKIKEVLNLPVDMIATAHGVVWRDQIIEKYLQWADQYQEDTIFYDTM... 261
380 0.000e+00gi|652938699|ref|WP_027192274.1| MBL fold hydrolase [Desulfovibrio putealis]  clstr ali  20  3....KKITDVGKIDWEFHGDEYSTHHGSSYNSYLVRGA-KTALIDTVWAPFAGEFMDNLTREGVLEKIDYVISNHAEPDHSGAMPLLMKARPELPVYCTANGVKTLKGMY--HQDWNFQVVKTGDTLDLGEGLTLTFVEAPMLHWPDTMFSYLSGENILFSNDAFGQHLASETLYNDTVDCELFQEALKYYANILTPFSKLVTKKINDVLNLPLSLICPSHGVIWRKDIVEAYLKWADDYQEAVVVYDTMWN. 262
381 0.000e+00 GL0125035 [Complete] locus=scaffold42567_4:6:1454:-  ali  18  8.....NILWVGQRDWDFHGTEYKTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRREIDLADLDYIVINHAEEDHAGALTELMMQIPDTPIYCTANAIDSINGH-HHHPEWNFHVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQELYEQCQRYYANILTPFSRLVTPKITEILGLPVEMIATSHGVVWRDQIVEKYLEWAADYQEDTIFYDTM... 261
382 0.000e+00 GL0103505 [Complete] locus=scaffold3374_2:4692:5864:-  ali  17  9...SVIYIGADDHDIDLFESQYVVPNGVSYNSYVIID-EKIAVMDTADPRVTDIWFDNLEKALDGRKPDYLVVQHMEPDHAGNIKKLAEKYPEMKIVGNAKTFPMMKQFFTIDLDDRSVVVKEGDTLSL-GSHTLQFVMAPMVHWPEVMVTYEQSEKLLFSADGFGKFGALD------VDEDWACEARRYYFNIVGKYGAQVQALLKKAAALDIKMILPLHGPIL-KEDLGYYLGLYNTWSKGVVAYASIHG. 256
383 0.000e+00gi|524579924|emb|CDD03474.1| putative uncharacterized protein [Ruminococcus sp. CAG:382]  clstr ali  16  1MHQEIKIYWVNDRRKALFESVYPIPRGVSYNSYLVLD-EKTVLLDTVDKEVSDVFLDGVEHLLSGRQLDYVIVNHMEPDHAATLGELVVRHPEVRIVCNAKTADMIKQFFAFDIDSRAHLVKEGDTL-CTGRHIFTFVMAPLVHWPEVMVTYDMTEETLYSADAFGSFGANGNIFADESTPD-MSEYRRYYTNIVGKYGVQVKALLNKAQSLRISMICPLHGLIWRKDIIQKYAKWYEREIKGVIAYSSVYG. 262
384 0.000e+00gi|657656729|ref|WP_029461144.1| MBL fold hydrolase [Desulfovibrio alcoholivorans]  clstr ali  21  9......VTWVGKRDWEFHGEEYSTHRGSTYNAYLVQD-EKTALVETVWAPFAGEFIDQLKTVVDLGRIDYIIANHAESDHSGGLPELMRLIPNVPVFCTANGVKSLRGHY--HQDWNFQVVKTGQRLSL-GSRELLFIEAPMLHWPDTMFCYLTGDEILFSNDAFGHHLASEGMYNDLVDPCLMEECIKYYANILTPFSTLVKRKIEEFAGLPLKMICPSHGTIWRDQIVTKYLEWAGDYQEVVIVYDTMWN. 261
385 0.000e+00gi|912592557|emb|CRZ34303.1| Anaerobic nitric oxide reductase flavorubredoxin [Herbinix hemicellulosilytica]  clstr ali  17  8.....KVTWVGKVDWEFHGHEYSTNKGSSYNSYLVRD-EKTVLIDTVWLPYDNEFVANLKKEIDLKEIDYIIINHSEIDHSGALFELMKEIPDTPIYCTANGAKIIKGHF--HKDWNFVTVKTGDTLN-IGSSTLTFIEAPMLHWPDSMMTYMSGENILFSNDAFGQHYATESLYNDMVDCELYNEAIKYYANILTPFSRFVTKKIEEVLNLPVNMICTSHGVIWKAQIIEKYLEWAGDYQENTLIYDTMWN. 261
386 0.000e+00JGI.Meta 7009007976 C15581535__gene_184338 hypothetical protein [Human Stool microbiome from visit number 1 of subject 823052294]  ali  17  1MFNVRQISDDNDRRLELFENAYPIPDGISYNSYLLVD-DKTVLLDTADAAIDHQFLENVEHVLDGRTLDYVVVNHMEPDHCATLCDIVVRYPDIKIVGNTMTFRMMKQFFDFDVDQHAIVVKEGDTLET-GHHVLSFVTTPMVHWPEVMMTYDSTTGTLFSADAFGTFGAHGNLFTSEMDLDEFWEARRYYTNIVGKYGIQVTNALKKASTLDISMLCPLHGPIWDEDIVEHTASWYKPEVKGVMIYGSIYG. 265
387 0.000e+00 GL0040796 [Complete] locus=scaffold103905_2:439:1620:+  ali  16  6...SVKYIGVDDTDIDLFESQYPVPDGVSYNSYVILD-DKIAVMDTVDERKTDEWFSNLTEVLEDRQPDYLVISHLEPDHSSNIERLAVRYPDMKLVGNAKTFQMLPQFFDMDFSERSIVVKEGEELSL-GTHKLVFYMAPMVHWPEVMVTYEATEKILFSADGFGKFGAIEL----TKDKDWACEARRYYFNIVGKYGGPVQQLLKKAAGLDINMICPLHGPVL-KDNLGYYIGLYDTWSKVLIAYASIHG. 254
388 0.000e+00gi|524572175|emb|CDC98315.1| uncharacterized flavoproteins [Alistipes sp. CAG:268]  clstr ali  17  10....IHYVGVNDRTTTRFEGLWPLPIGVSYNSYLVVG-EQVALIDTVEESFGSRLFENIREVIGDRKIDYLVVNHMEPDHSSSIAALRLRYPDLKIVGNAKTLQMIGGYYGIDAG--TLEVKEGDTLDLGAGKLLTFHLIPMVHWPETMVTWYAAEGVIFSGDAFGTFGADGGITDSEVEVDRYWDEMRYYACIVGKYGAPVQKALQKVGGLEIRTICPTHGPVW-QERIGEVVALYDRMSRAVIAYGSMYG. 261
389 0.000e+00 GL0017726 [Complete] locus=scaffold29014_1:5767:7023:+  ali  17  30....IHYVGVNDRTTTRFEGLWPLPIGVSYNSYLVVG-EQVALIDTVEESFGSRLFENIRGVIGDRKIDYLVVNHMEPDHSSSIAALRLRYPDLKIVGNAKTLQMIGGYYGIDAG--TLEVKEGDTLDLGGGKVLSFHLIPMVHWPETMVTWYAAEGVIFSGDAFGTFGADGGVTDSEVEVERYWDEMRYYACIVGKYGVPVQKALQKVGGLDIRTICPTHGPVW-QERIGEVVALYDRLSRAVIAYGSMYG. 281
390 0.000e+00JGI.Meta 7010895086 SRS042628_WUGC_scaffold_16445__gene_30868 rubredoxin [Human Stool microbiome from visit number 2 of subject 764447348] :  ali  17  1MYCTRKVTWVGARRLALFEGVFGVPDGISFNSYLLAD-EKTVLFDTADSAVRRTFRENLTHALAGRELDYIVVHHMEPDHAAELAELAEDYPKAQILCSAMAKTMVGQFFGPEMAGRITVIKEGETL-CTGRHTLRFVAAPMVHWPEVMMTYDETDRLLLTADAFGCFGANGALFADEVDFDRDYEARRYYTNIVGKYGPQVQAVLKKAAALDIEMLLPLHGFVWREELLGKYDLWYEPEVRGVMIYASVYG. 265
391 0.000e+00gi|524551180|emb|CDC79403.1| metallo-beta-lactamase domain protein [Clostridium sp. CAG:964]  clstr ali  16  9...SIKYIGVDDRETDLFEGQYIIPNGVSYNSYVIFD-EKIAVMDTVDKIATDKWVENLEKALNGKAPDYLVISHMEPDHASNVKLFAEKYPNAKLVGNAKTFAYMPQFFNLNVDDRKVVVKEGDTLEL-GQHTLTFIMAPMVHWPEVMVAYDSKDKVLFSADGFGKFGALDA------DEDWTCEARRYYFNIVGKYGAQVQALLKKTASLDIQTICPLHGPIL-NENLSYYIDKYDIWSKGVMIYGSMHG. 255
392 0.000e+00gi|490459316|ref|WP_004329975.1| flavodoxin [Alistipes putredinis]  clstr ali  17  10....IHYVGVNDRTTTRFESLWSLPYGVSYNSYLVID-EKVALIDTVEVSFGEQFIDNIRAILKDRPIDYLVVDHMEPDHSSSIKTLRLLYPEMQIVGNAKTLQMLDGYYGIHT--LTREVKEGESISL-GQKNLSFYMAPMVHWPEVMVTYCPEHKVLFSADAFGTFGANGGILDSQLSLDHFWDEMRYYACIVGKYGAPVQKALQKLSGLPIETICSTHGPVWQQE-IGRVIGIYDQLSRVVIAYGSMYG. 260
393 0.000e+00gi|836660033|ref|WP_047808053.1| MBL fold metallo-hydrolase [Desulfosporosinus acididurans]  clstr ali  22  4.MKPVQIYWVGGIDWDFHG--YLIPRGTTYNAYLIID-EKITLIDTVKHYLADEMLARISEVVDPSKIDYIVSNHVEMDHSGGLPRLMEAAPQAQIYTSLNGEKGLKAHYK--GNWNYNVMKSGTTLSL-GKRSLTFIHTPMVHWPDNMVCYLQEDKILFSNDAFGQHIATSERFDDQLSADIMEEAAKYYANIVLPYGKQVEKALELVSALEIDTIAPSHGVIWRSK-IKDILSEYRKWSKAVIVYDSMWN. 261
394 0.000e+00gi|1016808018|emb|CVI69630.1| Flavo-diiron protein FprA1 [Eubacteriaceae bacterium CHKCI004]  clstr ali  18  8...DIYYVGVNDHQIDLFEGQYVVPNGMAYNSYVVMD-EKVVVFDTVDAHFKDEWLANVAEVLDGRKPDYLIIQHMEPDHSANIAAFAEAYPEVKIVANAMAFNMVKQFFGTDFADRRLVVKDGETLS-SGKHTFTFVFAPMVHWPEVMVTYDSADKVLFSADGFGKFGALD------VEEEWACEARRYYIGIVGKYGLMVQKLLQKASALDIQVICPLHGPVL-NENLGYYLDLYNTWSSYVIAYTSVYG. 254
395 0.000e+00JGI.Meta 7011070196 C2753977__gene_205978 hypothetical protein [Human Stool microbiome from visit number 2 of subject 764447348]  ali  19  5..NDIEYIGVDDHEIDLFEGQYIVENGMSYNSYLIKD-EKIAVLDTVDAHFTEKWLDNVKHALHSRHPDYLIIQHMEPDHSASISHFMERYKDTKIVATAKAFVMMKQFFGTDFGDKKIVVGEGDTLSL-GKHTLTFVMAPMVHWPEVMVTYDSCDKVLFSADGFGKFGA-----LDIED-DWACEARRYYIGIVGKYGAQVQTLLKKASQLDIEIICPLHGPVL-KEDLSYYLNLYQIWSEGVMIYTSIYG. 252
396 0.000e+00gi|492559972|ref|WP_005886350.1| flavoprotein [Fusobacterium mortiferum]  clstr ali  17  1MYFCTEITWVNDRKTERFENYIPLPYGVTYNSYFI-DDEKTCVIDAVELGSASTFLDKIVECLDGRKLDYIVINHVEPDHSSGLKEVIRTFPTVKIVGNAKTLGMLQAFSPDFPVENFVTIKEGDILEL-GNHKLTFAMIPMVHWPESMVTYDLTDKILFSNDAFGSFGADGGIFDDQVNFEFYQEMRRYYSNIVGKYGPQVLNAIKKLGGLEIKFICPSHGLIWRKD-IAKVVSLYETWAKVVIVYGSMYG. 264
397 0.000e+00gi|496705965|ref|WP_009346395.1| FprA family A-type flavoprotein [Peptoniphilus sp. oral taxon 836]  clstr ali  20  1MFTVRKVVDDSDRRLELFENLFPIPRGIAYNSYLLLD-EKTVLLDAVDWSIARQYIDNVVRVLDGRPLDYLVIHHMEPDHCGTIDEMILRYPNLKIISSEQGFQIMRQIGYHVKEENCIVVEEGDTISF-GRHELFFIEAPMVHWPEVIMSLDTTNGVLFSADAFGSFGADGQIFADEVDFERDWDARRYLTNIVGKYGPFITNVLKKASTVDIKVICPLHGLVWRKD-LGWFINKYATWAEGVICYGSMYG. 265
398 0.000e+00JGI.Meta 7015914447 SRS014979_WUGC_scaffold_24677__gene_51623 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  16  1MECTARITWVNDRRLNLFENIFPIPRGVSYNSYLLLD-EKTVLVDTVDKAISGVFFDNLTAALDGRQLNYIVVNHMEPDHAATLAEVCGRYPGAQVMLTAKGAQMAAQFFGDGLRDRLHAVSDGAEL-VTGRHHLRFFTAPMVHWPEVMVTWDETDRVLFSADAFGAFGASGFLFADEVDFARDWDARRYYTNIVGKYGAPVQALLKKAAALDIAFLCPLHGPVWRQD-IAWFVEKYQRWSTVLVAYASIYG. 265
399 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  16  6...NVHYVGVNDRNKHLFENLWPLPYGVSYNSYLIADEEKVVLVDTVDVCYFELYLKKIRNVIGDRKIDYLIINHMEPDHSGSLALIKQHYPDIVLVGNKKTFDMVEGYYGVTGER--LVVADGDSLN-VGHHKLNFYLIPMVHWPETMVTFDSTEGILFAGDAFGCFGANGGCIDKDINTDIYWEMRRYYSNIVGKFGNPVQKALQKCSGLDIKMICSTHGPVW-EENIAKVVDMYDKMSRVVIAYGTMYG. 258
400 0.000e+00 GL0088354 [Lack 3`-end] locus=scaffold27366_6:1559:2347:+  ali  17  5..NDIKYVGVNDHQIDLFEGQYVVPNGMAYNSYAIMD-EKIAVMDTVDRKFTHEWLDNLAKVFGDRKPDYLIVQHMEPDHSANIVSFMNTYPEATVVSSSKAFTMMKNFFGTDFADRRIVVGEGDTLSL-GKHTLTFVTAPMVHWPEVIVTYDSTDKVLFSADGFGKFGA----LDAEEDWA--CEARRYYFGIVGKYGAQVQALLKKASALDIQTICPLHGPIL-SENLGYYLNLYNTWSSYVIAYTSVYG. 252
401 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  18  5..NDIKYVGVNDHQVDLFEGQYVVPNGMAYNSYVILD-EKIAVMDTVDIHFEKEWLANVETALDGRTPDYLVVQHMEPDHSANIQNFMKKYPNTTIVGNAKTFTMMDQFFALDSGVKRLTVQDKGTLSL-GKHELTFVFAPMVHWPEVMVTYDSTDKVLFSADGFGKFGA----LDVEENWD--DEARRYYIGIVGKYGMQVQKLLKEASALDIQIICPLHGPVL-TENLGHYLEKYDIWSKGVIAYASVYG. 252
402 0.000e+00 GL0109259 [Complete] locus=scaffold21141_6:19087:20277:-  ali  18  7....VHYVGVNDRTKALFENLWPLPYGVSYNSYLIADDDMVALVDTVDVAFFEQYLKKIRSVIGDRKIDYLIINHMEPDHSGAIALIKQYYPEIVLVGNKKTFDMVEGYYGVTGERY--VVGDGDFLKL-GHHNLRFYLIPMVHWPETMVTYDETDKILFSGDAFGCFGANGGCIDRNINTDIYWDEMRYYANIVGKFGNPVQKALQKCSGLDIRTICPTHGPVW-EEKIPQVVEMYDKLSRVVIAYGTMYG. 258
403 0.000e+00gi|553308946|ref|WP_023054007.1| MBL fold hydrolase [Megasphaera sp. BV3C16-1]  clstr ali  17  1MYCVRNITDDNDHRTHLFENIHPIPLGVSYNAYLLIDKS-TVLFDTVDWSVCRQLLENIEHVLNGRNLDYLVINHMEPDHGASIEEIILRYPKVKIISTEKSFMIMRQFGFSIDNQELIQVKEGDVQSF-GKHQVTFVEAPMVHWPEAMITLDLTNGALFSADAFGSFIADGKLFADEVNFDRDWEARRYYTNIVGKYGPHVQHLLGKAATLDIKVICPLHGPVWRQDFLDKYTHWYEPEEKGVIVYASMYG. 267
404 0.000e+00gi|494026582|ref|WP_006968775.1| anaerobic nitric oxide reductase flavorubredoxin [Desulfotignum phosphitoxidans]  clstr ali  20  1MHFKIKIFMVGKIDWHFHGEEYSTHRGSTYNAYLVKDK-KTVLIDTVWSPFSKEFVENLKNEISLDQIDYIIANHAESDHSGALPELMQHIPDTPIYCTANGVKSLKGLY--HQDWNFQVVKTGDKLN-IGSKDLIFIEAPMLHWPDTMFCYLTGDNILFSNDGFGQHLATELMYNDLVDQELFQEAIKYYANILTPFSAQVTRKIKEVLALPVDMICPSHGVIWRQDIVNKYMEWADAYAENTLIYDTMW.. 260
405 0.000e+00gi|498349888|ref|WP_010664044.1| flavodoxin [Marinilabilia salmonicolor]  clstr ali  18  1MYQPVQLSEDNDRRTELFENMWPLPRGVAYNSYLIND-DKVALLDTVEIGQVEKFLKKIHAVIGDKPVDYLVINHMEPDHAGSVNIIRQLYPDMQIVGNKKTLPMVEGFFGITE--NLVEVKEGDELDL-GKHKLQFYLAPMVHWPETMVTYEQTQKILFSADAFGSFGTDGGVFDDEMDFLWHDEMRRYYSNIVGKYGSPVQKALEKLSALDIKMIAATHGPIIRS-HIPEVLKMYDDWSSVVVAFASMYG. 261
406 0.000e+00gi|491753796|ref|WP_005585374.1| flavorubredoxin oxidoreductase [[Clostridium] ultunense]  clstr ali  21  9......VSWVGKIDWEFHGDEYSTHRGSSYNSYLIRD-EKTVLIDTVWEPFAEEFVENLKKEIDLNEIDYIVANHAEIDHSGALPLLLKEIPHVPVYCSSNGAKILKAHF--HEDWNFVEVKTGDELEIGENNKLIFIEARMLHWPDSMFTYMTGESILFSNDAFGQHYASELLYNDLVDQELYQEAIKYYANILTPFSSLVANKIKEVLGLPVDMIATSHGIIWRGQIIEKYLEWAGAYQENTIVYDTMWN. 262
407 0.000e+00gi|504062201|ref|WP_014296195.1| flavodoxin [Marinitoga piezophila]  clstr ali  17  1MDTILKITDVNDRDTHLFENMWPLPKGVTYNSYIIKD-EKNVLIDTVKISKVNAFIEKIYDILDGGKLDYLVINHMEPDHSGAIETIMHEFPEMKIVGNKKTFEFLKALY--DIEDNLYEIKDGDEIDL-GKHKLKFFLTPMVHWPETMMTYEITDKIIFTGDAFGGFGSDGGVFDDEVDIEYYEEIRRYYSNIVGKFGPMVQRAMKKVGGLDIEIVAPTHGPVWRS-NPGRILELYDKWSKVVIVYGTMYG. 261
408 0.000e+00gi|490959240|ref|WP_004821053.1| FprA family A-type flavoprotein [Peptoniphilus indolicus]  clstr ali  19  1MYTVRNVTEDNDHKTSLFENIFPIPEGVSYNSYLLLD-EKTALFDTVDWQFAQEFVKNIEYTLDGRDLDYLVIHHMEPDHAGTIEEICYRYPNVKIVSSEQGFEIMNQLYTKQDEHEQIIVKEGDTLSF-GKHTNAFVEAPMVHWPEVLISLDLTDGVLFSADAFGTFGADGKLFADELDFDRYLDYMRYYSNIVGKYGPFVQDVLKKAADLPIKYICSLHGPVWREDIIGKYDTWYEPEEEGVMIYASMYG. 266
409 0.000e+00 GL0057103 [Complete] locus=scaffold58988_1:11971:13140:+  ali  26  1MMPMEIIYDVGATDWDFHG--YKTERGASYNSYLIVD-EKICLIDTVKACYADELLEKIRRVADPAKIDYVVVNHVEPDHAGALPEVLKAAPNAKFVITMQGKEALRHYGG---GFDFMVVKEGDKISL-GSRELTFVPMPMLHWPDNMVTYCPQDGILFSNDAFGQHYASSKRFDDEVDYVLFYEAKKYFANILWPYARLIGGALKKASALDIKMIAPAHGVIWRSK-IAQILEKYAAWGTGVIAYDTMWG. 258
410 0.000e+00gi|524703815|emb|CDE10492.1| anaerobic nitric oxide reductase flavorubredoxin [Clostridium sp. CAG:354]  clstr ali  18  1MSKVINVKWVGKTDWEFHGDEYNTINGSSYNSYLIED-EKVVLIDTAWKPFDEEFVENLKKEIDLNKIDYIIANHGEVDHSGSLPKLMKEIPNTPIYCTANGIKSIKGQY--HEDWNFVTVKTGDTLN-IGKHTLTFIEAPMLHWPDTMFTYMDKENILFSNDAFGQHIASEHLYADEINCVLYSEAIKYYANIVAPFSMMVKNKINEILNIPINMICPSHGLIWRSDIINRYYKWADNYSENTILYDTMWN. 261
411 0.000e+00gi|655444005|ref|WP_028828401.1| flavodoxin [Proteocatella sphenisci]  clstr ali  18  11...DIYYIGVNDRETHLFENMWPLDNGVTYNSYLIKD-EKNVLLDTVKINKVDLFVEKMEEALGGRRLDYLVIHHMEPDHSSSIRTILSLYPDITLVGNKKTKEMLKEFYGI-ENLKMIEVKEGDEL-CLGKRTLKFFMTPMVHWPESMVSYEMCDKILFSQDAFGGFGANGPIFDDEINWKYYEETRRYYSNIIGKHSKQVQGVLKKLSDLEISMICPVHGPVWRT-NPAKIIEEYRKWSNVVIVYGSMYG. 263
412 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  17  26....IHYVGVNDRTTTRFESLWSLPYGVSYNSYLVID-EKVALIDTVEVSFGEQFIDNIRAILKDRPIDYLVVDHMEPDHSSSIKTLRLLYPEMQIVGNAKTLQMLDGYYGIHT--LTREVKEGESISL-GQKNLSFYMAPMVHWPEVMVTYCPEHKVLFSADAFGTFGANGGILDSQLSLDHFWDEMRYYACIVGKYGAPVQKALQKLSGLPIETICSTHGPVWQQE-IGRVIGIYDQLSRVVIAYGSMYG. 276
413 0.000e+00gi|497080322|ref|WP_009462410.1| FprA family A-type flavoprotein [Lachnospiraceae bacterium 2_1_46FAA]  clstr ali  16  9...TVKYVGVDDKTLDLFESQYVIPNGVSYNSYVILD-EKVTVMDTVDARATEEWLANLEEVLDGREVDYLVVSHMEPDHASNVQNLIEKYPSMQVVGNAKTFNLVSQFFNVDLEGRKVLVKEGDTLN-IGSHTLQFFMAPMVHWPEVMVTYEQSEKILFSADGFGKFGALD------TDEDWACEARRYYFNIVGKYGMQVQNLLKKASALDIEMICPLHGPIL-KENLAYYIDKYNTWSEGVVAYASIHG. 255
414 0.000e+00gi|953120870|gb|KRU42975.1| metallo-beta-lactamase [Clostridium sporogenes]  clstr ali  20  58......VTWVGKIDWEFHGEEYSTYKGSSYNSYLIKD-EKNVLIDTVWQPFAKEFVSNLKKEIDLDKIDYIIVNHSEIDHSGALPELMKEIPKTPIYCTKNGAKLLKAHY--HEDWNFVEVKTGDTLE-IGKNKLTFIEARMLHWPDSMFTYLSGKNMLFSNDAFGQHYASELMYNDKVDGELLQEAIKYYANILTPFSPLVIKKIEEILNLPVDMICPSHGVIWREQIVDKYMEWAKNYRENTIIYDTMWN. 310
415 0.000e+00gi|497047975|ref|WP_009445931.1| FprA family A-type flavoprotein [Lachnospiraceae bacterium oral taxon 082]  clstr ali  19  1MYNYRKVTDDDDHRLSLFENIHPIYHGVSYNAYLLMD-EKTVLVDTADWSVGRQFLDNVEGVLGERNLDFLLINHVEPDHAASIPEILLRWPNVKIITTEKAAMILRQFGFNIRPEQVDEVTEGDS-RCFGKHTIAFVKAPMVHWPEAMVSFDTTNGVLFSADAFGSFRADGKLFADEVEFDKEWDARRYYTNIVGKYGPQVLQVLKKASTLPIKYICPLHGPVWRKDILDKYMHWYEPEEKGIIVYASMYG. 265
416 0.000e+00gi|941500216|gb|KQC10943.1| MBL fold metallo-hydrolase [Candidatus Cloacimonas sp. SDB]  clstr ali  18  1MKKLVKVYWIGKVDWDFHGDEYSTHKGSTYNSYLIQ-EEKNVIIDTVWQPFAKEYVENLKKEIDLQKIDYIIANHAEIDHSGALPELMKEIPDKPIYCTKNALDSIKGHY--HQDWNFKVVKTGDTLDIGNGKKLIFVEAPMLHWPDSMFEYLTEDNILFSNDAFGQHYANEFLFNDLVDQELMVECLKYYANILTPFSKLVIQKIQQFLNLPLDMICTSHGVIWRGQIVEKYLLWADGYQEVTIVYDTMWN. 262
417 0.000e+00 GL0008392 [Complete] locus=scaffold8801_8:675:1829:+  ali  18  6...DIRYIGVNDHDVDLFEGQYTVENGMSYNSYVILD-EKVAVMDTVDAHFGVEWLQNLETELNGRRPDYLVVQHMEPDHSANIAVFMETYPEAQIVSSAKAFVMMQQFFGTDFPERKVVVGEGSTLKL-GRHTLTFVTAPMVHWPEVIVTYDSTDKVLFSADGFGKFGALD------VEEDWADEARRYYIGIVGKYGAQVQALLKKAAALDIAIICPLHGPVL-NENLGYYLDKYNTWSSVVIAYTSVYG. 252
418 0.000e+00 GL0030548 [Complete] locus=scaffold17873_4:440:1624:+  ali  17  10....IHYVGVNDRTTTRFESLWSLPYGVSYNSYLVID-EKVALIDTVEVSFGEQFIDNIRAILKDRPIDYLVVDHMEPDHSSSIKTLRMLYPQMQIVGNAKTLQMLDGYYGIH--NLTREVKEGESISL-GEKTLSFYLAPMVHWPEVMVTYCPEHKVLFSADAFGTFGANGGILDSQLSLDHFWDEMRYYACIVGKYGAPVQKALKKLSGLPIETICSTHGPVWQQE-IGRVIGIYDQLSRVVIAYGSMYG. 260
419 0.000e+00gi|496077149|ref|WP_008801656.1| FprA family A-type flavoprotein [Fusobacterium gonidiaformans]  clstr ali  18  1MHCVREITKDNDRRITMFENIHPLKDGVSYNSYLLLDK-KTVLFDTVDWTIVRQFVENIEYVLDGRTLDYLVINHMEPDHAAAIEEVLLRYPKAKVISTEKGFYLMTQFGFHVDPANQITVKEGDKQNF-GKHEIVFVEAPMVHWPEAMVSFDTTNGVLFSADAFGSFKANGAMFNDEVDFDKDWEARRYYTNIVGKYGPHVQHLLGKAPVDQIKFICPLHGPVWRNDFIDKYVKWYTPEEKAVIVYASMYG. 265
420 0.000e+00gi|918958531|ref|WP_052645623.1| MBL fold metallo-hydrolase [haloalkaliphilic bacterium ACht6-1]  clstr ali  19  1.MNVKIVDWVGKIDWEFHGNELSTQRGSSYNSYLIK-EEKNVLVDTVWKPYAEEFVENLKKEIDLEKIDYIVANHGEIDHSGSLPELMRHIPDTPIYCTENGVRSLKGHY--HQDWNFHTVKTGDTLDVGNGKKLHFIEMKLLHWPDSMACYLTEDNILFSNDAFGQHYASEHLFNDLVDQELYYEAIKYYANILGPFSPLVDKKINEVLNLPIDIIATSHGIIWR-DNPMQIVEKYQSWSKGTVMYDSMW.. 261
421 0.000e+00gi|492553601|ref|WP_005884019.1| FprA family A-type flavoprotein [Fusobacterium mortiferum]  clstr ali  18  1MHNVRKITEDDEHRLHLFENVHPIARGVSYNSYLLLDK-KTVLFDTVDWAIGRQFIENIKHVLKDRKLDYMVINHMEPDHAAMIQEVVMHYPEVRIISSEKAFYFMNQFGFHIDPEKCETVVEGDTKSF-GKHKILFVAAPMVHWPEAMVSFDLTNGVLFSADAFGSFGADGKLFNDEVNFDRDWDARRYYTNIVGKYGPHVQALLKKAGGIDIKMICPLHGPVWRNDF-EYLLDKYNRWSKGVIVYASMYG. 265
422 0.000e+00JGI.Meta 7063819914 SRS049318_LANL_scaffold_106135__gene_141001 flavodoxin/nitric oxide synthase [Human Supragingival plaque microbiome from  ali  15  16MHQARQIIDDSDRRLNLFENIHPVPDGMSYNSYVVLD-EKTVLLDTVDKAISKVFLENLDAVLNGRKLDYIVINHMEPDHTATLAEVFFRHPEATLVGNTKTFSMMKQFFDMPIDGHTLVVKEGDTLNT-GKHTFSFHLASMVHWPEVMVTFDTTYKALFSADAFGTFGANGNIFSDEFNFETEWEARRYYTNIVGKYGVQTQALLKKAAPLDVAYLCPLHGPVWRKEKIAWFIDKYSKWSSVVIFYGSIYG. 282
423 0.000e+00 GL0021125 [Lack 3`-end] locus=scaffold39491_3:2:1093:-  ali  16  10....IRYVGVNDRTTHLFEGLWSLPQGVSYNAYLVIG-EKIALIDTVEEAFGSRLFQHIREEIGDRRIDYLVVNHMEPDHSSSIAALRQLYPDITIVGNAKTLQMIAGYYGICDG--TLEVKEGDTLDL-GGKTLTFQLVPMVHWPETMVTWCAEEQTLFSGDAFGTFGADGGITDSQVDVDRYWEMRRYYACIVGKYGAPVQKALQKVRALPVATICPTHGPVWQR-HIAEVIDLYDRMSKGVVVYASMYG. 260
424 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  19  1MYCVRKVLEDNDRRLAMFEGVYAVPNGVSYNSYLLLD-DKTVLFDTVDPSVSKVFFENVDHVLAGRKLDYLVIHHMEPDHSGTVSEVLLRHPETVIVCNDRIRAMLQQFGGVAPQNAFHLVKEGDTFET-GHHTLTFLSAPMVHWPEVMVSYDLTTRTLFSADAFGTFGANGALFADEVDFDYVDEARRYYCNIVGKYGTQVQALLKKASTVQIDRICPLHGFVWRKNIIDRYVHWYTPEEQGVMIYASVYG. 266
425 0.000e+00gi|939328481|ref|WP_054875214.1| MBL fold metallo-hydrolase [Oxobacter pfennigii]  clstr ali  19  8.....KVTWVGKVDWEFHGDEYSTWKGSSYNSYLIKDV-KNVLIETVWKPFDKEFVSNLQNEIDLKEIDYIIANHAESDHSGALPELMRYIPDTPIYCTANAVKSLKGHYHH--DWNFITVKTGDTLEL-GSTKLIFVEAPMLHWPDSMFCYLTGENILFSNDAFGQHYATESLYNDTVDTELYTEAIKYYANILNPFSPLVIKKINEVLGLPVDMICPSHGVIWKEEIIQAYLKWAASYQENSIVYDTMWG. 261
426 0.000e+00gi|973094362|gb|KUK53867.1| Flavorubredoxin oxidoreductase [Desulfotomaculum sp. 46_296]  clstr ali  20  1MKKSIKVYWVGKVDWEFHGEELTTHLGSTYNSYLIQ-EEKTVLIDTVWKPFAREFIENLAQEIELCKIDYIIANHGEADHSGALPDLMKLIPNTPIYCTANAVKSLKGQY--HQNWNFEMVKTGDKLDIGNGKQLVFVEMPMLHWPDSMATYLTGENILFSNDAFGQHYATDQIFNDQVNCDLFKEAMKYFANILTPFSALLKRKLQEILRLPIDIIATSHGVIWRSDIVEKYALWADNYQENTIVYDTMWN. 262
427 0.000e+00gi|692230704|ref|WP_032111080.1| flavodoxin [bacterium OL-1]  clstr ali  19  1MYNVRVICEDSDRRIQLFENTYPVPNGMSYNNYLIMD-EKTCLLDGVDEAVSRQFEENLAHVLDGRPLDYLVIDHMEPDHCAVIPDLVRRWPNLKLVGTPKAFDLVRQFHGFDPTPHAIKIKEGDTLSL-GRHTLQFVLAPMVHWPEVMVTFDQLTGTLFSADAFGAFGATGGIFADEVDWERDWEARRYYTNIVGKYGLQVTSLLKKASKLDIKEIAPLHAHIWRRDILSRYQKWYEPEDKSVIFYGSIYG. 265
428 0.000e+00JGI.Meta 7012191586 SRS055378_LANL_scaffold_90541__gene_116768 hypothetical protein [Human Supragingival plaque microbiome from visit number  ali  18  7MKCIRQITDDSDRRLSLFENCFPIPDGVAYNSYLLMD-EKTVLFDTVDYAIGRQFIDNITSLLDNRKLDYLIVNHMEPDHCSLITQIITLYPELKLIANKKTLGLIEQFYNVDMTERTIFVGEGDSLST-GKHNLKFFMAPMVHWPEVMFTYDETDKILFSADAFGTFGADGRIFNDEFDYEFVSEARRYYANIVGKYGAQVQAVFKKLPS-EIAFICPLHGPIWRKDILEKYQAWYTPEENGVIAYASMYG. 270
429 0.000e+00 GL0015919 [Complete] locus=scaffold4814_1:418:1611:+  ali  17  1MYKLKEIADVNDRQKALFENMWPLPYGVSYNSYLIVD-EKTVLVDTVDVCYSDIFLKKIEDALAGRELDYLIVNHMEPDHAGSIRLLRHRYPGVQIVGNTKTFGMLAGFHGIKEG--LYEVKEGDSLN-IGSRLLTFYMAPMVHWPEVMVTYDAADKLLFSADAFGTYGADGGVIDTEMNVEHFWEEMRYYANIVGKYGSPVQMALRKLSGLEIQTICSTHGPVWR-ENIAKVVGIYDRLSRVVIVYGSMYG. 261
430 0.000e+00gi|740168195|ref|WP_038011144.1| flavodoxin [Tannerella sp. oral taxon BU063]  clstr ali  18  6..KDIYYVGVNDRQKALFENLWPLPGGVSYNSYLIVD-DKTVLVDTVDICYSDLFFKRVAKLLNGRKLDYLVVDHMEPDHAGSIRLLRQIYPDVKIIGNKQTFGMLAGYHGITDG--LHEVKEGDTLDL-GHHKLSFYMAPMVHWPEVMVTYEETEKVLFSADAFGTFGTDGGVLDTDMDTDRFWSEMRYYANIVGKYGAPVQRALKKLSGLEIHTICSTHGPVWTKQS-GDVIALYDRLSRVTIVYGSMYG. 258
431 0.000e+00JGI.Meta 7012937299 SRS015941_WUGC_scaffold_70741__gene_91646 flavoprotein [Human Tongue dorsum microbiome from visit number 1 of subject 76  ali  17  11MYSYRKITDDDDRRLPLFENLFPLDRGVSYNSYLLLD-EKTVLLDSCDQTVSHQFLENVEFALGGRTLDYLVIHHMEPDHCGSIEDLYNKYPKLSLVSNVKTFQMLEQFFSLTPEDRKVIVKDGEELSF-GKHNFKFIFAPMVHWPEVMFSYDTTDSILFSADAFGVFGCNGNIFADEQDKDFLDDARRYYANIVGKYGQQTQAALKKVSSLSISMICPLHGPIWRED-ISFIVNKYDLWSRYVILYNSVYG. 277
432 0.000e+00gi|769965187|ref|WP_045087678.1| flavodoxin [Defluviitoga tunisiensis]  clstr ali  18  1MNSSVKITDDNDRDTALFENLWPLDKGVSYNSYLILD-EKTALIDTVKESKISEFFDKIRHLLNGRALDYLIINHMEPDHSGSIPELLQEFPGIKIVGNKTTFQFIKDLYKV--EDNFQEIKDGSVLNL-GKHTLKFYLTPMVHWPETMMTYDEKDKILFSGDAFGGFGTDGGIFDDEVRIDFFEDERRYFSNIIGKYTKMVQRALNKLKNIDIDIIAATHGPVWRKD-PKRIIDLYDKWSKGVVIYGSMYG. 263
433 0.000e+00 GL0114974 [Complete] locus=scaffold7201_10:2379:3542:-  ali  22  1.MKAVEIYWVGAIDWSFHG--YETSRGSSYNAYLILD-EKVTLIDTVKEPFKEELLERIASVIDPAKIDYIISNHVEPDHSGSLPFMMAHCPNAKVITSPQGLKGLKARYG---DLPYEGVKAGDTLSL-GKRTLQFVPTPMLHWPDSMVTYCPEEKILFSNDAFGQHLASGSRFDDENDLALYYEAKKYYANILTLYGRQAQTALKALKDLPIEMIATGHGIIWRS-HVKEIHGLYEKWSTGVVVFDTMW.. 257
434 0.000e+00JGI.Meta 7032456493 SRS023914_Baylor_scaffold_33832__gene_90015 beta-lactamase domain-containing protein [Human Stool microbiome from visit  ali  17  18...........DRRNPYFENVYPIGRGASFNSYLYLD-EKTALLDTADASVTEAFFSNVSSGLGGRNLDYLIVQHMEPDHAANIARVMAEYPACTVVCNDKVRKMISNFFGAQEESRFHIVKEGDKLPL-GKRTLSFLFAPMVHWPEVMMTFEEREGVLFSADAFGTFGASGNLFADEVNFEWLAEARRYYTNIVGKYGVQVQAVLKKAANLPIRTICPLHGPVWRKD-LAFILEKYNRWSTALVVYGSVYG. 265
435 0.000e+00gi|495157283|ref|WP_007882086.1| FprA family A-type flavoprotein [Roseburia inulinivorans]  clstr ali  17  1MHSVRKVTDDNDHRLTLFENIHPIPQGVSYNAYLLKD-EQTVLFDTVDWSACRQLLENLDYLLGDRQLDVLLINHMEPDHGASIEEILLRYPKCKVISTEKAFMFMRQFGFDIDEHELIEVSEGDTY-CFGAHTVTFVSAPMVHWPEAMVTLDVTNGVLFSADAFGSFIADGKLFNDEVNFDRDWEARRYYTNIVGKYGPQVQLLLGKAAALDIKIICPLHGPVWHTE-LGYIIDKYQHWSTGVVVYASMYG. 268
436 0.000e+00gi|506423540|ref|WP_015943259.1| MBL fold hydrolase [Desulfitobacterium hafniense]  clstr ali  21  9......ITYVGKIDWEFHGEEYSTQRGSSYNSYLIRD-EKTVLIDTVWEPFGREFIAKLKQEIDLNEIDYIVMNHNEVDHSGALPFLMEEIPNTPIYCTANGKKILQGSY--HQDWNFVEVKTGDRLN-IGSRELIFIEARMLHWPDTMFCYLTGDNILFSNDGFGQHFASEHMYNDLVDTELYAEALKYYANILTPFSKMVTAKIQEIMELPISMICPSHGVIWRDQIVHKYLEWAAEYQEVTILYDTMWN. 261
437 0.000e+00JGI.Meta 7021008858 SRS023604_Baylor_scaffold_13802__gene_28712 hypothetical protein [Human Posterior fornix microbiome from visit number 2  ali  16  1MHCVRKVTEDNDHRLHLFENIHPIPQGVSYNSYLLLD-EQSVLFDTVDWEASRQLFENIDYLLGDRPLDVLVINHMEPDHCAAMEQVLKKYPKVKVYSTEKGFMLMHQFGYSVDEHETVEVTDGDT-ACFGRHTVAFLTAPMVHWPEAMITLDTTDGSLFSADAFGSFIADGKLFNDEVNFDRDWEARRYYTNIVGKYGPHVQSLINKAAPLQVKRICPLHGPVWRSD-IGYILDKYNHWSKAVIVYASMYG. 267
438 0.000e+00JGI.Meta 7058500900 C3980648__gene_351851 hypothetical protein [Human Stool microbiome from visit number 1 of subject 765701615]  ali  18  5..KDIKYIGVNDHDIDLFEGQYAVPAGMAYNSYVIKD-EKIAVMDTVDAHFGEQWLANLRDALDGRAPDYLVVQHMEPDHSANIAAFAKAYPDATIVASAKAFTMMKNFFGTDYAERRTVVGDGDTLPL-GKHTLTFVTAPMVHWPEVIVTYDSCDKVLFSADGFGKFGA----LDTEEDWA--CEARRYYFGIVGKYGAQVQALLRKASALDIAVICPLHGPVL-TENLGYYLGLYNTWSCGVIAYTSVYG. 252
439 0.000e+00gi|50877008|emb|CAG36848.1| probable flavoprotein [Desulfotalea psychrophila LSv54]  clstr ali  19  32MKVKNNIHWVGKIDWEFHGDEYSTHKGSSYNPYLIK-EEKVVLIDTVWGPFAQEFVENLRREIDLDQIDYIVACHAENDHSGALPELMRHIPDVPIYCSKNCAKFLKGLY--HQDWNFQVVKSGDRLSL-GSKELVFIEAPMLHWPDTMFVYLTGDAVLFSNDGFGQHYASAHMFNDLVDQDLFQECLKYYANILTPFSPMVTRKIKEILNLPLEMICTSHGIIWRDQIVEKYLQWADNYQENSILYDTMW.. 289
440 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  17  7...NIYYVGVNDRNKNLFEGLWPLPKGVSYNSYLIVD-EKVCLVDTVEVDFFTQFIENIRDVIGDRPIDYIVVNHMEPDHSGSLALMRKYYPNVTVIGNKKTFGMMAGFYGI-EGGCEHEVKNGDTLSL-GKHELQFVLTPMVHWPETMVTLDTTTHTLFSGDAFGCFGANGGVVDSDINCDSFWMEMRYYSNIVGKYGIPVQNALKKLAGVQIDYICSTHGPVWH-DFAARVIGTYDRLSRYVICYGTMYG. 259
441 0.000e+00gi|524724045|emb|CDE28553.1| rubredoxin [Catenibacterium sp. CAG:290]  clstr ali  18  1MFNVRQISDDNDRRLELFENAYPIPDGISYNSYLLLD-DKTVLLDTADAAIAHQFLENLEHVLDGRTLDYVVVNHMEPDHCATLCDIVVRYPDVKIVGNTMTFRMMKQFFDFDVDSYAIVIKEGDTLET-GHHVLSFVTTPMVHWPEVMMTYDSTTGILFSADAFGTFGAHGNLFTSEMDLDEFWEARRYYTNIVGKYGVQVTNALKKASTLDISMLCPLHGPIWDEDIVEHTASWYKPEVKGVMIYGSIYG. 265
442 0.000e+00gi|873245263|ref|WP_048571536.1| MBL fold hydrolase [Clostridium cylindrosporum]  clstr ali  23  9......VTWVGKMDWEFHGEEYSTHRGSSYNSYLIKD-EKTVLIDTVWQAFTKEFIANLEKEIDLKKIDFIVANHSEIDHSGALPELMRLIPNTPIYCTKTCAKLLKAHY--HQDWNFVEVKTGDTLE-IGKNKLMFIEAKMLHWPDSMFTYLTGENILFSSDAFGQHFASELMYSDKVDSELLYEAMKYYTNILTPFNPLVKKKIEELLGLPINMICPGHGIIWRDEIIKTYLEWSKNYKEVTIIYDTMWN. 261
443 0.000e+00gi|494121019|ref|WP_007060797.1| MBL fold hydrolase [Clostridium carboxidivorans]  clstr ali  20  9......VTWVGKIDWEFHGEEYSTHKGSSYNSYLIKD-EKTVLIDTVWYPFAKEFVANLKKEIDLNKIDYIIMNHSESDHSGALLELMKEIPNTPIYCTKSGVKILKGHY--HKDWNFVEVKTGDSLN-IGKNKLTFVEARMLHWPDSMFTYLSGENILFSNDAFGQHYASELMYNDKVDQELFQEAIKYYANILTPFSKFVVKKIEEVLNLPVNMICTSHGIMWRDQIVNKYMEWAKDYQENTIIYDTMWN. 261
444 0.000e+00gi|738423465|ref|WP_036374940.1| MBL fold metallo-hydrolase [Mitsuokella jalaludinii]  clstr ali  22  1.MKAVEIYWVGAIDWSFHG--YETSRGSSYNAYLILD-EKITLIDTVKEPFKEELLERVASVIDPSKIDYIISNHVEPDHSGALPFMMAHCPNAKVITSPQGLKGLKARYG---DMTYEGVKAGDTLS-IGKRTLQFVPTPMLHWPDSMVTYCPEEKILFSNDAFGQHLASGSRFDDENDLSLYYEAKKYYANILTLYGRQAQAALKALKGLDIEMIATGHGIIWRS-HVQEIHDLYEKWSTGVVVFDTMW.. 257
445 0.000e+00gi|951592467|ref|WP_057904705.1| flavodoxin [Lactobacillus bifermentans]  clstr ali  20  15........DCNDRRLERFENLFPLPDGVSYNSYYI-DDEKTAIVDTVDSSVTLQFLENVKYALNGRDLDFLIVNHMEPDHCANIVELAKLYPNMKLVGNAQTFAFFEQFYSADLTANYYPVKNGDQLSL-GQHELNFVFAPMVHWPEVMFSYESTEKILFSADAFGTFGANGNLFTDETDYENLYECRRYYTNIVGKYGPQVKRALKKASKLDIAMIAPLHGPVWRS-NIDYILDRYMKWATGVVIYASAYG. 266
446 0.000e+00gi|517058418|ref|WP_018247236.1| hypothetical protein [Orenia marismortui]  clstr ali  20  10......IYWVGGIDWDFHG--YLTQRGSTYNAYLIID-EKVILIDTVKHYLYDEMIERISSIIDPSKIDYVISNHVEMDHSGGLPQLMKVAKNAKLITSPKGKAGLEAHYD-SKNWNFEVAKPGTELN-IGQRTLNFVLTPMVHWPDNMVTYLPEEKILFSNDAFGQHYASSERFADQASFDIMEEAKKYYANIVMPYGRQVQGVLEKAKGLEIDIIAPSHGVIWRS-FVTEIMEKYQKWSKALIIYDTMW.. 258
447 0.000e+00gi|496261396|ref|WP_008974781.1| FprA family A-type flavoprotein [Coprococcus sp. HPP0048]  clstr ali  16  1.MKDTKISDSDDKTLDLFESQYVIPNGVSYNSYLILD-EKVTVMDTVDARATDEWLQNLDTALDGKKVDYLVVSHMEPDHAANVATLIEKFPELQVIGNAKTFNMIAQFFDLDLSSRSIIVKEGDTISL-GTHTLQFFMAPMVHWPEVMVTYEQSEKILFSADGFGKFGA----LDTEEDWA--EEARRYYLNIVGKYGMQVQALLKKASALDIQMICPLHGPIL-KENLGYYIEKYNTWSSVLIAYASIHG. 255
448 0.000e+00gi|944180349|ref|WP_055668976.1| MBL fold metallo-hydrolase [Clostridiaceae bacterium mt10]  clstr ali  21  9......VTWVGKTDWEFHGEEYSTHKGSSYNSYLIRD-EKIVLIDTVWKPFAKEFVANLKKEIDLNKIDYIIANHAEVDHSGALPELMKEIPNVPIYCTKNGVKSLKGHY--HEDWNFVEVKTGDILD-IGKNKLVFIEARMLHWPDSMFTYMTGDNILFSNDAFGQHYASEFMYNDLVDQDLYKEAIKYYANILTPFSPLVIKKIEEVVKLPLDMICTSHGIIWRDQIVNKYMEWANKYKENTLVYDTMW.. 260
449 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  18  40.KNGIYYVGVNDRNKHRFEGLWPLPNGVSYNSYVIVD-EKVTLVDTVEVDFFTQFLENIKEVIGEREIDYLVINHMEPDHSGSIALIKKYYPNIKIVGNKKTLGMLEGFYGVTDD--VVEVKNGETLST-GSHELSFVLIPMVHWPETMVTLDAANKVLFSGDAFGCFGANGGVIDEEINCEGFWLEMRYYSNIVGKYGVPVQNALKKLAGVELDFICSTHGPVWH-EHIAKVMDMYDKMSKYVICYGTMYG. 293
450 0.000e+00gi|495173740|ref|WP_007898535.1| flavodoxin [Prevotella stercorea]  clstr ali  17  1.MTNIHPVGVNDRHKTLFEGLWPLPYGVSYNAY-IIDDEKVALVDTVEVDFFSQFIDNVRRVIGDRPIDYIIVNHMEPDHSGSLALIKKYYPDAKIVGNKKTFDMMRGYYNVNTEDEIVEVANGDTLSL-GTHELVFTMIPMVHWPETMVTLDVTEHVLFSGDAFGCFGANGAYVDSEMNCDVYWNEMRYYSNIVGKYGVPVQQALKKLAGVQIDYICPTHGPIWH-EHIARVIGEYDRMSRYVICYGSMYG. 257
451 0.000e+00 GL0146989 [Complete] locus=scaffold41889_2:1664:2848:+  ali  18  6..NNIYYVGVNDRNKALFEGLWPLPNGVSYNSYLIVD-EKVCLVDTVEVDFFVPFIERIREVIGDRQIDYLVINHMEPDHSGSIGLIKKYYPGLKIVGNSKTFDMMKGFYGIADG--THLVKEGDTLSL-GSRELRFAMIPMVHWPETMVTFDTSAGALFSGDAFGCFGANGGLVDSQINCDEFWLEMRYYSNIVGKYGTPVQNALKKLSGLQINYICSTHGPVWH-ENIDRVVKLYDRMSRYVICYGTMYG. 258
452 0.000e+00gi|497927975|ref|WP_010242131.1| FprA family A-type flavoprotein [Peptoniphilus rhinitidis]  clstr ali  22  1MYTVRKVTDDNDHRLELFENIFPIPEGVTYNSYLLKD-EKNVLFDTVDWSIVKDYLENVSEVLDGEDLDYLVIHHLEPDHAAAIDEITLRYPDVKIIASEQGFEFMNQYGFHVSEEQQIIVAEGDTISF-GKHEFVFLEAPMVHWPEVLVSFDTTDGVLFAADAFGTFGTDGKLFADEVDFERDWSARRYLTNIVGKYGPFVQDILRKASTVDIKYICPLHGPVWR-ENLGWFIDKYDKWSEGVIVYASMYG. 265
453 0.000e+00gi|952995277|ref|WP_057953974.1| flavodoxin [bacterium L21-Spi-D4]  clstr ali  18  1.MKHVKLSDDNDRRTNLFENAWPLPNGVAYNSYLIVD-EKVALIDTVEYGHMEDFLLKIEEILGQTPIDYLVVNHMEPDHSGAIKQIVNKYPDIEIVGNKKTFPMLEGFFGIEEGKK--EVAEGDTLKL-GKHELSFYMAPMVHWPETMVTYESTTKTLFSADAFGSFGTDGGVFDDELNLDFHDELRRYYSNIVGKYGNQTQKALAKLSTLEIKQIAATHGPVWR-CHINYIMDKYQKWSKVVIVFGSMYG. 261
454 0.000e+00gi|256739885|gb|EEU53209.1| metallo-beta-lactamase domain protein [Parabacteroides sp. D13]  clstr ali  19  23MYKLKEIADVNDRQKALFENMWPLPYGVSYNSYLIVD-EKTVLIDTVDVCYSDIFLKKVADALDGRSLDYLVVNHMEPDHAGSIRLLRQQYPDVQIVGNNKTFGMLEGYHGIKEGLF--EVKEGDTLNT-GRHELVFYMAPMVHWPEVMVTYDVTDKIVFSADAFGTYGTDGGVIDTEMNVEHYWEEMRYYSNIVGKYGSPVQRALQKLSGLDIQTICSTHGPVWR-EYASKAIDIYDRMSRVVIIYGSMYG. 283
455 0.000e+00gi|56311754|emb|CAI06399.1| Fusion protein of nitric oxide reductase (flavorubredoxin NorV) with its associated reductase (NorW) [Aromatoleum aromati  clstr ali  18  8.....NITWVGKQDWEFHGAEYSTHKGSSYNSYLVR-EEKVALIDTVWSPYAQEFIDNLEKEIDLHKIDYIIANHAEIDHSGALPALLARIPDTPIYCTENGVKSLKGHF--HKDWNFKVVKTGDTLDLGNGKQFVFVEAPMLHWPDSMMTYLAGDAVLFSNDAFGQHYASEQMFNDLVDQEELAECLKYYANILTPFSARVAAKIHEVLKLPLEMICTAHGVIWRDQIVEQYLAWADDYQENTLIYDTMWN. 262
456 0.000e+00gi|655543279|ref|WP_028910427.1| flavodoxin [Prevotella sp. AGR2160]  clstr ali  17  1MMKNIHYVGVNDRNKNLFEGLWPLPNGVSYNSYLI-DDEKVCLIDTVEVDFFMQFLEHLHAVIGDRKIDYLVINHMEPDHSGSISLLKKYYPDVKIIGNKKTFNMLQGFYQISDD--TIDVKEGDTLDL-GKHTLQFFMTPMVHWPETMMTLDTTTNVLFSGDAFGCFGANGGVIDRDINTDEFWLEMRYYSNIVGKYGVPVQNALKKLSKVQVDYLCSTHGPVWHK-YVDKVIGIYDKLSKYVICYGTMYG. 258
457 0.000e+00JGI.Meta 7000618250 SRS022536_LANL_scaffold_125220__gene_274176 flavodoxin [Human Supragingival plaque microbiome from visit number 1 of sub  ali  17  6..KDIYYVGVNDRQKALFENLWPLPGGVSYNSYLIVD-DKTVLVDTVDICYSDLFFKRVAKLLNGRKLDYLVVDHMEPDHAGSIRLLRQIYPDVKIIGNKQTFGMLAGYHGITDG--LHEVKEGDTLDL-GHHKLSFYMAPMVHWPEVMVTYEETEKVLFSADAFGTFGTDGGVLDTDMDTDRFWSEMRYYANIVGKYGGPVQRALKKLSGLDIQTICSTHGPVWTKQS-GDVIALYDRLSRVTIVYGSMYG. 258
458 0.000e+00 GL0144175 unmapped_[Complete]_[mRNA]_locus=scaffold130790_2:203:1417:+  ali  19  1MYCVRNVTEDNDHRLHLFENIHPIPRGVSYNAYLLLDK-KTVLFDTVDWAVCRQFLENVEHVLNGRPLDYLVINHMEPDHGASIEEILIRHPETTVLATEKAI-MLMHQFGFQVDGRTEQVQEGDKRKF-GSHEVLFIEAPMVHWPEAMVTLDLTNGALFSADAFGSFGADGKLFADEVNFERDWDARRYYTNIVGKYGPHVQMLLKKAAGLDIKLLCPLHGPVWR-ENLPWLLDKYDHWSRGVMIYASMYG. 266
459 0.000e+00gi|941495434|gb|KQC06943.1| MBL fold metallo-hydrolase [Candidatus Cloacimonas sp. SDB]  clstr ali  20  1.MKAIEIYWVGGIDWDFHG--YLTQRGSTYNSYLIID-EKITLIDNVKHYLAEEQLKRISEIIDPGKIDFVIQNHIEMDHSGSLPKIMELNPDAKIFASPKGVEGLPKHYK--QKWNFQVVKSGDMLDL-GKRKLHFVQTPMVHWPDNMVTYCPEEKILFSNDAFGQHIASSERFDDEFPFNIMMEAAKYYANIVLPYSSQVQKALEAVSGLDIKTICPSHGLILR-NHISEILKNYQKWSKALIIYDTMWG. 258
460 0.000e+00 [KEGG:K12264] anaerobic nitric oxide reductase flavorubredoxin;|[COG0426] Uncharacterized flavoproteins  ali  19  23MYKLKEIADVNDRQKALFENMWPLPYGVSYNSYLIVD-EKTVLIDTVDVCYSDIFLKKVADALDGRSLDYLVVNHMEPDHAGSIRLLRQQYPDVQIVGNNKTFGMLEGYHGIKEGLF--EVKEGDTLNT-GRHELVFYMAPMVHWPEVMVTYDVTDKIVFSADAFGTYGTDGGVIDTEMNVEHYWEEMRYYSNIVGKYGSPVQRALQKLSGLDIQTICSTHGPVWR-EYASKAIDIYDRMSRVVIIYGSMYG. 283
461 0.000e+00gi|653273788|ref|WP_027471722.1| flavodoxin [Saccharicrinis fermentans]  clstr ali  17  1MYKPVKLTDDNDRRTHLFENIWPIERGVAYNSYVIAD-EKVALIDSVEIGQVEKYLKKIKAIIGDRPIDYLVVNHMEPDHGGSIDIIRKMYPEIQIVGNKKTLPMLEGYFGIS--DNTLEIKEGDCLHL-GKHTLNFYLVPMVHWPETMVTYESKEQILFSADAFGSFGTDGAIFDDEFEFEYYRDEMRYYSNIVGKYGSPVQKALDKLANLDIKMIASTHGPIWRK-YIKEVINYYDKWSKVVVAYASMYG. 261
462 0.000e+00gi|493343150|ref|WP_006299983.1| flavodoxin [Aminomonas paucivorans]  clstr ali  17  1MYKAIPITESNDRETDLFEGLWTLPRGVSYNSYLICD-EKVALVDTVKSSYLTDYLQRLRSVLDCKPVDYLIVNHMEPDHSGSIAVMRQVYPDLKIVGNKKTLEMIRAFY--DIQDNLVEVKDGDVLDL-GTHKLVFALIPMVHWPETMVTYDTTDKVLFTCDAFGGFGAEGGVFDDEVDMDFYESEIRYFSNIVGRYSPFVQKAIARVRTLDLKVICPSHGPVLRSNPW-RVVDLYDRWSEGVVVYGSMYG. 262
463 0.000e+00gi|1015558141|gb|KYZ75898.1| MBL fold metallo-hydrolase [Anaerosporomusa subterraneum]  clstr ali  21  9......VNWVGKIDWEFHGEEYSTHRGSSYNSYLIQD-EKTVLIDTVWIPFAKQFVDNLAKTIDLKKIDYIVANHGEIDHSGALPELMKHIPDTPIYCTANAVKSLTGQY--HQDWNFKVVKTGDKLNL-GSKELIFVEAPMLHWPDSMFCYLTGDNILFPNDAFGQHYASSMMYNDLVDQELYQECIKYYANILTPFSKLVDKKIKEVVGLPVDMICPSHGILWRDQIVEQYAKWANDYQENTIIYDTMWN. 261
464 0.000e+00gi|315621399|gb|EFV01368.1| metallo-beta-lactamase domain protein [Pseudoramibacter alactolyticus ATCC 23263]  clstr ali  19  31MHHIRKVTDDNDRRTERFENIHPIPEGVSYNAYMLLD-EKTVLFDTVDWSCGRQFFDNVEAALNGRPLDYVIVHHVEPDHAATLGELLLHYPNARVIGTAKAKQFLTQF-STDVADRFDAVKNGDSKSF-GRHEIHFVAAPMVHWPEVMVSFDSTNGVLFSADAFGSFKADGKLFADEVNFDRDWEARRYYTNIVGKYGKNVQGLLKKTAALDIRMICPLHGLIWRKNFIDKHDKWYEPESKGVVVYASMYG. 294
465 0.000e+00gi|737674938|ref|WP_035644158.1| FprA family A-type flavoprotein [Lachnospiraceae bacterium FE2018]  clstr