current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 5a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1, from PDB0516

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRLELast
1 -5.020HGC00374 gi|162831834|dbj|BABA01012875.1|1.0 TMP00304;  ali follow..  2..................................................................................................KVEVHYFDELLERIRDIRASEKRVYRKVKEIFALSVDYDSKSQVAQSFFKSVQN-KLEYAATGHTAPELIA-VRRGDVTVAKNYMTHEEISTLNLIVNMHMADWESKLGDFLRF--NGREVLENFGTVKREVAEKLALEQYEQYDTH 178
2 -3.950PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  17TVLFVACNNGKGQQPSEENEDPKAKEILQGIWL----------DDETETPLMRIIGDTIYYSDAQSAPVYFKILKDTLHYQIDKQSEYSFWFHSLADNIIKLHKSEDPNDTLAFSFKSVEIIPTYTEVTKKDSVVMFDGVRYRAYVYINPSQMKVVKTTYSEDGISMICVYEGKKSLYAKDITKQMFVDVIPFLQQAILSDMNFIGIDRKGYHYQALVCIPESPVCNLVNLTISFDGKLNITAAK 271
3 -3.440PB013946 A7ABR4_9PORP/121-442 PB013946; Pfam-B_13946;  ali follow..  10  146....................................................................RMLKKLGQDLRNPKNICPEDFMAAH-------------DNATRKIEAIHEKERAAEQRRWEIERREREQQRQLQRKKDAEDFIANKSKFFGLVITDEEIIVKVLEDEYYNEGKTQGI-----VFGSGYYKKADTLILSARIGEVDLRTLEVVQCHGTEYHERIIDLVNKNANLIRER 319
4 -3.280PB001934 Q6PSL5_CHLRE/821-1150 PB001934; Pfam-B_1934;  ali follow..  12  53.................................................RWSLGRNARLLMVIPMDAETPGGRLLQVMEEAIRHWATVLSVRLDL------------AARGKLGPEACEMERQRFDGVIAMMERNDGPTLVVTDSQAID----VVHPWTLDRSSGRPLVPITTFSIAMAYQQNG------------GRLDPFVEGLEALETLQDGDRVLIS-HNRITSACNDIGMVQIPNKLEAA 228
5 -2.710PB048276 _Gut.Meta.Jp.0112258_ gi|163310311|dbj|BABD01000385.1||2 (- 258:885~0 complete)  ali follow..  5....................................................IKLSETVMVIDVAYLNFVINDLRKYFEPLLGRSLVQVLLVYDKKNELDGVAFKASLGEFSFMAAPSEGFVSRGNAAEVKKLIVVPFNEEYGKEVENVLRECALENAGHKEEAKDIVYF-PAAPAVCRWEMLGYPLMSVLGIRSE................................................. 199
6 -2.590PB011023 A7V2G7_BACUN/1-167 PB011023; Pfam-B_11023;  ali follow..  11  29...................................................FVSCDDDMDIQQSYPFTVETMPVPNKVTKGQTVEIRCELKKTGDANTLYTIRYFQFEG---------------EGTLKMDNGITFLP----NDRYLLENEKFRLYYTAQGDEAHNFIVVVEDN....................................................................... 133
7 -2.460PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  12  7FTMLAAVLLAVAGANAQESAEFRPAELA-GIWQLCHYVSEIPDVPGSNTFKVLSDDGRIVNFTMIPGKDAIITGYGTYQQLTDNSYKESIEKNIHLPMLDHKD.............................................................................................................................................. 112
8 -2.400PB015879 Q5LJ14_BACFN/120-411 PB015879; Pfam-B_15879;  ali follow..  13  6........................DLTAFRAYGPALQETGERAFGYD----IWTKYNTTEPVVEARNPDMKAKIAELGKTDPKAAQELYRSVSYHVDHGNGLDCYKTLGGGTTALMAGDTIVYPYCYATQE---------------ILDNGPLKLVYNP--VVKGDSTIIETRIITLDAGSYCNKTVVSYTNLKETMPL.............................................. 172
9 -2.230HGC00422 gi|163631722|dbj|BABG01004545.1|2.0 TMP00397;  ali follow..  10  143............................................................................................................................................SIEAAVREHFDGMYL----SHDAAKGVIETYGMERVSM---LSNTVQLQDWDGRYSRRNKEWAKTIPNDNPETVRCGYALNSHPAVLD-GFIDLVREEQQRSRTQ 240
10 -2.220PB022506 Q11RP6_CYTH3/1-298 PB022506; Pfam-B_22506;  ali follow..  60..................ADIYTTNDLLEQLDILFEDHILIKAGFWKSITVGFKNTQFSLIPEALFEKDYLKEYLTLNTTLDREPDEEYHFYKQRQTEAVNVFATNQRLTSWFNKTYPLKQVRYVHHTASMIEGIMLQKDKNAAEKSV------FIQVEQYFLT---IIVKQGKKLIFCNSFTFNTSEDFVYFI--------LFVFDQLELNPEKCPVVVFGEITHDS-ESFSKLYKYIRHLT.. 266

FFAS is supported by the NIH grant R01-GM087218-01
1 1 8 0 3 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.