current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400
# Score Template Links and tools%idFirst MQATKIIDGFHLVGAIDWNSRDFHGYTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVIFRGADQCTFAVQKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVKLMWCKACHHSQIMSEISDAGAVIVGSPTHNNGILPYVAGTLQYIKGLRPQNKIGGAFGSFGWSGESTKVLAEWLTGMGFDMPATPVKVKNVPTHADYEQLKTMAQTIARALKAKLAALast
1 -132.0001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model  100  1MQATKIIDGFHLVGAIDWNSRDFHGYTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVIFRGADQCTFAVQKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVKLMWCKACHHSQIMSEISDAGAVIVGSPTHNNGILPYVAGTLQYIKGLRPQNKIGGAFGSFGWSGESTKVLAEWLTGMGFDMPATPVKVKNVPTHADYEQLKTMAQTIARALKAKLAA 402
2 -126.0001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  41  2.QPVAITDGIYWVGAVDWNIRYFHGAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWR--KDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPPTVQWVPRGEDLQRCYELGRKIAARIAD.... 398
3 -117.0002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  31  8VQDQEMIPGVYWVGIVDWMVRIFHGY-HTDEGSSYNSYFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANILGLFSAQMRKALEVAS--TVEIKYILSAHGVSWRG-DAMGLAIAEYDRWSKGQHQKKVTVVLDSMYGTTHRMALALLDGARSTGCETVLLEMTSSDITKVALHTYDSGAVAFASPTLNNTMMPSVAAALNYVRGLTLKGKPAFAFGAFGWSNRAVPDIVAELRDCKADVYDEKITFKFNYTEELLEQAYNAGVDLGKRAIAYCEK 409
4 -114.0002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  32  3AAAKRISDGVYWTGVLDWDLRNYHGY--TLQGTTYNAYLVCDEGVALIDNSYPGTFDELMARVEDAVGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLKHYPLREAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKFYANLITPLSKLVLKKFDEVKELGLRIQMIAPSHGQIWT---DPMKIIEAYTGWATGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSEGVDVRVYCLHEDDRSEIVKDILESGAIALGAPTIYDEPYPSVGDLLMYLRGLRTLTRKALVFGSMGGNGGATGTMKELLAEAGFDVA-CEEEVYYVPTGDELDACFEAGRKLAAEIRR.... 404
5 -112.0004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  33  2..SIVVKNNIHWVGQRDWEVRDFHGTYKTLRGSSYNSYLIREEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGPE----WNFNVVKTGDTLDIGNKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWR--DNPTQIVELYLKWAADYQEDRITIFYDTMSNNTRMMADAIAQGIAETDVAVKIFNVARSDKNEILTNVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRFRNKRASAFGSHGWSGGAVDRLSTRLQDAGFEMS-LSLKAKWRPDQDALKLCREHGREIARQWALAPLP 398
6 -102.0001vme_A mol:protein length:410 Flavoprotein  ali model follow..  25  12TERIFDDPEIYVLRIDDDRIRYFEAVWEIPEGISYNAYLVKNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIHDVEIIASNFGKRLLEGFYGIK--DVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGGGYLLPEILDSNESVVERYLPHVTKYIVTVIGHYKNYILEGAEKLS--SLKIKALLPGHGLIWK--KDPQRLLNHYVSVAKGDPKKKVTVIYDSMYGFVENVMKKAIDSLKEKGFTYKFSDEERPAISEILKDIPDSEALIFGVSTYEAEIHPLMRFTLLEIIDKANYEKPVLVFGVHGWAPSAERTAGELLKETKFRILSFTEIKGSNMDERKIEEAISLLKKELE........ 404
7 -89.2004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  20  9VQVLPIATNTKVLRARSWSRLRFEIEYALERGTTSNSYVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAGDLRAAFPDDNLNILPMRGKETLDLGKHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDNWE--SFKEDQRYYFNCLMAPHAIHVEAALEKIS--DLQVRLYAVGHGPLVR--TSLIALTQAYADWSKAQKLE..................................................................................................................................................... 256
8 -48.9003hly_A mol:protein length:161 Flavodoxin-like domain  ali model follow..  21  2.............................................................................................................................................................................................................................................................SVLIGYLSDYGYSDRLSQAIGRGLVKTGVAVEMVDLRAVDPQELIEAVSSARGIVLGTPPSQPS--EAVATALSTIFAAAHNKQAIGLFDSYGGDDEPIDALLAQFRNLGLHTAFPPIRVKDQPTEAIYQQCEESGTDLGQWLTRADA. 147
9 -47.8003fni_A mol:protein length:159 Putative diflavin flavoprotein A 3  ali model follow..  15  2.........................................................................................................................................................................................................................................................KAETSIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAVDLQELRELVGRCTGLVIGMSPAASA--ASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDPLLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRL. 152
10 -32.1002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  16  5.SSGLVPRGSHMLRLS-----QLDDDLCLLGDVQVPVFLLREASWALVEGGISRDAELVWADLCRWADPSQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAWKEACAWDALPVRAVADGEWLELGPRRLQVIEAH--HSDDHVVFYDVRRRRLFCGDALGEFDEAEGVWRPLVFDDM-----------------EAYLESLERLQRLP-TLLQLIPGHGGLLRGRLAADGAESAYTECLRLCRR---LLWRQSMGESLDELSEELHRAWGGQSVDFLPGELHLGSMRRMLEILSRQA................................................................................................. 311
11 -30.9001fln_A mol:protein length:138 FLAVODOXIN  ali model follow..  21  1..............................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLN----EDILILGCSAMPEVLEESEFEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVETPLIVQNEPD-EAEQDCIEFGKKIAN........ 137
12 -27.5002fax_A mol:protein length:138 FLAVODOXIN  ali model follow..  22  1..............................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELL----NEDILILGCSAMGDEVLEESEEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVETPLIVQNEPD-EAEQDCIEFGKKIAA........ 137
13 -24.5001fla_A mol:protein length:138 FLAVODOXIN  ali model follow..  24  1..............................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNID----ELLNEDILILGCSAMDDEVLEEFEPFIEEIST-KISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVETPLIVQNEPD-EAEQDCIEFGKKIAN........ 137
14 -24.0003kap_A mol:protein length:147 Flavodoxin  ali model follow..  18  1............................................................................................................................................................................................................................................................SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLADG---YDAVLMGCSAWGMELQDDFAPLFDEMENMGLKGKKLAAFASGDMECGAVPAIEEKARGLGAEVICEGLKIEGDASSDP-DAVSAFAEDVLKKL...... 147
15 -23.9004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  15  41AMPQKVYGNTWYVGT-----------------CGISALLVTDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVLSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRT-NIVTLADDGVVSVGPLALTAVASP--HTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARV-----------------AALDCDILVTPHPSASGLWNR------------IGPRAAAPLMDTTACRRYAQGARQRLEKRLAEE.......................................................................................................................... 292
16 -23.7002fz5_A mol:protein length:137 Flavodoxin  ali model follow..  20  2..............................................................................................................................................................................................................................................................VEIVYWSGTGNTEAMANEIEAAVKAAGADVESVRFEDTNVD----DVASKDVILLGCPAMGSEELEDVEPFFTDLAP-KLKGKKVGLFGSYGWGGEWMDAWKQRTEDTGATVIGTAIVNE---MPDNAPECKELGEAAAKA....... 137
17 -23.4004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  15  41AMPLKVYGNTWYVGT-----------------CGISALLVTDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVFSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRT-NIVTLADDGVVSVGPLALTAVASP--HTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARV-----------------AALDCDILVTPHPSASGLWNR------------IGPRAAAPLMDTTACRRYAQGARQRLEKRLAEE.......................................................................................................................... 292
18 -23.1003f6r_A mol:protein length:148 Flavodoxin  ali model follow..  17  2............................................................................................................................................................................................................................................................SKVLIVFGSSTGNTESIAQKLEELIAAGGHEVTLLNAADASAENLADG---YDAVLFGCSAWGMEMQDDFLSLFEEFDRIGLAGRKVAAFASGDQECGAVPAIEERAKELGATIIAEGLKMEGDASNDP-EAVASFAEDVLKQL...... 148
19 -23.0005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  12  14QAPFRLFGNTYYVGMKG-----------------LSSVLVTPQGHVLIDGGLPESAPKIIANIGALFRIEDVKLILNSHGHIDHAGGLAELQRRS-NALVAASPSAALDLASGEVGPDDP-RLARDGGQFNVGPVYLTAHATP--HTPGGLSWTWQSCD-MVYADSINAVSRPGFKFSASSEYPNALADLRHSFETL-----------------EKLPCDVLISAHPEASQLWQRLE---------ASATGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQQ....................................................................................................................... 271
20 -22.9003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  14  9QQPFTIYGNTHYVGT-----------------GGISAVLLSPQGHILVDGTTEKGAQVVAANIRAMFKLSDVKYILSTHSHEDHAGGISAMQKLT-GATVLAGAANVDTLRTGVSPKSDPQRAVADGELVKLGPLAVKAHATP--HTEGGITWTWQSCEQGKCKDV---------VFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEK------LSCDIAIAAHPEVNDMWTRQQR---------AAKEGNSAYVDNGACRAIAAAGRKRLETRLASE.......................................................................................................................... 260
21 -22.4003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  14  38FEPFQLIDNIYYVGT-----------------DGIAVYVIKSQGLILMDTAMPQSTGMIKDNIAKLFKVADIKLILNTHAHLDHTGGFAEIKKET-GAQLVAGERDKPLLEGGYYPGDEKNRAVKEGDRVTLGDTTLTAHATP--HSPGCTSWEMTVKDGKEDREV---------LFFCSGTVALNRLVGQPTYAGIVDDY----RATFAKAKA--MKIDVLLGPHPEVYGMQAKRA---------EMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQTAALE..................................................................................................................... 292
22 -22.4001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  14  21MAPLQIADHTWQIGTED-----------------LTALLVQPDGAVLLDGGMPQMASHLLDNMKARVTPRDLRLILLSHAHADHAGPVAELKRRT-GAKVAANAESAVLLARGGSDDL---RIVMDGEVITVGGIVFTAHFMA--HTPGSTAWTWTDTRNGKPVRI---------AYADSLSAPGYQLQGNPRYPHLIEDY----RRSFATVRA--LPCDVLLTPHPGASNWDY---------------AAGARAGAKALTCKAYADAAEQKFDGQLAKETAGAR..................................................................................................................... 269
23 -22.0004heq_A mol:protein length:146 Flavodoxin  ali model follow..  17  2............................................................................................................................................................................................................................................................PKALIVYGSTTGNTEGVAEAIAKTLNSEGMETTVVNVADVTAPGLAEG---YDVVLLGCSTWGDDEIEDFVPLYEDLDRAGLKDKKVGVFGSYTYFCGAVDVIEKKAEELGATLVASSLKIDGEPDSAEVLDAREVLARV.......... 146
24 -21.9001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  13  8FPPFRIAGNLYYVGTDD-----------------LASYLIVTPRNILINSDLEANVPMIKASIKKLFKFSDTKILLISHAHFDHAAGSELIKQQT-KAKYMVMDEDVSVILSGGKSDF---KVLHDGERVELGGTVLTAHLTP--HTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAEDY------------KHSIKVLES--MRCDIFLGSHAGMFDLKNKYV---------LLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQ.......................................................................................................................... 260
25 -21.8003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  21  21...................................TVYVMCGEKTVMIDA----------NSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQV-YKAKVLVKSGFKKYLTSEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTP--HARHHMSVLV--DDFLFTGDSAGA-----------------------YFNGVVIPTTPMYMESLKRQ--IELKPKVVGFAHG............................................................................................................................................................................... 208
26 -21.5003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  18  6VIEPPIKNNLH--------IYKTFGVFGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNK--GIKTYATAKTNEFLKK--DGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQW-------------------PKTINKLKAKYSKATLIIPGHDEW............................................................................................................................................................................. 203
27 -21.2001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  18  2VKIEKLKDNLYVYTTYN---------TFNGTKYAANAYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKI--GAKTYSTKMTDSILAK--ENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWT-------------------QSVHNIQQKFSGAQYVVAGHDDW............................................................................................................................................................................. 199
28 -20.9001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16  11ISITQLSDKVY--------YVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRK--GVQSYANQMTIDLAKE--KGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAW-------------------PKTLDKVKAKFPSARYVVPGHGNY............................................................................................................................................................................. 209
29 -20.9005aeb_A mol:protein length:272 LRA-12  ali model follow..  11  21YRPFRIAGNLYYIGTYD------------------ACYLITTKQNIIVNTGLAASALQIKNNIKALFKLTDTKILLTTQAHYDHLGAMAEIKKIT-GAKLMADEGDATVMADGGSSDYAFGRLLHDKDTIQLGDTKLVMLHHP--HTKGSCSFLFDTKDEQRSYRIL--ANMPTIVIEKKFSEVSSYPGIAKDY-----------AYTLQAMKN--LSFDIWVASHASQFSMHSKHK---------PGDGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN.......................................................................................................................... 272
30 -20.8001akq_A mol:protein length:147 FLAVODOXIN  ali model follow..  16  1............................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI...... 147
31 -20.8001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16  11ISITQLSDKVY--------YVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKK--GVQSYANQMTIDLAKE--KGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCM-------------------LKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDY............................................................................................................................................................................. 209
32 -20.7001f4p_A mol:protein length:147 FLAVODOXIN  ali model follow..  16  1............................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCWEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI...... 147
33 -20.6002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  15  11ISISQLNKNVWVHTELG---------SFNGEAVPSNGLVLNSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSL-------------------VKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEV............................................................................................................................................................................. 208
34 -20.4002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  14  17ISISQLNKNVWVHTELG---------SFNGEAVPSNGLVLNSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCL-------------------VKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEV............................................................................................................................................................................. 214
35 -20.2001i1o_A mol:protein length:147 FLAVODOXIN  ali model follow..  16  2.............................................................................................................................................................................................................................................................KALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCHEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI...... 147
36 -20.1003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  11  6LTLTHFKGPLY--------------IVEDKEYVQENSVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTL--GAKIVATQMTYDLQKSQYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCI-------------------LKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAPK.......................................................................................................................................................... 233
37 -19.9003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  15  11ISISQLNKNVW--------VHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCL-------------------VKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEV............................................................................................................................................................................. 208
38 -19.8004tyf_A mol:protein length:231 NDM-4  ali model follow..  10  10LVFRQLAPNVW----------QHTSYLDMPGFGAVASIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGLVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAP............................................................................................................................................................................. 214
39 -19.7001j9e_A mol:protein length:147 FLAVODOXIN  ali model follow..  16  2.............................................................................................................................................................................................................................................................KALIVYGSTTGNTEYTAETIARELADAGYEVDCRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI...... 147
40 -19.7003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  10  16LVFRQLAPNVW----------QHTSYLDMPGFGAVASIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAP............................................................................................................................................................................. 220
41 -19.6005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  17  26VRLYQIADGVWHIATQSFDGAVYPS----------NGLIVRGDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRKA--GVATYASPSTRRLAEAEGNEIPTHSGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEW-------------------PTSVERIQKHYPEAEVVIPGHGLP............................................................................................................................................................................. 225
42 -19.6001akr_A mol:protein length:147 FLAVODOXIN  ali model follow..  16  1............................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWADDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI...... 147
43 -19.5001fx1_A mol:protein length:148 FLAVODOXIN  ali model follow..  15  2............................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARQLANAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI...... 148
44 -19.2002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  16  7LEVIKIEDGVY--------HTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLARE--------THYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSW-------------------ADSIKNIVSKKYPIQMVVPGHGKV............................................................................................................................................................................. 203
45 -19.1003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  10  23LVFRQLAPNVW----------QHTSYLDMPGFGAVASIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAP............................................................................................................................................................................. 227
46 -19.1001wsb_A mol:protein length:148 FLAVODOXIN  ali model follow..  16  2............................................................................................................................................................................................................................................................AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI...... 148
47 -19.1004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  10  22LVFRQLAPNVW----------QHTSYLDMPGFGAVASIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHY-------------------AASARAFGAAFPKASMIVMSHSAP............................................................................................................................................................................. 226
48 -19.0004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  11  7LRIEKVKENIF--------LHTSYSRVNGFGLVSSNGLVVIDKGNAFI--VDTPWSDRDTETLVHWIRGYELLGSVSTHWHEDRTAGIKWLNDQ--SISTYATTSTNHLLKENKKEPA---KYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQW-------------------SRSAQNALSRYSEAQIVIPGHGKI............................................................................................................................................................................. 203
49 -18.9004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  10  25LVFRQLAPNVW----------QHTSYLDMPGFGAVASIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAP............................................................................................................................................................................. 229
50 -18.9005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  10  22LVFRQLAPNVW----------QHTSYLDMPGFGAVASIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAP............................................................................................................................................................................. 226
51 -18.8004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  15  7LKIEKLDEGVY--------VHTSFEEVNGWGVVPKHGLVVLNAEAYLIDTFTAKDTEKLVTWFVER--GYKIKGSISSHFHSDSTGGIEWLNSR--SIPTYASELTNELLKKDGKVQA---TNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGL----------------------GNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEV............................................................................................................................................................................. 200
52 -18.7004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  15  8LKIEKLEEGVY----------VHTSFEEVNGWGVVSKVVLVNTDAYLIDTFTATDTEKLVNWFVER--GYKIKGTISSHFHSDSTGGIEWLNSQ--SIPTYASELTNELLKKDGKVQA---KNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFV----------------------KPDGLGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHSEI............................................................................................................................................................................. 201
53 -18.4004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  16  44VRLYQIADGVWHIATQSFDGAVYPS----------NGLIVRGDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEAEGNEIPTHSGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSANVLYGGCA-------------------VLELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLP--GLDLLQHTANVVKAHKNRSVAE..................................................................................................................................................... 266
54 -18.4005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  15  24LEVIKIEDGVY----------LHTSFKNIEGYGLVDSVVLDNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLARE--------THYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSW-------------------ADSIKNIVSKKYPIQMVVPGHGKV............................................................................................................................................................................. 220
55 -18.3002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  18  44VRLYQIADGVWHIATQSFDGAVYPS----------NGLIVRDDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEVEGNEIPTHSGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEW-------------------PTSIERIQQHYPEAQFVIPGHGLP............................................................................................................................................................................. 243
56 -18.3004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  10  49LVFRQLAPNVW----------QHTSYLDMPGFGAVASIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAP............................................................................................................................................................................. 253
57 -18.1002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  17  43VRLYKIGDGVWHIATQKLG-----------TVYSSNGLIVRADELLLIDTWGAKNTVALLAEIEKQIG-LPVTRSISTHFHDDRVGGVDVLRAA--GVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVVRFGPVEVFYPGAAHSGDNLVVYVPAVRVLFGGCA-------------------VHEASRESAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLP--GLELLQHTTNVVKTHKVRPVAE..................................................................................................................................................... 265
58 -18.0004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  13  14LTATKIDSDVF--------------VVTDRDFYSSNVLVAKDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKM--GAETWSSDLTKQLRLEE--VPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMI-------------------------KPKELGYLGDANVKAWPDSARRLKFDAKIVIPGHGEW............................................................................................................................................................................. 228
59 -17.8001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  13  3MSLTQVSGPVY--------------VVEDNYYVQENSVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSI--GAKVVSTRQTRDLMKSDYPDLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCI-----------------------LKEKLGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPLHGPELIDHYEALIKAAPQ.......................................................................................................................................................... 226
60 -17.4002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  11  1..MKALLPGLYLLPV------------PIPYPLKTNLYLLQGGEVALVDT-TRAARGALELHLAELLCFQDVKTILLTHHHPDHYGLSGFFEGL--GARVFLHEEEFARGHRFWREPE-NPLPLRDGEALEVAGKRLRVLWTP--HADGHAAFYLEEEGVLLAGD-------------------ALLEKVSPNVGLWAYTRENPLKDFLRSLDRLDLGARVAYAGHFGPIADRQRAEELKAHH--------QARLEALLALL--DGPKTAWELSLHLFPQELDPAGRRFAFAETLAHLEYLREEGAV............................................................................................... 305
61 -16.1004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  12  8.RVERLSNRVVRVLGCNPGPMTLQGT---------NTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTP--HTDDHMALLLEEENAIFSGDCILGEGTT------------VFEDLYDYMNS------------LKEL--LKIKADIIYPGHGPV----HNAEAKIQQYIS--RNIREQQILTLFRENFEKSFTVMELVK--IIYKNTPENLHEMAKHNLLLHLKKLEKEGKIF.............................................................................................. 276
62 -15.7005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  14  23.DTFEVAPGVRWLRM------------PLPFSLDHNLWLLRDAGWTIVDC-SEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGDNVRLWMTLGEYMFGCLMAAGNGSNYRRLREGDAVKIGARTWRVVTGY--HSPEHCALHSEADGVLISGDMVLPRISTNSVFDLEPE------------ANPLALY----LESLGRYETMAPDT-LVLPSHGKPFRGRTRIAQLRAHH--------DARLEEVRVACAEKPMSAAGIVPIMFRRRELDIHQMTFALGEALAHLNLLWLAGEL............................................................................................... 345
63 -15.6002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  13  2MKSLHRPDLYSWSTFNP------------ARNIDFNGFAWIPEGNILIDP--VALSNHDWKHLESL---GGVVWIVLTNS--DHVRSAKEIADQT-YTKIAGPVAEKENFPIYCD------RWLSDGDELVPG---LKVMELQGSKTPGEL-ALLLEETTLITGDLVRAYRAGGLEILPDEKLMNK----------------QKVVASVRRLAALE-KVEAVLVGDG............................................................................................................................................................................... 182
64 -15.3001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  16  27................................HFSTVVYLEKDRRIIIDPGNLSSMDELEEKFSELISPDDITDVLFTHVHLDHIFNSV----LFENATFYVHEVYKTKNYLSFGISSWKNVVLLKGEE-SLFDEKVKVFHTP--HAREHLSFLLDTENVLITGDIT--------------------PNRLSYYDIIKGYGSVQVKNFLDRVGRIDL---LVFPHDAPLKPEVKK....................................................................................................................................................................... 215
65 -15.2004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  20  66................................GGAEAALEEARGPILVDTGGPWAREALLGALAGQVAPGDVTLVVGTHGHSDHIGNLG----LFPGAALLVSHD------FCLPGGRYLPHGLGEGQPLRLGP-GLEVWATP--HGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV----------------------ADVVVPGHGPPFRVLRE....................................................................................................................................................................... 240
66 -14.9002ark_A mol:protein length:188 Flavodoxin  ali model follow..  22  6.............................................................................................................................................................................................................................................................KVLVIYDTRTGNTKKMAELVAEGARSEGTEVRLKHVDEATKEDVL----WADGLAVGSPTNMGLVSWKMKRFFDDVLG-EIDGKIACAFSSSG-GGNEVACMSILTMLMNFGFLVFGVVAGEPRSEEEKEACRRLGRRLAEWVAIFVDG 171
67 -13.8003d7n_A mol:protein length:193 Flavodoxin, WrbA-like protein  ali model follow..  15  2.......................................................................................................................................................................................................................................................TTNSSSNTVVVYHSGYGHTHRMAEAVAEGAEAT---LHAIDAEGNLSEDGWAALDAADAIIFGTPTYMGGPSWQFKKFADASSKPKWQDKVFGGFTNSA-NGDKLNTLQYLVSYIAPMAQSDADAAPEEMSVGDLETARLYGARVANVARQHKST 190
68 -13.3004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  14  15.............................PVSCTF-TYLLGDRESVLIDPV-LETAPRDAQLIKEL----RLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQAD----------LHIEDGDSIRFGRFALETRASP--HTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQ---------CAKTLYHSVHEKIFTLPGDCL------------IYPAHDYHGFTVSTVEE--RTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMR............................................................................................................................ 230
69 -13.0001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  17  34...............................GEATSGYLFEDGFRLLVD-----CGSGVLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKT--VHPVTCFAMRITAGNVVYSADS----SYIPEFIPFTKDADLFICEC-NMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADL...................................................................................................................................................................... 239
70 -12.9002dkf_A mol:protein length:431 metallo-beta-lactamase superfamily protein  ali model follow..  15  4.....................VPFGAAREVTGSAH--LLLAGGRRVLLDCGMFQGKEEARNHAPFGFDPKEVDAVLLTHAHLDHVGRLPKLFREGYRGPVYATRATVLLMEPFFGPEDVELRPLEYGEWLRLGALSLAFGQAGHLPGSAFVVAQGEGRTLVYSGD-LGNREKDVLPDPSLPPLADLVLAEGTYGDRPHRPYRETVREFLEILEKT----KVLIPTFA-VERAQEILYVLYTHGHRLPRAPIDSPMAGRVLSLYPRLVRYFSEEVQAHFLQGKNPGLEVVEHTEASKALNRAPGPMVVLAGSGMLAGG------RILHHLKHGLSDPRNALVFVGYQPQGGLGAEIIARPPAVR--ILGEEVPLRASVHTLGGFSGHAGQDELLDWLQG.... 392
71 -12.8001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  17  3.........................VEVLPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARK--HGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALT----------HKITHLSTLQVGSLNVKCLATP--HTSGHICYFVSEPPAVFTGDTLGTADEMCKALLERLPPDTRVYCGHEYFARHVEPGNAAIREKLAWAKEKYSIGEPTVPS................................................................................................................................................................................. 213
72 -12.8004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  17  11................................SSTYTYLIGDEATVLIDPV-LEQVDRDLQMVAEL----TLTHVFDTHVHADHITASGALRERTQATVVGSVNGASCA------------VQVRHGDEVRVGQLVFQVLATP--HTDDSI-SYLLGDRV-FTGDALLVRGNGRTDFQN---------NASQLYDSLTRVLFTLPDETL------------VYPGHDYKGRTVTSIAEEKRHNPRVAGKSREEFIHIMENLNLPRPKLIDAAVPANRA............................................................................................................................ 222
73 -12.8001zwk_A mol:protein length:207 Trp repressor binding protein WrbA  ali model follow..  15  2.......................................................................................................................................................................................................................................................ASLSSPYILVLYYSRHGATAEMARQIARGVEQGGFEARVRTVPAVSTECEAVDLKNCAGLALGSPTRFGNMASPLKYFLDGTSSLSLVGKPAAVFTSTA-GGQETTQLSMLLPLLHHGMLVLGIPYSEPLDEHELTLCRALGKRLAETAGK.... 198
74 -12.7002a5l_A mol:protein length:200 Trp repressor binding protein WrbA  ali model follow..  16  4..........................................................................................................................................................................................................................................................SSPYILVLYYSRHGATAEMARQIARGVEQGGFEARVRTVPAVSTECEAVDLKNCAGLALGSPTRFGNMASPLKYFLDGTSSLSLVGKPAAVFTSTA-GGQETTQLSMLLPLLHHGMLVLGIPYSEPLDEHELTLCRALGKRLAETAGK.... 197
75 -12.5002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  17  14...................................NAYLVTGEGPVLIDPGDEP------EKLLALFQTTGLIAILLTHAHFDHVGAVAPLVEAL-DLPVYLHPLDLPLYEGADLAARAPVRPLEEGMRL----FGFQVLHLP--HSPGHVAFYDPEGAQVFSGDL---------LFRGSVGR-----------YDLPGADPKALFASLKRLLSLPPETRVH-PGHGP.............................................................................................................................................................................. 186

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 0 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. VISSA: a program to visualize structural features from structure sequence alignment. Bioinformatics. 2006 Apr 1;22(7):887-8. Epub 2006 Jan 24.