current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst AYPMPNPFPPFRIAGNLYYVGTDDLASYLIVTPRGNILINSDLEANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYANDSSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQETGLast
1 -109.0001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model  100  1AYPMPNPFPPFRIAGNLYYVGTDDLASYLIVTPRGNILINSDLEANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYANDSSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQETG 263
2 -102.0005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  29  7CATWNADQAPFRLFGNTYYVGMKGLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGEVGPDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVPGFKFSASSEYPNALADLRHSFETLEKLPCDVLISAHPEASQLWQRLEASATGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQ. 270
3 -101.0003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  28  3.RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSY-RFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEKR. 262
4 -100.0005aeb_A mol:protein length:272 LRA-12  ali model follow..  35  14NADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGH-GSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN... 272
5 -97.4003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  35  31MKKWTAPFEPFQLIDNIYYVGTDGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKNE--DLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVA-LNRLVGQPTYAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGMQAKRAEMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQTAA 290
6 -96.5004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  24  34DAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAIDVYRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIG---PRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAA 295
7 -95.2004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  23  34DAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAIDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIG---PRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAT 295
8 -92.3001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  29  14DASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHFGD--GITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAP-GYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAG------ARAGAKALTCKAYADAAEQKFDGQLAKETAG 267
9 -50.1002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  18  8...................LGPLQENAYLVETGEGPVLIDPG--DEPEKLLALFQTTGLI---PLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEGADLAARAWG----AIPKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPG--------ADPKALFASLKRLLSLPPETVHPGHGPGTTLGLEAR------TNPFLTGLEWEA................... 207
10 -49.5002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  13  21.........PGQLDDDLCLLGDVQVPVFLLRLGESWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLNVQVLASERTCQAWKSESAVRVVERLNRQLL-WDALPVRAVADGEWLELGPHRLQVIEAHGHSDDHVVFYDVRRR------RLFCGDLGEFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLQLIPGHGGAADGAESAYTECLRLCRRLLWRQSMGESLDELSEELHRAWGGQSVD 289
11 -48.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  13  20........................ATVYVMCGEKLTVMIDAGVSNSIADFSF--------LDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVD--------DFLFTGDSAGAYFNGVVIPTTPPVDYKMYMESLKRQIELKPKVVGFAHGGLVSHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS. 260
12 -45.7002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  20  7......PVTAFS--QNCSLIWCEQTRLAALVDPGG----------DAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGL--DECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPR--------GDHTQLIDAIRKLLPLGDDVFIPGHGPLSTLGYERL------HNPFLQD........................ 210
13 -42.3001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  17  29........................STVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFEN---ATFYVHEVYKTKNYL---SFGTIVGRIYSKVISSWKNVVLLKGEESLFDE-KVKVFHTPWHAREHLSFLLDTENAG---RVLITGDITPNRLSYYDIIK--GYGSVQVKNFLDRVGRI--DLLVFPHDAPLKPEVKK...................................... 215
14 -40.0002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  16  3...........ALLPGLYLLPLKTVNLYLLQGAGEVALVDTALRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEG-LGARVFLHEEEFARGHGALQGIRETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALL----EKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQRA-------------EELKAHHQARLEALLALLDGPKTA 268
15 -37.0002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  17  23.......................DFNGFAWIRPEGNILIDP--VALSNHDWKHLESLG----GVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENF-------------------PIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLE-ETTLITGDLVRAYRAGGLEILP----DEKLMNKQKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKE.................................. 195
16 -36.8003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  17  35........................VYSILIEHAEGRFLIDTGYDYDHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFP---HAKKICHRSEVPQACNPQPFELEGTTRANSTFEGIDGDVDLARG---------VKLISTPGHSIGHYSLLVEFPRRKPI--LFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDELMYSH................................................ 252
17 -36.8003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  18  39........................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKECILP--------HLNYKIIEGDYEVVPG--VQLLYTPGHSPGHQSLFIETEQSG---SVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGH................................................ 239
18 -36.8002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  18  37........................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKECILP--------HLNYKIIEGDYEVVPG--VQLLYTPGHSPGHQSLFIKTEQSG---SVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGH................................................ 237
19 -36.6004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  17  68........................AEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPG---AALLVSHDFCLPGGRYLPHG-------------------LGEGQPLRLGP-GLEVWATPGHGGQRDVSV--VVAGTALGTVVVAGDV-FERDGDEDSWQALSEDPAAQERSRKRVLVV-ADVVVPGHGPPFRVLREASQ.................................... 243
20 -36.6002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  14  43........................VSAYLIQCTDATVLYDTGCHPECCNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDEFATAVRYFATGDHSSPYIVKDIEARNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVRLEKQP---GFLLVSDACYTATNPPARRAGVLHDTIGYDRTVSHIRQYAESTVLFGH................................................ 259
21 -35.9004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  17  16.....................VSCTFTYLLGDRESAVLIDPVL-ETAPRDAQLIKELGLR---LLYAVNTHCHADHITGSGLLRSLLPGCQSVISR----------------------LSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHE-------KIFTLPGDCLIPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPA 227
22 -35.2001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  18  14..........................AYILHDEDTVGVVDPS---EAEPIIDSLKRSGRN---LTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPG--------------------IDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKL----------FEGTPKQMLASLQKITSLPDDTSI-GHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKA. 216
23 -34.9004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  18  10.....................ESSTYTYLIGDEATAVLIDPVL-EQVDRDLQMVAELDLT---LTHVFDTHVHADHITASGALRERTQATVVGSVNGAS-----------------------CANVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLG--DRVFTGDALLVRGNGRTDFQNGNASQLYDSLT-------RVLFTLPDETLVPGHDYKGRTVTSIA--EEKRHNPRVAGKSREEFIHIMEN............ 204
24 -34.5004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  13  7HVDLPYNLTATKIDSDVFVVDFYSSNVLVAKMLDGVVIVSSPFENLTQTLMDWVAKT--MKPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRLEENKKDRIKAAEFSSHPVPADNVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGD----------ANVKAWPDSARRLKKFDAKIVIPGHGEWGG........................................... 230
25 -34.4005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  10  23....VGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWGAKTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEAEGNEI-----------PTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAN------VLYGGCAVLALSRTSAGNVA-DADLAEWPTSVERIQKHEAEVVIPGHGLPGG........................................... 227
26 -34.0002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  17  1..........MKLLFRQLFENESSTFTYLLADVKPALLIDPVD-KTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKA----------------------SGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGADQPQPRMAFTGDAVLIRGCGRTDFQE--GSSDQLYESVSQIFTLPKDTLIPAHDYKGFEVSTVGEEMQHNPRLTKDKETFKTIMSNLNLSYPKMIDVAVPA 231
27 -33.9004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  16  20............LGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGN----------GEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVF------------EDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKI-------------QQYISHRNIREQQILTLFRENFEK 235
28 -33.7004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  16  1AGARLPDLKIEKLEEGVYVHGVVSKHGLVVLVNTDAYLIDTPTATDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIEWLNSQ-SIPTYASELTNELLKKDGKVQAKNS-----------------SGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGD----------ANLEAWPKSAKILMSKKAKLVVSSHS------------------EIGDASLLKRTWEQAVKGLNESKKPSQPS 228
29 -33.5004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  10  41....VGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWGKNTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEAEGNE-----------IPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAN------VLYGGCAVLELSSTSAGNVA-DADLAEWPTSVERIQKHEAEVVIPGHGLPGG........................................... 245
30 -33.4004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  11  4....VPELRIEKVKENIFLHGLVSSNGLVVIDKGNAFIVDTPSDRDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIKWLNDQ-SISTYATTSTNHLLKENKK----------------EPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPKSK------ILFGGCFVRSLDSEGLGYTG-EAHIDQWSRSAQNALSREAQIVIPGHGKIGDIAL----------------KHTKSLAETASNKSIQPNANASA. 232
31 -33.3003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  12  3....EKNLTLTHFKGPLYIVEYVQENSMVYIGTDGITIIGATWTPEAETLYKEIRKV--SPLPINEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLDTVFPGDFNLQNGSIRAMYLEAHTKDGIFVYFPAER------VLYGNCILKENLGNMSF-----ANRTEYPKTLEKLKGLKVDSIIAGHDTPIHDVGLIDHYLT................................. 226
32 -33.3003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  16  3....KDFVIEPPIKNNLHIYKEYSANSMYLVTKKGVVLFDVPWEKVYQSLMDTIKKR--HNLPVVAVFATHSHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKDGKA---------------TSTEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIK-------EANVEQWPKTINKLKAKKATLIIPGHDEWKG........................................... 205
33 -33.2001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  12  1.....AGMSLTQVSGPVYVVYYVQENSMVYFGAKGVTVVGATTPDTARELHKLIKRV--SRKPVLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPPNVVHDGDFTLQEGKVRA-FYAGPAHTPDGIFVYFPDEQ------VLYGGCILKEKLGNLSF-----ADVKAYPQTLERLKALPIKTVIGGHDSPLHGPELIDHYEA................................. 219
34 -33.1002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  14  4IKNETGTISISQLNKNVWVHEAVPSNGLVLNTSKGLVLVDSSWDDKTKELIEMVEKK--FQKRVTDVIITHAHADHIGGIKTLKER-GIKAHSTALTAELAKKNGYE---------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGSLVKSTSAKDLGNVA-DAYVNEWSTSIENVLKRNINAVVPGHGEVGD........................................... 210
35 -32.8004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  12  15GDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-------HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLG-AADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 228
36 -32.7002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  11  41....VGEVRLYQIADGVWS-AVYPSNGLIVRDGDELLLIDTAWGKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEVEGNEI-----------PTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAS------VLYGGCAIYELSRTSAGNVA-DADLAEWPTSIERIQQHEAQFVIPGHGLPGG........................................... 245
37 -32.6002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  10  40....VGEVRLYKIGDGVWSHTVYSSNGLIVRDADELLLIDTAWGKNTVALLAEIEKQ--IGLPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAEAAGNE-----------VPAHSLKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVPAVR------VLFGGCAVHEASRESAGNVA-DANLAEWPATIKRIQQREAEVVIPGHGLPGG........................................... 244
38 -32.5004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  12  18GDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-------HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLG-DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 231
39 -32.5003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  13  4IKNETGTISISQLNKNVWVHTELGSSGLVLNTSKGLVLVDSSWDDKTKELIEMVEKK--FQKRVTDAIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKNGYE---------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGCLVKSTSAKDLGNVA-DAYVNEWSTSIENVSKRNINAVVPSHGEVGD........................................... 210
40 -32.5004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  14  4....LPDLKIEKLDEGVYVHGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKKDGKVQATNS-----------------SGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGD----------ANIEAWPKSAKLLKSKKAKLVVPSHS------------------EVGDASLLKLTLEQAVKGLNESKKPSKPS 227
41 -32.5002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  12  14....TGTISISQLNKNVWVHEAVPSNGLVLNTSKGLVLVDSSWDDKTKELIEMVEKK--FQKRVTDVIITHAHASRIGGIKTLKER-GIKAHSTALTAELAKKNGYE---------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGCLVKSTSAKDLGNVA-DAYVNEWSTSIENVLKRNINAVVPGHGEVGD........................................... 216
42 -32.5001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  13  2.......VKIEKLKDNLYVYTKYAANAVYLVTDKGVVVIDCPWGEDFKSFTDEIYKK--HGKKVIMNIATHSHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKENKP---------------RAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIG-------EAYVNDWTQSVHNIQQKGAQYVVAGHDDWKD----------------------QRSIQHTLDLINEYQQKQKAS 222
43 -32.5001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  8....SDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPINDATETLVNWVADS--LHAKVTTFIPNHWHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEKG----------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTEN------ILFGGCMLKDNQATSIGNIS-DADVTAWPKTLDKVKAKSARYVVPGHGDYGG........................................... 211
44 -32.4003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  11  16GDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-------HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLG-DADTEHYAASARAFGAAKASMIVMSHSAPDSRAA----------------THTARMADKLRKLVPRGSAAAAL. 256
45 -32.3004tyf_A mol:protein length:231 NDM-4  ali model follow..  11  3GDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGLVAAQ-------HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG-------DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 216
46 -32.3001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  8....SDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPINDATEMLVNWVTDS--LHAKVTTFIPNHWHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKG----------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTEN------ILFGGCMLKDNQTTSIGNIS-DADVTAWPKTLDKVKAKSARYVVPGHGNYGG........................................... 211
47 -32.3003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  12  9GDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-------HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLG-DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 222
48 -32.2005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  12  15GDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-------HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLG-DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 228
49 -31.9004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  12  42GDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-------HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLG-DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................... 255
50 -31.5002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  12  4....HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPSEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREG----------------KPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSK------ILFGGCLVRSHEWEALGYVG-DASISSWADSIKNIVSKPIQMVVPGHGKVGSSDI----------------DHTIDLAESASNKLMQPTAEASA. 232
51 -31.3005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  11  21....HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPWSEETKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAR----------------EGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVG-------DASISSWADSIKNIVSYPIQMVVPGHGKVGSSDI----------------DHTIDLAESASNKLMQPTAEASA. 249
52 -30.7001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  15  3.......VEVLPALTDNY--------MYLVIDDETAAIVD---PVQPQKVVDAARKHGVK---LTTVLTTHHHWDHAGGNEKLVKLEGLKVYGGDDRIGAL-----------------------THKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSETGDTLFVAGCGKF----------YEGTADEMCKALEVLGRLPPDTRVCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFT. 220
53 -30.0005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  13  19....PAAGDTFEVAPGVRWLSLDHINLWLLRDQAGWTIVDCGISEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGNVRLWMTLGEYMFGCL-DKLRSRRSYYSDLVPAVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALHSEADGVLISGDMVL----RISTNVSVFDLEPEANPLALYLESLGRYETMAPDLVLPSHG-----------------KPF---RGVRTRIAQLRAHHDARLEEVRVA 299
54 -29.9003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  16  47.......................PTHPILIQTAQYNLIIDAGIGNEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHANAIHVVQQDEWHEFIA--PNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPG--IKMQHSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVK........................................ 259
55 -28.6002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  15  25.......VTVVPTLKDNF--------SYLINDHTTHTLAAVDVNADYKPILTYIEEHLKQQGTFSTILSTHKHWDHSGGNAKLKAELEAVVVGGAND----------------------SIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGDTMFIAG-----GAFFEGDEKDMCRAMEKVYHIHKGFIFPGH--EYTSGFMTFSEKTFPDRASDDLAFIQAQRAKYAASVPSSLAEEKR. 272
56 -28.5003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  15  14............LAHASYLVGCQETGEACVIDPA----------RDVEPYLLTAKREGLR---IVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEWKSEYVKAYPH--------------RLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKTSPSGDFVFVGDVGRPDERVAGESGSSEALARQMFRSLRKFEALPDHVQVPAHGAGSACGKALGAVPEKLVNWALQHKDEDAFVQALLA............ 241
57 -28.5004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  15  57.......................SINAFLVNIGKSLILIDSGAASHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISKDGVANNATVYVSNDEASFWLDPKQAAKLPKEKQAAPYQAKQRFKTYKLGDDIQ-----FKVINTAGHTPGHFSYELKTKGESIVGDIVHSHTVQFDRPETAIEYDIDPKKAVETRLKQFANFAKNGQTIAAPHLPFPGIGHTYSADGKS................................ 281
58 -28.1004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  17  58.......................AINILLVKTKEKLILMDTGMGIRTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQI-KFYDLNKTLYSH---FNFQLAPGHTPGLTVTTISSGNEKLMADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKVKAPGFEWIP............................ 289
59 -27.9004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  19  10.................FFDPATCTISYLLFDSGSGALIDSVLDASADQLIARVAALGAR---VRWLLETHVHADHLSAAPYLKTRVGGEIAIGRHVTRVQDVFGK----FNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARAAFVGDTLFMPDYGTARCDFPGGDARSLYRSIRKVLSLPPATLYMCHPNGRAIQYASTVADELRENVHIREGVTEDDFVAMRTARDATLDMPV.. 265
60 -27.9003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  14  29............LSQASYLIGCQKTGEAMIIDPI----------RDLSSYIRVADEEGLT---ITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLGYKNMPNHT---------------HFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGASGDFIFVGDIGRPDEKAVKVEGSSEIGAKQMFKSIESIKDLPDYIQIPGHGAGSPCGKSLGAIPEKQTNWAFSENNEATFIDKLIS............ 255
61 -27.7004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  18  12.................FYDEATSTISYLVMDRETRALIDSVLDASADRLVERVNELNAS---VRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHITQVQKVFGA----FNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIEDAGE----IAVFVGDTLFMPDYGTARCDFPGADARTLYRSIRRLLAFPDQTLFMCHPGGRDMQYVTTVAEQRASNIHIHQGIDEDSFVAMREARDKTLEMPV.. 261
62 -27.0004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  15  88.......................AVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPEGMQGAPYAKMNKLKPYKTEGELLPG---VSLVASPGHTPGHTSYLFKSGGQSLLGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVP............................ 314
63 -26.9001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  15  96.......................SVTGYLVNTGSKLVLVDTGAAGTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMVGEQLANAVVRADQKEADFWLSQTNLDKAPDDESKGFFKGAMASKPFSGNTDLVPG---IKALASHGHTPGHTTYVVESQGQKLAGDLILVAAVQFDDPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIAASHLSFPGIGHIRAEGKGYRFVP............................ 322
64 -26.9004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  15  88.......................AVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPEGMQGAPYAKMNKLKPYKTEGELLPG---VSLVASSGHTPGHTSYLFKSGGQSLLGDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVREEAQGYAWVP............................ 314
65 -26.0002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  13  10.......LNSIPAFQDNYI--------WVLTNDEGRVIVDPG---EAAPVLKAIAEHKWM---PEAIFLT----DHVGGVKELLQHFQMTVYGPAET----------------------QDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSR--PYLFCGDTLFSGGCGRL----------FEGTPSQMYQSLMKINSLPDDTLI-AHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERK. 215
66 -25.8001vme_A mol:protein length:410 Flavoprotein  ali model follow..  13  12.......TERIFDDPEIYVLRIDDYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKI-VDPKEITHIIVNHTEPDHSGSLPATLKTIDVEIIASNFGKRLLEG---------------FYGIKDVTVVKDGEEREIGGKKFKFVMTP-HWPDTILFSCDVGGGYLLPEILDDSNESVVERYLPHVTKYIVTVIGHYLEGAEKLSSLKIKALLPGHGLI-NHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKEK... 287
67 -23.9002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  12  8.......VQDQEMIPGVYWVGIVDYNSYFIDDEC-PTVIDSVKYPFAEEWLSRIAAC-CPLDKIKYVVMNHAEGDHASSLKDHYHKFNATFVCTKKCQEHLKILYGMEKATW-------------LIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYRKALEVASTVEIKYILSAHGVS-AEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARST... 284
68 -23.7004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  9.......VQVLPIATNTKVLRARSSNSYVIEGDK-TAIIDPPVESFMKIYLEALQQT-VNLKKLDYVILGHFSPNRIPTFKALLELAQITFVCSLPAAGDLRAAFPDDNLNI-------------LPMRGKETLDLGGHVLKFLPIP-RWPAGLCTYDVQTQILYTDKIF--GAHICGDDVFDDNWESFKEDQRYYEAALEKISDLQVRLYAVGHGPL............................................. 234
69 -23.7002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  13  3.......AAAKRISDGVYWTGVLDYNAYLVCGDEGVALIDNSYPGTFDELMARVEDAQVGMERVDYIIQNHVEKDHSGVLVELHRRFEAPIYCTEVAVKGLLKHYPSLREAE-------------MTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKFLKKFDEVKELRIQMIAPSHGQIWTDPMKIIEAGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSE... 284
70 -21.9001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  13  1.......MQATKIIDGFHLVGAIDYNAYLVEDEK-TTLFDTVKAEYKGELLCGIASV-IDPKKIDYLVIQHLELDHAGALPALIEACPEKIFTSSLGQKAMESHFHYKD----------------QVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYLKAIETLVGVAPEFICPDHGVIFRGADQCTAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDE... 280
71 -21.1001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  15  2........QPVAITDGIYWVGAVDYNAYLIVDDK-TALVDTVYEPFKEELIAKLKQI-KDPVKLDYLVVNHTESDHAGAFPAIMELCDAHVLCTQRAFDSLKAHYSHID----------------TIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYTKKLDEIQKLAIKTIAPSHGIIWR-AYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAG... 279
72 -20.5002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  13  29..........................SLLLKKGNKEIVVDTGQSE---NFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPEVKIYTHKEITNTDITYDNEFTTKNFFVEKEGKRIPDKFLDEVFVVVKEEDGINVVTGCSHA-GILNILETARNRFGVSYISLIGGFHLRGMEE-----------EKVKDIARKIEEYGVKKVLTGHCTGIDEYGFLKSVLKDK............................... 266
73 -20.1004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  14  2.........SIVVKNNIHWVGQRDYNSYLIREEK-NVLIDTVDHKFSREFVQNLRNE-IDLADIDYIVINHAEEDHAGALTELMAQIDTPIYCTANAIDSINGPEWN------------------NVVKTGDTLDIGNKQLIFVETP-HWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFEQCQRYTPKITEILGLPVDMIATSHGVVWR-LYLKWAADYQEDRITIFYDTMSNNTRMMADAIAQGIAET... 275
74 -19.0002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  10  3....SKAKTTVTFHSGILTIGG---TVIEVAYKDAHIFFDFGTEFRPELLVPELKDL--KDYQHTAVFLSHAHLDHSRMINYLDP--AVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDAYGASALLIRTPDHFITYTLMMEGVSISFPEREPDPAQIAVVSEEDLVQHLVRLELENPNRQITFNGYPANVERFAKIIEKSPRTVVLEANMAALLLEVFGIEVRYYYAESGK. 306
75 -18.3002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  12  13...............LIRPLGAGQ-SCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEINFHEVKEVAGIKFWCYHA-GHVLGAAMFMIEIAGV----KLLYTGDFSRQEDRHLMAAEKREEREARFCNTVHDIVNRGGRGLIPVFA............................................... 242

FFAS is supported by the NIH grant R01-GM087218-01
1 1 8 0 3 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.