current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1m2x_A mol:protein length:223 class B carbapenemase BlaB-1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKASNLast
1 -103.0001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model  100  1DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKASN 223
2 -98.5003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  45  5FVIEPPIKNNLHIYKTFGVFGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNK......... 218
3 -98.0002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  36  16TISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK.......... 228
4 -97.9002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  35  10TISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK.......... 222
5 -96.5001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  28  10DISITQLSDKVYTYVSLAEIEGWGVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQYIESTSK.. 231
6 -96.5003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  35  10TISISQLNKNVWVHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK.......... 222
7 -96.0001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  28  10DISITQLSDKVYTYVSLAEIEGWGVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSK.. 231
8 -92.0002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  32  6PLEVIKIEDGVYLHTSFKNIEGYGVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQP. 226
9 -92.0004tyf_A mol:protein length:231 NDM-4  ali model follow..  25  9DLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR....... 231
10 -91.9003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  25  15DLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR....... 237
11 -91.2004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  32  6ELRIEKVKENIFLHTSYSRVNGFGVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRK-NGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKE-PAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQP. 226
12 -90.4005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  25  21DLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRLE..... 245
13 -90.1005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  32  23PLEVIKIEDGVYLHTSFKNIEGYGVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQP. 243
14 -89.7003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  24  22DLVFRQLAPNVWQHTSYLDPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRKLVPRG. 250
15 -89.6004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  25  21DLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR....... 243
16 -89.3005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  26  25EVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNEILEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVA.. 247
17 -89.0004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  25  24DLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR....... 246
18 -88.6004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  30  7DLKIEKLEEGVYVHTSFEEVNGWGVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVE-RGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSG-VSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG---DANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKP. 224
19 -87.9004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  25  48DLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRL...... 271
20 -87.2004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  30  6DLKIEKLDEGVYVHTSFEEVNGWGVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVE-RGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSG-VNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG---DANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKP. 223
21 -87.1002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  26  42EVRLYKIGDGVWSHIATQKLGDTVYSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPKALSSSGDVVRFGP--VEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVA.. 264
22 -86.8004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  26  43EVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVA.. 265
23 -86.3002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  26  43EVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGTHSLEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVV.. 265
24 -81.8004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  27  13NLTATKIDSDVFVVT-----DRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLG---DANVKAWPDSARRLKKF--DAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMR... 249
25 -80.8003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  25  5NLTLTHFKGPLYIVED-----KEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWKSLPDTVFPGD--FNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN----LGNMSFANRTEYPKTLEKLKGLIEKVDSIIAGHDTIHDVGLIDHYLTLLEKAPK...... 233
26 -80.7001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  27  2GMSLTQVSGPVYVVE-----DNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWLVLPNVVHDGDFTLQEGK--VRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK----LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPHGPELIDHYEALIKAAPQSS.... 228
27 -34.4002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  11  5..SSGLVPRGSHMLRLSAPGQGDVQVPVFLLRLGEASWALVEGGISRD-AELVWADLCRADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALFDEAEGVWRPLVFDDMEAYLESLERLQRL-PTLLQLIPGHGGLRGRLAADGAESAYTECLRLCRRL. 262
28 -34.0001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  14  21.MAPLQIADHTWQI--------GTEDLTALLVQTPDGAVLLDGGMPQM-ASHLLDNMKARTPRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSANADRIVMDGEVITVGGIVFTAHFM-AGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLPHLIEDYRRSFATVRAL--PCDVLLTPHPGASNWDYAAGARAGAK.......... 242
29 -33.6002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  17  1...MKALLPGLYLLPVPIPYPLKTV--NLYLLQGAGEVALVDTALGTRAARGALELHLAELGQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHRVHPPQNPLPLRDGEALEVAGKRLRVLW-TPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAENPLKDFLRSLDRLADL--GARVAYAGHFGP--EELKAHHQARLEALLALLDGP. 265
30 -33.1002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  11  6......HRPDLYSWSTFNPARN--IDFNGFAWIRPEGNILIDPV---ALSNHDWKHLESLGG--VVWIVLT--NSDHVRSAKEIADQYTKIAGPVAEKENFPIY----CDRWLSDGDELVPG---LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVRRLLEKVEAVLVGDGWSVFRDGRDRLKELVATL........ 200
31 -32.9003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  14  38.FEPFQLIDNIYYV--------GTDGIAVYVIKTSQGLILMDTAMPQS-TGMIKDNIAKLKVADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYPKVDRAVKEGDRVTLGDTTLTAHAT-PGHSPGCTSWEMTVKDVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAM--KIDVLLGPHPEVYG...................... 247
32 -32.6003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  16  9.QQPFTIYGNTHYV--------GTGGISAVLLSSPQGHILVDGTTEKG-AQVVAANIRAMKLSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPAKVRAVADGELVKLGPLAVKAHAT-PGHTEGGITWTWQSCEVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKL--SCDIAIAAHPEVND...................... 220
33 -32.5001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  13  8.FPPFRIAGNLYYV--------GTDDLASYLIVTPRGNILINSDLEAN-VPMIKASIKKLKFSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKSTVDKVLHDGERVELGGTVLTAHLT-PGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKPKIAEDYKHSIKVLESM--RCDIFLGSHAGMFDKNYIEQKANDFYTELKKQETG. 263
34 -32.2004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  14  41.AMPQKVYGNTWYV--------GTCGISALLVTSDAGHILVDAAT-PQAGPQILANIRALRPEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPVANIVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASGRRYAQGARQRLEKRLAEEAAA. 295
35 -31.8005aeb_A mol:protein length:272 LRA-12  ali model follow..  14  21.YRPFRIAGNLYYI--------GTYDLACYLITTKQGNIIVNTGLAAS-ALQIKNNIKALKLTDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSIIADRLLHDKDTIQLGDTKLVMLHH-PGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKPGIAKDYAYTLQAMKNL--SFDIWVASHASQFS...................... 232
36 -31.7005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  15  18.....RLFGNTYYV--------GMKGLSSVLVTSPQGHVLIDGGLPES-APKIIANIGALRIEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVVKDMRLARDGGQFNVGPVYLTAHAT-PGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGPNALADLRHSFETLEKL--PCDVLISAHPEASQ...................... 228
37 -31.6004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  14  41.AMPLKVYGNTWYV--------GTCGISALLVTSDAGHILVDAAT-PQAGPQILANIRALRPEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPVANIVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASGRRYAQGARQRLEKRLAEEAAT. 295
38 -31.5002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  14  11........................LQENAYLVETGEGPVLIDPGDE---PEKLLALFQT-TGLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLPLPVRPLEEGMRL----FGFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYD-LPGADPKALFASLKRLLSL-PPETRVHPGHGPGTTLGLEARTNPFLTGLEWEA.... 207
39 -31.4003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  15  20..........................ATVYVMCGEKLTVMIDAGVSNSIADFSFL-------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDGLKKVIEVEGNEEFDLGGYRMRLIYT-PGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIPTTVIDYKMYMESLKRQIEL--KPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQIN.. 232
40 -28.1004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  15  8..RVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTPAIPEYISCLKQALTE-FNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCILGEGTTVF-----EDLYDYMNSLKELLKI--KADIIYPGHGPVIHQQYISHRNIREQQILTLFRENF 233
41 -27.0005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  14  23..DTFEVAPGVRWLRMPLPFSLDHI--NLWLL-GQAGWTIVDCGISSEAIRTHWEQIRHLDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTLGEYMFGCLPAVPPRYRRLREGDAVKIGARTWRVVT-GYGHSPEHCALHSEADGVLISGDMVLPRISTNVSVFDLEPLALYLESLGRYETMAPD-TLVLPSHGKP--AQLRAHHDARLEEVRVACAEK. 303
42 -26.9002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  13  11........................FSQNCSLIWCEQTAALVDPGGD---AEKIKQEVDA-SGVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQGQPLTPDRWLNDGDRVSVGNVTLQVLHC-PGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDF-PRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD......... 210
43 -26.2001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  15  3SDKIMELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSS-MDELEEKFSELGISPITDVLFTHVHLDHIFNSVLFE--NATFYVHEVYKTKNYLSFGTIVGRIYSKVIS-SLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRLSYY-----DIIKGYGSVQVKNFLDRVGRIDLLVFPHD.......................... 206
44 -25.6004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  17  68..........................AEAALEEAARGPILVDTGGPWAR-EALLGALAGVAPGDVTLVVGTHGHSDHIGNLGLFPGAALLV----SHDFCLPGGRYLPHGLGEGQPLRLGPG---LEVWAT-PGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV---ADVVVPGHGPP........................ 234
45 -24.9001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  20  9........................LTDNYMYLVIDDEAAIVD----PVQPQKVVDAARK-HGVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYG--------GDDRIGALTHKITHLSTLQVGSLNVKCLAT-PCHTSGHICYFVSKPGAVFTGDTLFVAGC---GKFYEGTADEMCKALLEVLGRLPPDTRVYCGHNNLKFARHVEPGNAAIREKLAWAKE.. 202
46 -24.7001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  21  9........................LKDNYAYILHDEDVGVVDPSEAEPIIDSL-----KRSGRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAM-----DKDRIPGIDMALKDGDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSLSC---GKLFEGTPKQMLASLQKITSL-PDDTSIYCGHEYTLSNSKFALSLE............. 183
47 -24.4004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  10  8DVQVLPIATNTKVLRARS---ERGTTSNS-YVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRAPDDNLNILPMRGKETLDLGGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFKEDQRYYFNCLMAPHAIHVEAALEKISDL--QVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLE.. 256
48 -23.4002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  15  47..............................LIQCTDATVLYDTGCHPECMCNLPERLRQLGLSPISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRVNLLNFGTGHASGMLGLAVRLEKFLLVSDACYTATNYGPPARRAGDTIGYDRTVSHIRQYAESRSLVLFGHDREQFASLIKSTDGFYE.......... 276
49 -23.1004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  16  28.................................ESREAVLIDP----ETAPRDAQLIKEL-GLRLLYAVNTHCHADHITGSGLLRSL------LPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRAS-PGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDF-QQGCAKTLYHSVHEKIFTLPGDCLIYPAHD.......................... 180
50 -22.8002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  16  31........................LKDNFSYLINDHTLAAVDVNAD---YKPILTYIEEHLKQTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVV-ANDSIPAVTKPVREGDRVQVGDLSVEVIDA-PCHTRGHVLYKVQHPQALFTGDTMFIAGI---GAFFEGDEKDMCRAMEKVYYALDKVTFIFPGHEYTSGFMTFSEKTF............. 234
51 -22.7002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  15  2KAAAKRISDGVY-LRNYHGYTLQGTTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKFLGLLERIQMIAPSHGQI........................ 236
52 -22.1003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  13  43..............................LLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKEKIIEGDYEVVPGVQLLYT----PGHSPGHQSLFIETEQVLLTIDASYTKENFEDEVPFAGDPELALSSIKRLKEVVKKEKIIFFGHDI-EQEKSCRVFPEYI........... 254
53 -22.1002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  13  41..............................LLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKEKIIEGDYEVVPGVQLLYT----PGHSPGHQSLFIKTEQVLLTIDASYTKENFEDEVPFAGDPELALSSIKRLKEVVKKEKIIFFGHDI-EQEKSCRVFPEYI........... 252
54 -21.8002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  15  8.VQDQEMIPGVYIFHGYHTDEGSSYNS---YFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKIGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANI-EIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQHCQK 257
55 -21.6003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  13  3DTKVYLLDGGSLVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYEKHQTIPGALGLLGLEPIDVVVNSHFHFDHCGGNKYFP--HAKKICHRSEVPQACNPQPFEHLEGIDGDVDLARGVKLIST----PGHSIGHYSLLVEFPRILFTIDAAYTQKSTLCQAAFHIDPVAGVNSMRKVKKLAEDHGALMYSHDM......................... 254
56 -21.6004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  15  22.................................ATRQAVLIDP----EQVDRDLQMVAEL-DLTLTHVFDTHVHADHITASGALRER--------QATVVGSVNGASCANVQVRHGDEVRVGQLVFQVLAT-PGHTDDSISYLLGDR--VFTGDALLVRGNGRTDF-QNGNASQLYDSLTRVLFTLPDETLVYPGHD.......................... 171
57 -21.4001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  14  2..QPVAITDGIYYFHGPAFSTHRGTTYNA-YLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKASHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAK. 253
58 -21.3002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  19  27..................................DKPALLIDP----KTVDRDLKLIDEL-GLKLIYAMNTHVHADHVTGTGLLKTK------LPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRAT-PGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTDF-QEGSSDQLYESVHSQIFTLPKDTLIYPAHD.......................... 184
59 -21.2001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  18  1.MQATKIIDGFHLVGAIDTLSPMGTTYNA-YLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLEKAIETLVGAGVAPEFICPDHGVI........................ 229
60 -20.4004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  11  4.....VVKNNIHDFHGTEYKTLRGSSYNS-YLIREEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPEWNF--NVVKTGDTLDIGGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQEDR. 249
61 -20.4001vme_A mol:protein length:410 Flavoprotein  ali model follow..  12  12.TERIFDDPEIY-VLRIDDDR-EGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEGFYGIKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGLPHVTKYIVTVIGHYKNYILEGAEKLSSL--KIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPKKGK 261
62 -19.6003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  20  30..........................SQASYLIGCQKAMIID----PIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHT-PGHTPESISFLLTDEGGLFSGDFIFVGDIGRPDLLEKAVAKQMFKSIESIKDL-PDYIQIWPGHGA......................... 215
63 -19.1003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  15  5DISIHYLNGGNTKMDGANERNQINLPTHPILIQTAQYNLIIDAGIGNGKESHIIADLANLTPKDIDYVLMTHMHFDHAAGLTDQAGHNAIHVVQQDEWHEFIAPNIRSKSILFEKHFEPVPG---IKMQHSG-GHSFGHTIITIESDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAY........ 270
64 -18.8003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  18  15..........................AHASYLVGCQEACVID----PARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAIVSDEGPPEWKSEYVKAYPHRLLKDGDELHFGNVRIVVMHT-PGHTPEHVSYLLYDGKALFSGDFVFVGDVGRPDLLERVAARQMFRSLRKFEAL-PDHVQVLPAHGA......................... 201
65 -18.0004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  19  44DFEVTALYDGLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGYQPVDTVLLTHLHPDHACGLEFWLDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEGELLSLVASPGHTPGHTSYLFKSQSLLVWGDILLNHAVPEVVFEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV........................ 303
66 -17.9004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  19  44DFEVTALYDGLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGYQPVDTVLLTHLHPDHACGLEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGELLSLVASSGHTPGHTSYLFKSQSLLVWGDILINHAVPEVVWEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV........................ 303
67 -17.9004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  15  13ELELFILTDGYILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGFSAITDIFLSHAHPDHIGGVVFISKIEHDFWINASIKDFNNSALKAHPERLIQPKLKFYDLNKTLYNFQLAPGHTPGLTVTTISSEKLMYVADLIHSDVIPDWGFSGDTDLDIATASRKKFLKQLADTKARAPGLGFTKVKA.................... 282
68 -17.6004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  16  13DVQITALLDGTNFMSPADQEKGVQTSINAFLVNIGKSLILIDSGAASSHLGSVLSNLKASGYQPVDTILLTHLHPDHVCGIANFPNATVYVSNDEASFWLDPKQAAKLPKEKIKQAIAPYQAKQRFKTYKLGAGHTPGHFSYELKTESIVFIGDIVHSHTVPETAIEYDIDPKKAVETRLKQFANFAKNGQTIPGIGHTYSAD.................... 278
69 -17.5001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  15  54DFEITALSDGTVALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAGPTLGRLAANLKAAGYQPVDEIYITHMHPDHVGGLLAFPNAVVRADQKEGAMASLNPYVKAGKFKPFSGNTDLVPGIKALAS----HGHTPGHTTYVVESQKLALLGDLILVAAVPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIPGIGHI........................ 311
70 -16.8004nur_A mol:protein length:633 PSdsA  ali model follow..  14  89...LFEVTDGIYQVRNYD-------LSNMTIVEGKDGITIFDPLISQETAKAALDLYYKRPKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAENLIPPTDIIKETETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTLHNTYSLRGARDPLAWSKYLNEALKLWGDDVQVMPVWGNKEVREQLSLQRDMYRYINDET.... 354
71 -16.8002cfu_A mol:protein length:658 SDSA1  ali model follow..  12  107...LFEVAEGIYQVRGFD-------LANITFIRGDSGWIVVDTLTTPATARAAYELVSRLGERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKENLLAPTRLIEGEEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTLHNLYTLRGARDALGWSKYINQALHRFGRQAEVMPRWGNAEIVEVLEKQRDLYGYLHDQT.... 372
72 -16.6004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  16  89...LFKVTDKMYQVRGQD-------ISNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQRPQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISENIIAPTKTIVRTEKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENATHTLHNFYTLRGAKDTSKWTEYLNETLDMWGNDAEVLPVWGNKHINDYIGKYRDTIKYIHDQT.... 354
73 -16.4002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  15  117...LFEVMPKLYQVRGLD-------PANMTIIEGDSGLVLIDTLTTAETARAALDLYFQRPKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSENLVAPNVLIEKPERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPAMHNLLTPRGARDAKAWAGYIDASLEKYGDRTDVLPVWGGDKVRTYLADQRDMYAFLNNRA.... 383
74 -15.2002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  20  16........................FQDNYIWVLTNDECVIVDPGEAAPVLKAI-----AEHKWMPEAIFLT----DHVGGVKELLQHQMTVYG--------AETQDKGATHLVGDGDTIRVLGEKFTLFAT-PGHTLGHVCYFSRP--YLFCGDTLFSGGC---GRLFEGTPSQMYQSLMKINSL-PDDTLICCAHANIKFALSILPHDSFINEYYRKVKE.. 197
75 -15.1003x2x_A mol:protein length:227 UPF0173 metal-dependent hydrolase TM_1162  ali model follow..  18  8..........................GHAVVLIEGKKNIIID----PFISGNPVCPVKLEGLPKIDYILVTAGHGDHLGDAVEIAKKDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYIEGKKIYHAGDTGLTREMELLA-IGGNFVMDVEDAV--RAAVMIKPKKVVPMH........................... 191

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 5 7 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.