current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1sml_A mol:protein length:269 PROTEIN (PENICILLINASE), from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst AEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGARAGAKALTCKAYADAAEQKFDGQLAKETAGARLast
1 -104.0001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model  100  1AEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGARAGAKALTCKAYADAAEQKFDGQLAKETAGAR 269
2 -96.8003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  31  18AQAQTIKDFLAVAMKKWTAPFEPFQLIDNIYYVGTDGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGMQAKRAENPFIKPGELVTYATSLSEDFDKQLAKQTAALE 292
3 -93.3003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  31  2.............DRDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQNSAYVDNGACRAIAAAGRKRLETRLASEKR... 262
4 -92.3005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  38  1.......TPGCEVCATWNADQAPFRLFGNTYYVGMKGLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGEPDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGFKSSEYPNALADLRHSFETLEKLPCDVLISAHPEASQLWQRLEADAFVDPQACRAYVAAARTLLDSRLDQEKQQ.. 271
5 -92.3001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  29  1.............AYPMPNPFPPFRIAGNLYYVGTDDLASYLIVTPRGNILINSDLEANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYANSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVNNPFVDPTGCKNYIEQKANDFYTELKKQETG.. 263
6 -90.7004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  36  21LASDAPASRGCADDAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTADVYRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPAPLMDTTACRRYAQGARQRLEKRLAEEAAA.. 295
7 -90.3005aeb_A mol:protein length:272 LRA-12  ali model follow..  25  3..ASQKVKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPKSFMDRKGYDESLDKLQKEYEKHLNEN..... 272
8 -90.3004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  36  21LASDAPASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTADVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPAPLMDTTACRRYAQGARQRLEKRLAEEAATSP 297
9 -51.7002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  22  4............................FPVTLGPLQENAYLVETGEGPVLIDPG--DEPEKLLALFQTTGLI---PLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEGADLAARAWGLAIP-KPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPG-------ADPKALFASLKRLLSLPPETVHPGHGPGTTLGLEARTNPFLTGLEWEA..................... 207
10 -49.3002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  17  15................MLRLSAPGQLDDDLCLLGDVQVPVFLLRLGESWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLNVQVLASERTCQAWKSESARAEQRLPEACAWDALPVRAVADGEWLELGPHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDAL-----EFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLQLIPGHGGLLRGRLAADCRRLLWRQSMGESLDELSEELHRAWGGQSVD.. 289
11 -47.9002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  20  4............................RIIPVTAFSQNCSLIWCEQLAALVDPG--GDAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKR------KLLPLGDDVFIPGHGPLSTLGYERLHNPFLQD.......................... 210
12 -47.9003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  14  20.....................................ATVYVMCGEKLTVMIDAGVSNSIADFSF--------LDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKV-DQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVD--------DFLFTGDSAGAYFNGVVIPTTPIDYKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMGGVAGEILRKQIEVNLRGLRESKKS... 260
13 -45.3001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  12  29.....................................STVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFE---NATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEK--VKVFHTPWHAREHLSFLLDTENAG---RVLITGDITPNRLSYYDIIK-GYGSVQVKNFLDRVGRI--DLLVFPHDAPLKPEVKK.................................. 215
14 -40.8002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  16  3........................ALLPGLYLLPLKTVNLYLLQGAGEVALVDTALRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEG-LGARVFLHEEEFARGHRFWREPEAFAEASRVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEK---VSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQR----------AEELKAHHQARLEALLALLDGPKT 267
15 -39.5002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  18  23....................................DFNGFAWIRPEGNILIDP--VALSNHDWKHLESLG----GVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENF-----------------PIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLE-ETTLITGDLVRAYRAGGLEI----PDEKLMNKQKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKELVATLA........................ 201
16 -38.9004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  18  68.....................................AEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPG---AALLVSHDFCLPGGRYLPHG-----------------LGEGQPLRLGP-GLEVWATPGHGGQRDVSVV--VAGTALGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV-ADVVVPGHGPPFRVLREASQPETEG........................... 248
17 -38.3002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  19  43.....................................VSAYLIQCTDATVLYDTGCHPECCNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDEFATAVRYFATGDHSSEAWLATPRNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVRLEKQPGFLLVSDACYTATNYGPPARRAGVLHDTIGYDRTVSHIRQYAESTVLFGHDREQFASLIKSTDGFYE........................... 276
18 -37.7002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  19  37.....................................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEMKECILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIKTEQSGSV--LLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGH............................................ 237
19 -37.6003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  17  35.....................................VYSILIEHAEGRFLIDTGYDEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFP---HAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEAEGIDGDVDLARG--VKLISTPGHSIGHYSLLVEFPRRK---PILFTIDATQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDELMYSH............................................ 252
20 -37.5003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  19  39.....................................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEMKECILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIETEQSGSV--LLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGH............................................ 239
21 -36.6005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  15  6AHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEAEGNE---------IPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAN------VLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVT........................... 239
22 -36.4004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  16  24AHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEAEGNE---------IPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAN------VLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVAE.................. 266
23 -35.7004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  11  2........PKSSDHVDLPYNLTATKIDSDVFVVDFYSSNVLVAKMLDGVVIVSSPFENLTQTLMDWVAKT--MKPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRLEENKKDRIKAASSHPVPADNVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLG---------DANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAE........................... 242
24 -35.6002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  15  41.................VGEVRLYQIADGVWS-AVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEVEGNE---------IPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAS------VLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE.................. 266
25 -35.5004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  14  20.........................LGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGN--------GEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTV------------EDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAK----------IQQYISHRNIREQQILTLFRENFE 234
26 -35.5001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  20  14.......................................AYILHDEDTVGVVDPS---EAEPIIDSLKRSGRN---LTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPG------------------IDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKL---------FEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAETIPTTVKMEKA... 216
27 -35.3003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  17  3.................KDFVIEPPIKNNLHIYKEYSANSMYLVTKKGVVLFDVPEKVQYQSLMDTIKKR--HNLPVVAVFATHSHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKDGK-------------ATSTEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIK------EANVEQWPKTINKLKAKKATLIIPGHDEWKGGGHVEHTLELLNKK......................... 219
28 -35.1002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  13  23AYSAQPGGEYPTVDDIPVGEVRLYKIGDGVWSHTVYSSNGLIVRDADELLLIDTAWAKNTVALLAEIEKQ--IGLPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAEAAGNE---------VPAHSLKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVPAVR------VLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQREAEVVIPGHGLPGGLELLQHTTNVV-------------KTHKVRPVAE..... 265
29 -34.8002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  16  8.................TGTISISQLNKNVWVHEAVPSNGLVLNTSKGLVLVDSSDDKLTKELIEMVEKK--FQKRVTDVIITHAHADHIGGIKTLKER-GIKAHSTALTAELAKKNGYE-------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEVGDKGLLLHTLDLLK........................... 222
30 -34.7004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  13  4.................VPELRIEKVKENIFLHGLVSSNGLVVIDKGNAFIVDTPSDRDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIKWLNDQ-SISTYATTSTNHLLKENKK--------------EPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPKSK------ILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSREAQIVIPGHGKIGDIAL----------KHTKSLAETASNKSIQPNANASAD.. 233
31 -34.5004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  14  4.................LPDLKIEKLDEGVYVHGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKKDGKVQATNS---------------SGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG---------DANIEAWPKSAKLLKSKKAKLVVPSHSEVGDASLLKLTLEQA-----VKGLNESKKPSKPSNWSHPQFEK 236
32 -34.5004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  16  2NAIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMAD........................... 240
33 -34.4002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  15  1....ASQKVEKTVIKNETGTISISQLNKNVWVHTELGSNGLVLNTSKGLVLVDSSDDKLTKELIEMVEKK--FQKRVTDVIITHAHASRIGGIKTLKER-GIKAHSTALTAELAKKNGYE-------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEVGDKGLLLHTLDLLK........................... 228
34 -34.4003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  13  3.................EKNLTLTHFKGPLYIVEYVQENSMVYIGTDGITIIGATTPETAETLYKEIRKV--SPLPINEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDPGDFNLQNGSIRAMYLEAHTKDGIFVYFPAERVLYGNCILKENLGNMSF----------ANRTEYPKTLEKLKGLKVDSIIAGHDTPIHDVGLID................................. 222
35 -34.3003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  16  3GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHT---------ARMADKLRKLVPRGSAAAALE.. 257
36 -34.3003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  15  8.................TGTISISQLNKNVWVHTELGSSGLVLNTSKGLVLVDSSDDKLTKELIEMVEKK--FQKRVTDAIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKNGYE-------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRNINAVVPSHGEVGDKGLLLHTLDLLK........................... 222
37 -34.2004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  13  5.................LPDLKIEKLEEGVYVHGVVSKHGLVVLVNTDAYLIDTPTATDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIEWLNSQ-SIPTYASELTNELLKKDGKVQAKNS---------------SGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG---------DANLEAWPKSAKILMSKKAKLVVSSHSEIGD----------------ASLLKRTWEQAVKGLNESKKPSQ 226
38 -34.1001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  12  1..........AQKSVKISDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPNDAQTETLVNWVADS--LHAKVTTFIPNHWHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEKG--------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTEN------ILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGDYGGTELIEHTKQIVN........................... 223
39 -34.1004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  17  9....PTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMAD........................... 243
40 -34.0001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  14  2....................VKIEKLKDNLYVYTKYAANAVYLVTDKGVVVIDCPWGEDFKSFTDEIYKK--HGKKVIMNIATHSHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKENK-------------PRAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIG------EAYVNDWTQSVHNIQQKGAQYVVAGHDDWKDQRSIQHTLDLIN........................... 213
41 -34.0003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  17  1.....SNANYMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMAD........................... 234
42 -34.0001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  12  1..........AQKSVKISDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPNDAQTEMLVNWVTDS--LHAKVTTFIPNHWHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKG--------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTEN------ILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGNYGGTELIEHTKQIVN........................... 223
43 -33.9004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  19  15.......................................TYLIGDEATAVLIDPVL-EQVDRDLQMVAELDLT---LTHVFDTHVHADHITASGALRERTQATVVGSVNGAS---------------------CANVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLG--DRVFTGDALLVRGNGRTDFQNGNASQL------YDSLTRVLFTLPDETLVPGHD-VTSIAEEKRHNPRVAGKSREEFIHIMEN.............. 204
44 -33.8005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  18  19.................FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMAD........................... 240
45 -33.6004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  17  29GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMAD........................... 267
46 -33.6004tyf_A mol:protein length:231 NDM-4  ali model follow..  17  7.................FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGLVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGN--------DADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMAD........................... 228
47 -33.6001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  14  1..................AGMSLTQVSGPVYVVYYVQENSMVYFGAKGVTVVGATTPDTARELHKLIKRV--SRKPVLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDWAEIVAFPEYPDLPLVLPNVVHDGDFTLQEGKVRA-FYAGPAHTPDGIFVYFPDEQVLYGGCILKEKLGNLSF----------ADVKAYPQTLERLKALPIKTVIGGHDSPLHGPE.................................... 212
48 -33.0004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  19  21.......................................TYLLGDRESAVLIDP-VLETAPRDAQLIKELGLR---LLYAVNTHCHADHITGSGLLRSLLPGCQSVIS--------------------RLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTL------YHSVHEKIFTLPGDCLIPAHD-----YHGFTVSTVEEERTLNPRLTLSCEEFVKIMGN...... 212
49 -33.0002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  17  4.................HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPSEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGKPVPT--------------HYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVG------DASISSWADSIKNIVSKPIQMVVPGHGKVGSSDI----------DHTIDLAESASNKLMQPTAEASAD.. 233
50 -32.7005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  17  21.................HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPSEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREG--------------KPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVG------DASISSWADSIKNIVSYPIQMVVPGHGKVGSSDI----------DHTIDLAESASNKLMQPTAEASAD.. 250
51 -31.1002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  14  1.......................MKLLFRQLFENESSTFTYLLADDKPALLIDP-VDKTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKA--------------------SGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGADQPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIPAHD-----YKGFEVSTVGEEMQHNPRLTKDKETFKTIMSN...... 216
52 -31.1005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  10  2AMNALEHQLDYPFADTLPAAGDTFEVAPGVRWLSLDHINLWLLRDQAGWTIVDCGISEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGNVRLWMTLGEDPAALDKLRSRRSYYSDLVPAVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALHSEADGVLISGDMVLPR---STNVSVFDLEPEANPLALYLESLGRYETMAPDLVLPSHGKPFRGVRTR----------IAQLRAHHDARLEEVRVACAEKPM 305
53 -30.0003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  14  48.....................................THPILIQTAQYNLIIDAGIGNEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHANAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPG--IKMQHSGGHSFGHTIITIESQGD----KAVHMGDIFPTTA-VTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGE.............................. 265
54 -29.1001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  19  14.......................................MYLVIDDETAAIVD---PVQPQKVVDAARKHGVK---LTTVLTTHHHWDHAGGNEKLVKLEGLKVYGGDDRIGAL---------------------THKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAGCGKF----YEGTADEMCKALEVLGRLPPDTRVCGH------------EYTINNLKFARHVEPGNAAIREKLAWAKEKYS 205
55 -29.0004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  21  59.....................................INILLVKTKEKLILMDTGMGIRTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTISSGNE----KLMYVADLIHSDVILFPHPDGDTDLDIATASRKKFLKQLADRAFTSH............................................ 269
56 -28.1002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  12  25....................VTVVPTLKDNF--------SYLINDHTTLAAVDV--NADYKPILTYIEEHLKQQGTFSTILSTHKHWDHSGGNAKLKAELEAVVVGGANDS----------------------AVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGDTMFIA------AFFEGDEKDMCRAMEKVYHIHKGFIFPGH-----TSGFMTFSEKTFPDRASDDLAFIQAQRAKYAAAVKTGD. 260
57 -27.8004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  20  57....................................SINAFLVNIGKSLILIDSGAASHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISKDGVANNATVYVSNDEASFWLDPKQAEKIKQAIAPYQAKQRFKTYKLGDDIQ-----FKVINTAGHTPGHFSYELKTKGE----SIVFIGDIVHSHTVQFDRPEYDIDPKKAVETRLKQFANFAKTIAAPH............................................ 265
58 -27.3003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  17  9..............................FYDEGLAHASYLVGCQETACVIDP--ARDVEPYLLTAKREGLR---IVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEWKSEYVKAYPH------------RLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKTSFSGDFVFVGDVGRPDLVAGESGSSEALARQMFRSLRKFEALPDHVQVPAHGASSTVGYEKLVNWALQHKDEDAFVQALLAGQPE.......... 245
59 -27.2004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  20  88....................................AVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAQQAVAPYAKMNKLKPYKTEGELLPG---VSLVASPGHTPGHTSYLFKSGGQ----SLLVWGDILLNHAVQFAKPEFDVDSDQARQSRQRILAEAATWVAGAH............................................ 294
60 -27.1004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  20  88....................................AVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKARQAVAPYAKMNKLKPYKTEGELLPG---VSLVASSGHTPGHTSYLFKSGGQ----SLLVWGDILINHAVQFAKPEFDVDSDQARQSRQRILAEAATWVAGAH............................................ 294
61 -27.0001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  21  96....................................SVTGYLVNTGSKLVLVDTGAAGTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMVGEQLANAVVRADQKEADFWLSQTNLDKAPDDESPYVKAGKFKPFSGNTDLVPG---IKALASHGHTPGHTTYVVESQGQ----KLALLGDLILVAAVQFDDPSLDSDSKSVAVERKKAFADAAKLIAASH............................................ 302
62 -26.7003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  15  24..............................FYDKHLSQASYLIGCQKTAMIIDP--IRDLSSYIRVADEEGLT---ITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLGYKNMPNHT-------------HFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGFSGDFIFVGDIGRPDLAVKVEGSSEIGAKQMFKSIESIKDLPDYIQIPGHGATSTLGYEKQTNWAFSENNEATFIDKLISDQPA.......... 259
63 -26.5004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  21  19.......................................SYLLFDSGSCALIDSVLDASADQLIARVAALGAR---VRWLLETHVHADHLSAAPYLKTRVGGEIAIGR-HVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARAFVGDTLFMPDYGTARCDFPGGDARSLYRSIRKVLSLPPATLYMCHD-ASTVADELRENVHIREGVTEDDFVAMRTARDATLDMPV.... 265
64 -26.3004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  19  21.......................................SYLVMDRETCALIDSVLDASADRLVERVNELNAS---VRWVLETHVHADHLSAAAYLKEKLGGHTAIGA-HITQVQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIEDAGEIA---VFVGDTLFMPDYGTARCDFPGADARTLYRSIRRLLAFPDQTLFMCHD-VTTVAEQRASNIHIHQGIDEDSFVAMREARDKTLEMPV.... 261
65 -25.3002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  19  21.......................................IWVLTNDEGCVIVDPG---EAAPVLKAIAEHKWM---PEAIFLT----DHVGGVKELLQHFQMTVYGPAETQ----------------------GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSR--PYLFCGDTLFSGGCGRL---------FEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSILPHDSFINEYYRKVKETLPVILKNERK... 215
66 -25.0001vme_A mol:protein length:410 Flavoprotein  ali model follow..  16  12....................TERIFDDPEIYVLRIDDYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKI-VDPKEITHIIVNHTEPDHSGSLPATLKTIDVEIIASNFGKRLLEG-------------FYGIKDVTVVKDGEEREIGGKKFKFVMTP-HWPDTMVTYLDGILFSCDVGGGYLLPEILDDSNESVVERYLPHVTKYLEGAEKLSSLKIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPKKGKVTVIYDSMYGFVENVMK 278
67 -24.6004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  12  7..................RDVQVLPIATNTKVLRARSSNSYVIE-GDKTAIIDPPVESFMKIYLEALQQT-VNLKKLDYVILGHFSPNRIPTFKALLELAQITFVCSLPAAGDLRAAFPDDNL-------------LPMRGKETLDLGGHVLKFLPIP-RWPAGLCTYDVQTQILYTDKI-FGAHICGDDVFDDNWESFKEDQRYYEAALEKISDLQVRLYAVGHGPLVRTSLIALTQAYADWSKAQK..................... 254
68 -24.3002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  17  3....................AAAKRISDGVYWTGVTTYNAYLVCGDEGVALIDNSYPGTFDELMARVEDAQVGMERVDYIIQNHVEKDHSGVLVELHRRFEAPIYCTEVAVKGLLKHYPSLREAE-----------MTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLDEDGILFSNDARLDREIPEYILMDAARKFYANLITPLLKKFDEVKELRIQMIAPSHGQIWTATGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSEGVDVR 289
69 -23.8002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  10  8....................VQDQEMIPGVYWVGIVDYNSYFID-DECPTVIDSVKYPFAEEWLSRIAAC-CPLDKIKYVVMNHAEGDHASSLKDHYHKFNATFVCTKKCQEHLKILYGMEK--------------LIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCPEDKILFSNDGRWADECDVSHVMHLFKEYTANILGLFRKALEVASTVEIKYILSAHGDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCETV 289
70 -22.3001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  14  1....................MQATKIIDGFHLVGAIDYNAYLVE-DEKTTLFDTVKAEYKGELLCGIASV-IDPKKIDYLVIQHLELDHAGALPALIEACPEKIFTSSLGQKAMESHFHYKD--------------QVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFADEKVLISNDIRFSDQIPVHTLERAMREYYANIVNPYLKAIETLVGVAPEFICPDHGVIFRGADKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVK 285
71 -22.1001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  16  2.....................QPVAITDGIYWVGAVDYNAYLIV-DDKTALVDTVYEPFKEELIAKLKQI-KDPVKLDYLVVNHTESDHAGAFPAIMELCDAHVLCTQRAFDSLKAHYSHID--------------TIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVPEEALLLPNDARFDDQVDAGLIMDEAAKYYANILMPFTKKLDEIQKLAIKTIAPSHGIIWRKDPGRIIEAYAR-DTMWLSTEKMAHALMDGLVAGGCEVK 284
72 -21.6004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  14  3.......................IVVKNNIHWVGQSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNE-IDLADIDYIVINHAEEDHAGALTELMAQIDTPIYCTANAIDSINGPEWN----------------NVVKTGDTLDIGNGQLIFVETP-HWPDSMMTYLTGDAVLFSNDALFNDEVDQTELFEQCQRYYANILTPFTPKITEILGLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQ-MSNNTRMMADAIAQGIAET. 275
73 -20.1002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  14  29.......................................SLLLKKGNKEIVVDTG---QSENFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPVKIYTHKEDLSFYEKYKNNFVLIDKDAEIEERIPDKFLDEVFVVVKEEDGINVVTGCSHA-GILNILETARNRFGVSYISLIGGFHLRG----------MEEEKVKDIARKIEEYGVKKVLTGH............................................ 249
74 -18.8002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  13  13............................LIRPLGAGQ-SCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSGRTFMTHADYVKVSNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHA-GHVLGAAMFMIEIAGV----KLLYTGDFSRQEDRHLMAAEIPNIKPDIL------------IIESTYGTHIHEKREEREARFCN--TVHDIVNRGGRGLIPVFALGRAQE. 248
75 -18.3002ycb_A mol:protein length:636 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  16  181............................RLTAMGGFR-SCLYLQTPNSRVLLDCGVGGDDKNSYPYLNVPEFTLDSLDAVIITHAHLDHSGFLPYLYHYYDGPVYCTAPDHIDIAHREDEPLPFNVKHVKKSVKHTITLDYGEVTDIAPDIRLTLHNAGHILGSAMAHLHIGDGQH--NMVYTGDFKYEQSRLLEAAANRFPRIETL------------VMESTYGGHEDVQPSRNRAEKELVKTIYSTLRRGGKILIPVFAVGRAQE. 423

FFAS is supported by the NIH grant R01-GM087218-01
1 1 8 0 3 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.