current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1vme_A mol:protein length:410 Flavoprotein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400
# Score Template Links and tools%idFirst MGSDKIMPKIWTERIFDDPEIYVLRIDDDRIRYFEAVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIGHDVEIIASNFGKRLLEGFYGIKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYLDGILFSCDVGGGYLLPEILDDSNESVVERYLPHVTKYIVTVIGHYKNYILEGAEKLSSLKIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKEKGFTPVVYKFSDEERPAISEILKDIPDSEALIFGVSTYEAEIHPLMRFTLLEIIDKANYEKPVLVFGVHGWAPSAERTAGELLKETKFRILSFTEIKGSNMDERKIEEAISLLKKELELast
1 -120.0001vme_A mol:protein length:410 Flavoprotein  ali model  100  1MGSDKIMPKIWTERIFDDPEIYVLRIDDDRIRYFEAVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIGHDVEIIASNFGKRLLEGFYGIKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYLDGILFSCDVGGGYLLPEILDDSNESVVERYLPHVTKYIVTVIGHYKNYILEGAEKLSSLKIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKEKGFTPVVYKFSDEERPAISEILKDIPDSEALIFGVSTYEAEIHPLMRFTLLEIIDKANYEKPVLVFGVHGWAPSAERTAGELLKETKFRILSFTEIKGSNMDERKIEEAISLLKKELE 404
2 -102.0001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  25  1...........MQATKIIDGFHLVGAIDWNSRDFHGYTLSPMGTTYNAYLVE-DEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEAC-QPEKIFTSSLGQKAMESHFHYKPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFEKVLISNDIFGQNIAASERF-SDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGVAPEFICPDHGVIFRDQCTFAVQKYVEYAEQKPTN-KVVIFYDSMWHSTEKMARVLAESFRDEGCT---VKLMWCKACHHSQIMSEISDAGAVIVGSPTHNNGILPYVAGTLQYIKGLRPQNKIGGAFGSFGWSGESTKVLAEWLTGMGFDMPATPVKVKNVPTHADYEQLKTMAQTIAR 394
3 -101.0002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  24  8...........VQDQEMIPGVYWVGIVDWMVRIFHG-YHTDEGSSYNSYFID-DECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKF-TNATFVCTKKCQEHLKILYGMETWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCDKILFSNDGFGQHYATSRRW-ADECDVSHVMHLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDMGLAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCE---TVLLEMTSSDITKVALHTYDSGAVAFASPTLNNTMMPSVAAALNYVRGLTLKGKPAFAFGAFGWSNRAVPDIVAELDGCKADVYEKGITFKFNYTEELLEQAYNAGVDLGK 401
4 -100.0001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  26  2............QPVAITDGIYWVGAVDWNIRYFHGAFSTHRGTTYNAYLIV-DDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELC-PDAHVLCTQRAFDSLKAHYSHINYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVEALLLPNDAFGQHIATSVRF-DDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQNLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKA-KAVIAYDTMWLSTEKMAHALMDGLVAGGCE---VKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIEPGPTVQWVPRGEDLQRCYELGRKIAA 394
5 -98.9004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  24  2.............SIVVKNNIHWVGQRDWEVRDFHGTYKTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQI-PDTPIYCTANAIDSINGPE--WNFNVVKTGDTLDIGNKQLIFVETPMLHWPDSMMTYLDAVLFSNDAFGQHYCDEHLF-NDEVDQTELFEQCQRYYANILTPFSRLVTPKITEILGLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQED-RITIFYDTMSNNTRMMADAIAQGIAETDPR-VAVKIFNVARSDKNEILTNVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRFRNKRASAFGSHGWSGGAVDRLSTRLQDAGFEMSLS-LKAKWRPDQDALKLCREHGREIAR 390
6 -95.8002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  26  1.........MKAAAKRISDGVYWTGVLDWDLRNYHGY--TLQGTTYNAYLVCGDEGVALIDNSYPGTFDELMARVEDAVGMERVDYIIQNHVEKDHSGVLVELHRRF-PEAPIYCTEVAVKGLLKHYPSAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDGILFSNDAFGQHLCCPQRL-DREIPEYILMDAARKFYANLITPLSKLVLKKFDEVKELRIQMIAPSHGQIWT-DPMKIIEAYTGWATGMVDE-RVTVIYDTMHGSTRKMAHAIAEGAMSEGVD---VRVYCLHEDDRSEIVKDILESGAIALGAPTIYDEPYPSVGDLLMYLRGLKFLTRKALVFGSMGGNGGATGTMKELLAEAGFDVACE-EEVYYVPTGDELDACFEAGRKLAA 400
7 -84.5004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  19  9...........VQVLPIATNTKVLRARSWSRLRFEIEYALERGTTSNSYVIE-GDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELA-PQITFVCSLPAAGDLRAAFPDDNILPMRGKETLDLGKHVLKFLPIPSPRWPAGLCTYDTQILYTDKIFGAHICGDDVFDDN---WESFKEDQRYYFNCLMAPHAIHVEAALEKISDLQVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLE................................................................................................................................................. 256
8 -38.4003fni_A mol:protein length:159 Putative diflavin flavoprotein A 3  ali model follow..  13  1...............................................................................................................................................................................................................................................................TKAETSIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDL--GAAVDLQELRELVGRCTGLVIGMSPAASA--ASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDPLLSKFRNLGLTTAFPAIRIKQTPTENTYKLCEEAGTDLGQ 145
9 -38.0003hly_A mol:protein length:161 Flavodoxin-like domain  ali model follow..  11  2....................................................................................................................................................................................................................................................................SVLIGYLSDYGYSDRLSQAIGRGLVKTGVA---VEMVDLRAVDPQELIEAVSSARGIVLGTPPSQPS--EAVATALSTIFAAAHNKQAIGLFDSYGGDDEPIDALLAQFRNLGLHTAFPPIRVKDQPTEAIYQQCEESGTDLGQ 140
10 -29.2002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  17  5............SSGLVPRGSHMLRLS-----QLDDDLCLLGDVQVPVFLLRLEASWALVEGGISRDAELVWADLCRWADPSQVHYWLITHKHYDHCGLLPYLCPRL-PNVQVLASERTCQAWKS-WDALPVRAVADGEWLELGPRRLQVIEAH--HSDDHVVFYDRRRLFCGDALGEFDEAEGVWRPLVFD--------------------EAYLESLERLQRLPLLQLIPGHGGLLRGR--LAADGAESAYTECLRLCRRLLWRQSMGESLDELSEELHRAWGGQSVDFLPGELHLGSMRRMLEILSR.............................................................................................. 309
11 -27.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  18  21..............................................TVYVMCGEKLTVMIDA----------NSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQV--YKAKVLVKSGFKKYLTS-LDQDKVIEVEGNEEFDLGGYRMRLIYTP--HARHHMSVLVDDFLFTGDSAGA------------------------YFNGVVIPTTPMYMESLKRQIELKPKVVGFAHGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS...................................................................................................................... 260
12 -26.3005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  15  14...........QAPFRLFGNTYYVGMKG-----------------LSSVLVTSPQGHVLIDGGLPESAPKIIANIGALFRIEDVKLILNSHGHIDHAGGLAELQRRS--NALVAASPSAALDLASYPPVKDMRLARDGGQFNVGPVYLTAHATP--HTPGGL-----SWTWQSCDGPRCLNMVYADSINAVSRPGFKFSASSEYPNALADL----RHSFETLEKLPCDVLISAHPEA---------QLWQRLEASATGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQQ.................................................................................................................. 271
13 -25.8001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  13  8...........FPPFRIAGNLYYVGTDD-----------------LASYLIVTPRGNILINSDLEANVPMIKASIKKLFKFSDTKILLISHAHFDHAAGSELIKQQT--KAKYMVMDEDVSVILSFTQSTVDKVLHDGERVELGGTVLTAHLTP--HTRGC-------TTWTMKLKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAEDY----KHSIKVLESMRCDIFLGSHAGM---------DLKNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQ..................................................................................................................... 260
14 -25.7001fln_A mol:protein length:138 FLAVODOXIN  ali model follow..  21  1.....................................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNI-------DELLNEDILILGCSAMGPEVLEESEEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVETPLIVQNEPDEA-EQDCIEFGKKIAN 137
15 -25.7003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  18  38...........FEPFQLIDNIYYVGTDG-----------------IAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLFKVADIKLILNTHAHLDHTGGFAEIKKET--GAQLVAGERDKPLLEGFPAVKVDRAVKEGDRVTLGDTTLTAHATP--HSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRLVGQPTYAGIVDDY------------RATFAKAKAMKIDVLLGPHPEV--------YGMQAKRAEMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQ..................................................................................................................... 287
16 -25.4003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  13  9...........QQPFTIYGNTHYVGTGG-----------------ISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMFKLSDVKYILSTHSHEDHAGGISAMQKLT--GATVLAGAANVDTLRTFPGSAKVRAVADGELVKLGPLAVKAHATP--HTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASL------------RGSFEAVEKLSCDIAIAAHPEV---------DMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASE..................................................................................................................... 260
17 -25.2004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  11  41...........AMPQKVYGNTWYVGTC-----------------GISALLVTSDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVLSHEHFDHAGSLAELQKAT--GAPVYARAPAIDTLKRVAPVANIVTLADDGVVSVGPLALTAVASP--HTPGGTSWTWRRQMVYADSLTAISDDVYRYSDDAAHPG----------------YLAAFRNTLARVAALDCDILVTPHP-----------SASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEE..................................................................................................................... 292
18 -25.1001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  16  21...........MAPLQIADHTWQIGTED-----------------LTALLVQTPDGAVLLDGGMPQMASHLLDNMKARVTPRDLRLILLSHAHADHAGPVAELKRRT--GAKVAANAESAVLLARYPPANADRIVMDGEVITVGGIVFTAHFMA--HTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDY------------RRSFATVRALPCDVLLTPHPGASNWDYAAGARAGAKALTCKAYADAAEQKFDGQLAKETAGAR.............................................................................................................................. 269
19 -25.0005aeb_A mol:protein length:272 LRA-12  ali model follow..  11  21...........YRPFRIAGNLYYIGT-----------------YDLACYLITTKQGNIIVNTGLAASALQIKNNIKALFKLTDTKILLTTQAHYDHLGAMAEIKKIT--GAKLMADEGDATVMADFEPIIADRLLHDKDTIQLGDTKLVMLHHP--HTKGSCSFLFDRILIANMPTIVIEKKFSEVSSYPGIAKDY-------------------AYTLQAMKNLSFDIWVASHA--------SQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN..................................................................................................................... 272
20 -24.8004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  11  41...........AMPLKVYGNTWYVGTC-----------------GISALLVTSDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVFSHEHFDHAGSLAELQKAT--GAPVYARAPAIDTLKRVAPVANIVTLADDGVVSVGPLALTAVASP--HTPGGTSWTWRRQMVYADSLTAISDDVFRYSDDAA------------HPGYLAAF----RNTLARVAALDCDILVTPHP-----------SASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEE..................................................................................................................... 292
21 -23.7002fax_A mol:protein length:138 FLAVODOXIN  ali model follow..  21  1.....................................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVN-------IDELLNEDILILGCSAMGDEVLEESEEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVETPLIVQNEPDEA-EQDCIEFGKKIAA 137
22 -21.6001fla_A mol:protein length:138 FLAVODOXIN  ali model follow..  21  1.....................................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVN-------IDELLNEDILILGCSAMDDEVLEESEEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVETPLIVQNEPDEA-EQDCIEFGKKIAN 137
23 -21.1002fz5_A mol:protein length:137 Flavodoxin  ali model follow..  15  2.....................................................................................................................................................................................................................................................................VEIVYWSGTGNTEAMANEIEAAVKAAGADVESVRFEDTN-------VDDVASKDVILLGCPAMGSEELEDSVEPFFTDLAPKLKGKKVGLFGSYGWGGEWMDAWKQRTEDTGATVIGTAIVNEM---PDNAPECKELGEAAAK 136
24 -20.7003kap_A mol:protein length:147 Flavodoxin  ali model follow..  11  1...................................................................................................................................................................................................................................................................SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLAD------GYDAVLMGCSAWGMELQDDFAPLFDEMENMGLKGKKLAAFASGDMECGAVPAIEEKARGLGAEVICEGLKIEGDASSD-PDAVSAFAEDVLK 145
25 -20.6003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  15  27.........................................KEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNK---GIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFYNVLDGGCLV--------------------KSNSATDLGYIKEANVEQWPKTINKLKAKKATLIIPGHDEW....................................................................................................................................................................... 203
26 -20.4001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  12  2...........VKIEKLKDNLYYTTYNTFN-----------TKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKI---GAKTYSTKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFEKVLVGGCII--------------------KSADSKDLGYIGEAYVNDWTQSVHNIQQKGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKASN............................................................................................................................................... 223
27 -20.3001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16  11...........ISITQLSDKVY--------TYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKK---GVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLENILFGGCML--------------------KDNQATSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSK................................................................................................................................................. 231
28 -20.2001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16  1.AQKSVKISDDISITQLSDKVY--------TYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRK---GVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLENILFGGCML--------------------KDNQTTSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGNYGGTELIEHTKQIVNQYIESTSK................................................................................................................................................. 231
29 -20.0002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  20  32.........................................EAVPSNGLVLNTSKGLVLVDSWDDKLTKELIEMVEKKFQ-KRVTDVIITHAHADHIGGIKTLKER---GIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLYNILVGGSLV--------------------KSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEV....................................................................................................................................................................... 208
30 -19.9002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  16  38.........................................EAVPSNGLVLNTSKGLVLVDSWDDKLTKELIEMVEKKFQ-KRVTDVIITHAHASRIGGIKTLKER---GIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLYNILVGGCLVKSTSAKDLGNVADAY----------------VNEWSTSIENVLKRY--RNINAVVPGHGEVGDKGLLLHTLDLLK......................................................................................................................................................... 228
31 -19.8003f6r_A mol:protein length:148 Flavodoxin  ali model follow..  16  2...................................................................................................................................................................................................................................................................SKVLIVFGSSTGNTESIAQKLEELIAAGGHEVTLLNAADASAENLAD------GYDAVLFGCSAWGMEMQDDFLSLFEEFDRIGLAGRKVAAFASGDQECGAVPAIEERAKELGATIIAEGLKMEGDASNDP-EAVASFAEDVLK 146
32 -19.4004heq_A mol:protein length:146 Flavodoxin  ali model follow..  17  2...................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEGVAEAIAKTLNSEGMETTVVNVADVTAPGLAE------GYDVVLLGCSTWGDDEIEDFVPLYEDLDRAGLKDKKVGVFGSYTYFCGAVDVIEKKAEELGATLVASSLKIDGEPDSAEVLDAREVLARV.. 146
33 -19.1002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  15  3...............ALLPGLYLLPV------------PIPYPLKTNLYLLQGAGEVALVDT-TRAARGALELHLAELLCFQDVKTILLTHHHPDHYGLSGFFEGL---GARVFLHEEEFARGHRFWREPEPLPLRDGEALEVAGKRLRVLWTP--HADGHAAFYLEGVLLAGDALLEKVSPNVGLWAYTRE-------------NPLKDF----LRSLDRLADLGARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALLDGPKTAWELSLHL................................................................................................................................ 275
34 -19.1003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  17  11...........ISISQLNKNVWHTELGSFN-----------EAVPSSGLVLNTSKGLVLVDSWDDKLTKELIEMVEKKFQ-KRVTDAIITHAHADRIGGIKTLKER---GIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLYNILVGGCLV--------------------KSTSAKDLGNVADAYVNEWSTSIENVSKRNINAVVPSHGEV....................................................................................................................................................................... 208
35 -19.0002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  17  2...........MKSLHRPDLYSWST------------FNPARNIDFNGFAWIRPEGNILIDP--VALSNHDWKHLESL---GGVVWIVLTNS--DHVRSAKEIADQT--YTKIAGPVAEKENFP----IYCDRWLSDGDELVPG---LKVMELQGSKTPELALLLEETTLITGDLVRAYRAGGLEILPDEKLMN------------------QKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKELVA......................................................................................................................................................... 198
36 -19.0004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  16  18...............................KIDSDVFVVTDRDFYSSVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKM---GAETWSSDLTKQLRLE---ADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFKKLLFGGCMI----KPKELGYLGDANVKAWP-------------------DSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMR.................................................................................................................................................. 249
37 -18.4005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  16  26...........VRLYQIADGVWHIATQSFDGAVYPS----------NGLIVRDGDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRKA---GVATYASPSTRRLAEAEGNEIPTHLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVANVLYGGCAV--------------------LALSRTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVAE................................................................................................................................................ 248
38 -18.3001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  16  27...........................................HFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELISPDDITDVLFTHVHLDHIFNSVLF-----ENATFYVHEVYKTIYSKVISSWKNVVLLKGEE-SLFDEKVKVFHTP--HAREHLSFLLDRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPLKPEVKK....................................................................................................................................................................................... 215
39 -18.1004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  21  31...........................................VPKHGLVVLVNAEAYLIDTFTAKDTEKLVTWFVER--GYKIKGSISSHFHSDSTGGIEWLNSR---SIPTYASELTNELLKKDGKVQATNSF-SGVNYWLVKNKIEVFYPGPGHTPDNVVVWLRKILFG----GGFIKPYGLGNLGDANIEAWP-------------------KSAKLLKSKKAKLVVPSHSEV....................................................................................................................................................................... 200
40 -17.9004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  14  7...........LRIEKVKENIF----------LHTSYSRVNGFVSSNGLVVIDKGNAFIVDTWSDRDTETLVHWIRKN--GYELLGSVSTHWHEDRTAGIKWLNDQ---SISTYATTSTNHLLKE--KKEPAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLSKILFGGCFVRSLDSEGLGYTGEAH----------------IDQWSRSAQNALSRYS--EAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQ................................................................................................................................................. 225
41 -17.8003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  14  1......MSEKNLTLTHFKGPLY--------------IVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTL---GAKIVATQMTYDLQKSQWGSIVNFTRQGNGDFNLQNGSIRAMYLGEAHTKDGIFVYFERVLYGNCIL-----KENLGNMSFANRTEYPKTLEK-------------LKGLIEQGELKVDSIIAGHDTPIHD.................................................................................................................................................................... 217
42 -17.8004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  19  32...........................................VSKHGLVVLVNTDAYLIDTFTATDTEKLVNWFVER--GYKIKGTISSHFHSDSTGGIEWLNSQ---SIPTYASELTNELLKK--GKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLKKILFG----GCFVKPDGLGNLGDANLEAWPKSAKIL-----------------MSKYVKAKLVVSSHSEI....................................................................................................................................................................... 201
43 -17.5003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  11  23...........LVFRQLAPNVW--------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTWTDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA---GIATYANALSNQLAPQ-LTFAANGWVEPATAPNFGPLKVFYPGP---HTSDNITVGITDIAFGGCLI-KDSKAKSLGNLGDADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRKLVPR................................................................................................................................................. 249
44 -17.4001akq_A mol:protein length:147 FLAVODOXIN  ali model follow..  13  1...................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFE------GFDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRG 145
45 -17.4003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  11  16...........LVFRQLAPNVW--------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTWTDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA---GIATYANALSNQLAPQ-LTFAANGWVEPATAPNFGPLKVFYPGP---HTSDNITVGITDIAFGGCLI-KDSKAKSLGNLGDADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR...................................................................................................................................................... 237
46 -17.4004tyf_A mol:protein length:231 NDM-4  ali model follow..  12  10...........LVFRQLAPNVW--------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA---GIATYANALSNQLAPQ-LTFAANGWVEPATAPNFGPLKVFYPGP---HTSDNITVGITDIAFGGCLI-KDSKAKSLGNLGDADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR...................................................................................................................................................... 231
47 -17.3004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  16  11...............RLSNRVVRVLGCNPGPMTLQGT---------NTYLVGTGPRRILIDTGEPA-IPEYISCLKQALTNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQRE--GEQQYVYLKDGDVIKTEGATLRVLYTP--HTDDHMALLLENAIFSGDCILGEGTT-------------VFEDLYDYMNS------------LKELLKIKADIIYPGHGPVIHNAEAKI----QQYISHRNIREQQILTLFRENFEKSFTVMELVKII----YKNTPENLHEMAKHNLLLHLKKLEKEGKIF...................................................................................... 276
48 -17.3002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  18  7...........LEVIKIEDGVY--------LHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK---SIPTYTSELTKKLLAREGKPVPTHYFKD-DEFTLGNGLIELYYPGAGHTEDNIVAWLSKILFGGCLVRSHEWEALGYVGDAS----------------ISSWADSIKNIVSKK--YPIQMVVPGHGKV....................................................................................................................................................................... 203
49 -17.3005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  11  22...........LVFRQLAPNVW--------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTWTDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA---GIATYANALSNQLAPQ-LTFAANGWVEPATAPNFGPLKVFYPGP---HTSDNITVGITDIAFGGCLI-KDSKAKSLGNLGDADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRLE.................................................................................................................................................... 245
50 -17.3004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  15  44...........VRLYQIADGVWHIATQSFDGAVYPS----------NGLIVRDGDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA---GVATYASPSTRRLAEAEGNEIPTHLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVANVLYGGCAV--------------------LELSSTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVAE................................................................................................................................................ 266
51 -17.2004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  12  22...........LVFRQLAPNVW--------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA---GIATYANALSNQLAPQ-LTFAANGWVEPATAPNFGPLKVFYPGP---HTSDNITVGITDIAFGGCLI-KDSKAKSLGNLGAADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR...................................................................................................................................................... 243
52 -17.2001f4p_A mol:protein length:147 FLAVODOXIN  ali model follow..  13  1...................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFE------GFDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCWEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRG 145
53 -17.1004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  11  25...........LVFRQLAPNVW--------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTWTDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA---GIATYANALSNQLAPQ-LTFAANGWVEPATAPNFGPLKVFYPGP---HTSDNITVGITDIAFGGCLI-KDSKAKSLGNLGDADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR...................................................................................................................................................... 246
54 -17.1002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  14  44...........VRLYQIADGVWHIATQSFDGAVYPS----------NGLIVRDGDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA---GVATYASPSTRRLAEVEGNEIPTHLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVASVLYGGCAIYELSRTSAGNVADADLAE---------------------PTSIERIQQHEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE................................................................................................................................................ 266
55 -16.9002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  15  43...........VRLYKIGDGVWHIATQKLG-----------TVYSSNGLIVRDADELLLIDTWGAKNTVALLAEIEKQIG-LPVTRSISTHFHDDRVGGVDVLRAA---GVATYTSPLTRQLAEA--AHSLKALSSSGDVVRFGPVEVFYPGA---HSGDNLVVYVVRVLFGGCAV--------------------HEASRESAGNVADANLAEWPATIKRIQQREAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVAE................................................................................................................................................ 265
56 -16.8001i1o_A mol:protein length:147 FLAVODOXIN  ali model follow..  14  2....................................................................................................................................................................................................................................................................KALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFE------GFDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCHEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRG 145
57 -16.6004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  11  49...........LVFRQLAPNVW--------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTWTDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA---GIATYANALSNQLAPQ-LTFAANGWVEPATAPNFGPLKVFYPGP---HTSDNITVGITDIAFGGCLI-KDSKAKSLGNLGDADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR...................................................................................................................................................... 270
58 -16.4005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  17  24...........LEVIKIEDGVY--------LHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK---SIPTYTSELTKKLLAREGKPVPTHYFKD-DEFTLGNGLIELYYPGAGHTEDNIVAWLSKILFGGCLVRSHEREGLGYVGDAS----------------ISSWADSIKNIVSKK--YPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQ................................................................................................................................................. 242
59 -16.4004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  16  66...........................................GGAEAALEEAARGPILVDTGGPWAREALLGALAGQVAPGDVTLVVGTHGHSDHIGNLGLF-----PGAALLVSHDFCLPGGRYLP----HGLGEGQPLRLGPG-LEVWATP--HGGQRDVSVVVAVVVAGDVFERDGDEDSWQALSEDPAA--------------------QERSRKRVLVV-ADVVVPGHGPPFR..................................................................................................................................................................... 236
60 -16.4001j9e_A mol:protein length:147 FLAVODOXIN  ali model follow..  13  2....................................................................................................................................................................................................................................................................KALIVYGSTTGNTEYTAETIARELADAGYEVDCRDAASVEAGGLFE------GFDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRG 145
61 -16.4001akr_A mol:protein length:147 FLAVODOXIN  ali model follow..  13  1...................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFE------GFDLVLLGCSTWADDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRG 145
62 -16.3001fx1_A mol:protein length:148 FLAVODOXIN  ali model follow..  13  2...................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARQLANAGYEVDSRDAASVEAGGLFE------GFDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRG 146
63 -16.0001wsb_A mol:protein length:148 FLAVODOXIN  ali model follow..  13  2...................................................................................................................................................................................................................................................................AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFE------GFDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAAR-DDIVGWAHDVRG 146
64 -15.0001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  14  3...........MSLTQVSGPVY--------------VVEDNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSI---GAKVVSTRQTRDLMKS---VLPNVVHDGDFTLQEGKVRAFYAGP---HTPDGIFVYFEQVLYGGCI-----LKEKLGNLSFADVKAYPQTLERL-----------------KAMKLPIKTVIGGHDSP....................................................................................................................................................................... 207
65 -14.9005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  12  23............DTFEVAPGVRWLRM------------PLPFSLDHNLWLLRGQAGWTIVDC-SEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHANWLCEGGDQGRWNVRLWMTLGEYMFGCLMAAGNRYRRLREGDAVKIGARTWRVVTGY--HSPEHCALHSDGVLISGDMVLPRISTNVSVFDLEPE------------ANPLALY----LESLGRYETMAPDLVLPSHGKPFRGVRTRIAQLRAH------HDARLEEVRVACAEKPMSAAGIVPIMFRRRELDIHQMTFA------LGEALAHL............................................................................................. 336
66 -13.8001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  13  1MSSGVDLGTENLYFQSNAMKMTVVG--------FWGGFPEAGEAT-SGYLFEHDGFRLLVD-----CGSGVLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLTKGQLPELPIYGHTFDENGFHSLTPHTKGIPYNPEETLQIGPFSISFLKTPVTCFAMRITAGNDIVVYSADS-----SYIPEFIPFTKDADLFICECN-MYAHQEAAKAGHMTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFS....................................................................................................................................................... 248
67 -13.5002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  20  11...........................................LQENAYLVETGEGPVLIDP--GDEPEKLLALFQT--TGLIPLAILLTHAHFDHVGAVAPLVEAL--DLPVYLHPLDLPLYEGAWGLAIPKPPLPVRPLEEGMRLFGFLHLP--HSPGHVAFYDGAQVFSGDLLGSVGRYD-----------------------LPGADPKALFASLKRLLSLPPETVHPGHGPGTTLGLEARTNPFLTGLEWEA................................................................................................................................................... 207
68 -13.5002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  16  41...........................................IPVSAYLIQCTDATVLYDTYIGASECNLPERLRQLLSPDDISTVVLSHLHNDHAGCVEYF-----GKSRLIAHEDEFATAVRYFATGDHLVGRDERERELAPGVNLLNFGT--HASGMLGLAVRGFLLVSDACYTATNYG-----PPARRAGVLHDTIGYDRTV---------SHIRQYAESRSLTVLFGHDREQFASLIKSTDGF........................................................................................................................................................... 274
69 -12.8003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  15  37...........................................LPVWCYLLETEEGPILVDTPKMTEEDRIVNILKRVYEPDDLLYIISSHLHFDHAGGNGAF-----TNTPIIVQRTEYEAALHILPHLNYKIIEGDYEVVPG---VQLLYTP--HSPGHQSLFIESVLLTIDASYTKENFEDEVPFAGFDPELALSSIKR----------------LKEVVKKEKPIIFFGHDI........................................................................................................................................................................ 241
70 -12.7002ark_A mol:protein length:188 Flavodoxin  ali model follow..  16  1...............................................................................................................................................................................................................................................................SNAMGKVLVIYDTRTGNTKKMAELVAEGARSEGTEVRLKHVDEAT-------KEDVLWADGLAVGSPTNMGLVSWKMKRFFDDVLG-EIDGKIACAFSSSG-GGNEVACMSILTMLMNFGFL-GAVVAGEPRSEEEKEACRRLGRRLAE 163
71 -12.7002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  15  35...........................................LPVWCYLLETEEGPILVDTPKMTEEDRIVNILKRVYEPDDLLYIISSHLHFDHAGGNGAF-----TNTPIIVQRTEYEYMKECILPHLNYKIIEGDYEVVPG--VQLLYTP--HSPGHQSLFIKSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKR----------------LKEVVKKEKPIIFFGHDI........................................................................................................................................................................ 239
72 -12.7003d7n_A mol:protein length:193 Flavodoxin, WrbA-like protein  ali model follow..  15  3...............................................................................................................................................................................................................................................................TNSSSNTVVVYHSGYGHTHRMAEAVAE-----GAEATLHAIDAEGNLSEDG-WAALDAADAIIFGTPTYMGGPSWQFKKFADASSKPKWQDKVFGGFNSASLNGDKLNTLQYLV................................... 115
73 -12.7002wyl_A mol:protein length:360 L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG  ali model follow..  13  39...................AMWWLG--------------------CTGIWLKSEGGTNVCVDFKQGHQMQRMAGVKKL-AIRQIDAVLATHDHNDHVNVAAAVMQNCADDVPFIGPKTCVDLWIGWVPKERCIVVKPGDVVKVKDIEIALITLPADQKPDGMDDRAVNYLFKTPGGSLYHSGDSHYS------NYYAKHGNEHQIDVLGSYGENSADMLRMGEALNAKVVIPFH--------------HDIWSNFQADPQEIRVLWEM---KKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRGFDDCFTIE......................................................................................... 345
74 -12.5003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  16  33...........................................FPVYSILIEHAEGRFLIDTPIQEKHQTIPGALGLLLEPRDIDVVVNSHFHFDHCGGNKYF-----PHAKKICHRSEVPLLEGTTRANSTFEGIDGDVDLARG--VKLISTP--HSIGHYSLLVEPILFTIDAAYTQKSLE------TLCQAAFHIDPVAGVNSM---------RKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFY........................................................................................................................................................... 267
75 -12.2002dkf_A mol:protein length:431 metallo-beta-lactamase superfamily protein  ali model follow..  17  12...........................................VTGSAHLLLAGGRRVLLDCGMFQGKEEARNHAPFGFDPKEVDAVLLTHAHLDHVGRLPKLFREGYRG-PVYATRATVLLMEPFFGPEDLRPLEYGEWLRLGALSLAFGQAGHLPGSAFVVAQGETLVYSGD-LGNREKDVLPDPSLPPLADLVLAEGT--YGD-YRETVREFLEILEKTLSQGGKVLIPTFAVERAQEILYVLYTHGHRLPRAP-DSPMAGRVLSLYPRLVRYFSEEVQAHFLQGKNPFRPALEVVEHTEASKALNRAPGPMVVLAGSGMLAGG------RILHHLKHGLSDPRNALVFVGYQPQGGLGAEIIARPPAVRI.............................. 360

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 3 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]