current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1x8h_A mol:protein length:228 Beta-lactamase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst AGMSLTQVSGPVYVVEDNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEKLGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPLHGPELIDHYEALIKAAPQSSLast
1 -100.0001x8h_A mol:protein length:228 Beta-lactamase  ali model  100  1AGMSLTQVSGPVYVVEDNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEKLGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPLHGPELIDHYEALIKAAPQSS 228
2 -93.9003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  59  4KNLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAPK.. 233
3 -84.7004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  21  20GDLVFRQLAPNVWQHPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGAADTEHYAASARAFGAAFPKASMIVMSHSAP-DSRAAITHTARMADKLR... 243
4 -84.7004tyf_A mol:protein length:231 NDM-4  ali model follow..  21  8GDLVFRQLAPNVWQHPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAAQ----------HSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP-DSRAAITHTARMADKLR... 231
5 -84.7003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  21  14GDLVFRQLAPNVWQHPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP-DSRAAITHTARMADKLR... 237
6 -84.4005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  21  20GDLVFRQLAPNVWQHPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP-DSRAAITHTARMADKLRLE. 245
7 -84.2004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  21  23GDLVFRQLAPNVWQHPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP-DSRAAITHTARMADKLR... 246
8 -83.0003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  21  21GDLVFRQLAPNVWQHPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP-DSRAAITHTARMADKLRKLV 247
9 -81.7005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  25  24GEVRLYQIADGVWSHIDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNE--------------IPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLP-GGLDLLQHTANVVTAHKNRS 245
10 -81.2004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  21  47GDLVFRQLAPNVWQHPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQ----------HSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP-DSRAAITHTARMADKLRL.. 271
11 -80.7001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  27  1.DVKIEKLKDNLYVYTNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKEN------------------KPRAQYTFDNNKSFKVGKFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSALGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDW-KDQRSIQHTLDLINEYQQKQ 219
12 -79.9001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  27  9DDISITQLSDKVYTYEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKG------------------LPVPEHGFTDSLTVSLDGLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDY-GGTELIEHTKQIVNQYIEST 229
13 -79.9001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  27  9DDISITQLSDKVYTYEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKG------------------LPVPEHGFTDSLTVSLDGLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNY-GGTELIEHTKQIVNQYIEST 229
14 -79.8002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  28  9GTISISQLNKNVWVHTNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNG------------------YEEPLGDLQTVTNLKFGNVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEV-GDKGLLLHTLDLLK...... 222
15 -79.8002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  26  42GEVRLYQIADGVWSHIDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNE--------------IPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLP-GGLDLLKHTTNVVKAHTNRS 263
16 -79.8002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  28  15GTISISQLNKNVWVHTNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNG------------------YEEPLGDLQTVTNLKFGNVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEV-GDKGLLLHTLDLLK...... 228
17 -79.8003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  25  4DFVIEPPIKNNLHIYKGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGK------------------ATSTEIIKTGKPYRIGGFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEW-KGGGHVEHTLELLN...... 217
18 -79.7003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  28  9GTISISQLNKNVWVHTNGEAVPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNG------------------YEEPLGDLQTVTNLKFGNVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEV-GDKGLLLHTLDLLK...... 222
19 -79.5004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  26  42GEVRLYQIADGVWSHIDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNE--------------IPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLP-GGLDLLQHTANVVKAHKNRS 263
20 -78.9004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  27  13.NLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKLSSHPVPADNVFDLKQGKVFSFSNVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKLGYLGDANVKAWPDSARRLKK--FDAKIVIPGHGEW-GGPEMVNKTIKVAEKAVGEM 248
21 -78.7002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  24  41GEVRLYKIGDGVWSHIGDTVYSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNE--------------VPAHSLKALSSSGDVVRFGPVEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEAAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLP-GGLELLQHTTNVVKTHKVRP 262
22 -76.1004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  22  6PDLKIEKLEEGVYVHTGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVE-RGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDG------------------KVQAKNSFSGSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDLGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHSEI-GDASLLKRTWEQAVKGLNES 221
23 -75.3004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  22  5PDLKIEKLDEGVYVHTGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVE-RGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDG------------------KVQATNSFSGNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEV-GDASLLKLTLEQAVKGLNES 220
24 -75.3002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  21  5KPLEVIKIEDGVYLHTGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREG------------------KPVPTHYFKDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGK-VGSSDILDHTIDLAESASNKL 223
25 -74.5004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  20  5PELRIEKVKENIFLHTSFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRK-NGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKE-------------------PAKYTLKGNESTLVDIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGK-IGDIALLKHTKSLAETASNKS 223
26 -73.6005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  21  22KPLEVIKIEDGVYLHTGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREG------------------KPVPTHYFKDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKV-GSSDILDHTIDLAESASNKL 240
27 -33.9002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  20  2GSSSSGLVPRGSHMLR-GDVQVPVFLLRLGEASWALVEGGISRD-AELVWADLCRADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAVRVVERLNRQLLRAEQRLALPVRAVADGEWLELGPLQVIE-AHGHSDDHVVFYDVRRRRLFCGDALEGVWRPLVFDDMEAYLESLERLQRLP-TLLQLIPGHGGLLRGRLAADGAESAYTECLRLC 259
28 -33.6001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  14  19QPMAPLQIADHTWQI---GTEDLTALLVQTPDGAVLLDGG-MPQMASHLLDNMKARTPRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSDDLHF-----GDGITYPPANADRIVMDGEVITVGGIVFAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGHLIEDYRRSFATVRA--LPCDVLLTPHPGASNWDY................ 233
29 -33.2001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  12  6NPFPPFRIAGNLYYV---GTDDLASYLIVTPRGNILINSD-LEANVPMIKASIKKLKFSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKSDFHYANDSSTYFTQST---VDKVLHDGERVELGGTVLAHLTPGHTRGCTTWTMKLKDAVIIGSIGVNPGYKLVDKIAEDYKHSIKVLES--MRCDIFLGSHAGMFDLKNKYVLLSK......... 230
30 -32.5003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  16  36APFEPFQLIDNIYYV---GTDGIAVYVIKTSQGLILMDTA-MPQSTGMIKDNIAKLKVADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYPGDEKNEDL-----AFPAVKVDRAVKEGDRVTLGDTTLAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVAAGIVDDYRATFAKAKA--MKIDVLLGPHPEVYGMQAKRAEMKD......... 257
31 -32.3003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  15  7SPQQPFTIYGNTHYV---GTGGISAVLLSSPQGHILVDGT-TEKGAQVVAANIRAMKLSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPKSD---PQFGSLSNFPGSAKVRAVADGELVKLGPLAVAHATPGHTEGGITWTWQSCEVVFADSLTAVSADSYRFSDVASLRGSFEAVEK--LSCDIAIAAHPEVNDMWTRQQRAAK......... 230
32 -31.6002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  18  9..................GPLQENAYLVETGEGPVLIDPGDE---PEKLLALFQT-TGLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLAARAW------GLAIPKPPLPVRPLEEGMRL---GFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGRYDLPGADPKALFASLKRLLSL-PPETRVHPGHGPGTTLGL--ARTNPFLTGLEWEA 207
33 -31.6005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  18  12ADQAPFRLFGNTYYV---GMKGLSSVLVTSPQGHVLIDGG-LPESAPKIIANIGALRIEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVGPDDPQYHALPKYPPVK---DMRLARDGGQFNVGPVYLAHATPGHTPGGLSWTWQSCDMVYADSINAVSRPGFKPNALADLRHSFETLEK--LPCDVLISAHPEASQLWQRLEASAT......... 238
34 -31.4004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  19  39DPAMPQKVYGNTWYV---GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALGFRPVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVAN---IVTLADDGVVSVGPLALAVASPGHTPGGTSWTWRSCEMVYADSLTAISDDVYRYSDLAAFRNTLARVAA--LDCDILVTPHPSASGLWNRIG............. 261
35 -31.3005aeb_A mol:protein length:272 LRA-12  ali model follow..  17  19KPYRPFRIAGNLYYI---GTYDLACYLITTKQGNIIVNTGLAAS-ALQIKNNIKALGFKLTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSSDYAFG----GHGSMFEPIIADRLLHDKDTIQLGDTKLMLHHPGHTKGSCSFLFDTKRILIANMPTIVIEKKFSEGIAKDYAYTLQAMKN--LSFDIWVASHASQFSMHSKHKPGDG......... 242
36 -31.0004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  18  39DPAMPLKVYGNTWYV---GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALRPEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVA---NIVTLADDGVVSVGPLALAVASPGHTPGGTSWTWRSCEMVYADSLTAISDDVFRYSDLAAFRNTLARVAA--LDCDILVTPHPSASGLWNRIG............. 261
37 -30.3002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  18  1....MKALLPGLYLLPPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHLALCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHRPEGALQGIRETVEKTRERVHPPQNPLPLRDGEALEVAGKRLVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSP-RENPLKDFLRSLDRLAD--LGARVAYAGHFGPIADEELKAHHQARLEALLALL 262
38 -29.4003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  16  20......................ATVYVMCGEKLTVMIDAGVSNSIADFSFL-------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDESAEKVLGDLYYVYGGLEKKLDQIEVEGNEEFDLGGYRMLIYTPGHARHHMSVLV--DDFLFTGDSAVVIPTTPPVIDYKMYMESLKRQIE--LKPKVVGFAHGGLVSPKIMEEHLKQMLSKEE... 228
39 -29.2001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  15  7MELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSS-MDELEEKFSELGISPITDVLFTHVHLDHIFNSVLFE--NATFYVHEVYKTKNYLSFGTIVGRIYS-----KVISSWKNVVLLKGEESLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRLSYY-DIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPL.................... 209
40 -28.3002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  11  6.......HRPDLYTFNPARNIDFNGFAWIRPEGNILIDPV---ALSNHDWKHLESLGG--VVWIVLTN--SDHVRSAKEIADQYTKIAGPVAEKENFPIY----------------------CDRWLSDGDELVPG-LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYLPDEKLMNKQKVVASVRRLAALE-KVEAVLVGDGWSVF-RDGRDRLKELVATL.... 200
41 -25.5002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  14  47..........................LIQCTDATVLYDTGCHPECMCNLPERLRQLGLSPISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEATAVRYFATGDHSSPYIVKDIEAWLATPRNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVRLEKFLLVSDACYPARRAGVLHDTIGYDRTVSHIRQYAESRSLVLFGHDR...................... 261
42 -25.1004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  13  8...RVERLSNRVVRVLGCN---TNTYLVGTGPRRILIDTGEIPEYISCLKQALTE-FNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQ------------QYVYLKDGDVIKTEGATLRVL-PGHTDDHMALLLEEENAIFSGDCIL-GEGTTVFEDLYDYMNSLKELLKI--KADIIYPGHGPVIHNAEAKIREQQILTLFRENF 233
43 -24.8002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  13  11....................FSQNCSLIWCEQTAALVDPGGD---AEKIKQEVDA-SGVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQGLPAQSRMF-----GLDECQPLTPDRWLNDGDRVSVGNVTLVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGRSDFPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLST................... 197
44 -24.5004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  15  68......................AEAALEEAARGPILVDTGGPWA-REALLGALAGQGVAPVTLVVGTHGHSDHIGNLGLFP--GAALLVSHDFCLPGGRYLPH--------------------GLGEGQPLRLGPG-LEVWAT-PGHGGQRDVSVVVAGTVVVAGDVFERDSWQALSEDPAAQERSRKRVLVV---ADVVVPGHGPPF.................... 235
45 -23.8005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  18  23...DTFEVAPGVRWLR-------NLWLL-GQAGWTIVDCGISSEAIRTHWEQIRHLDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTAAAADHFARHGPAALDKLRSRRSYYSDLVPAVPPRRLREGDAVKIGART-VVTGYGHSPEHCALHSEADGVLISGDMVLPRISTNVSNPLALYLESLGRYETMAPD-TLVLPSHGKPFRGAQLRAHHDARLEEVRVA. 299
46 -23.4003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  18  43..........................LLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLN-----------KIIEGDYEV-VPGVQLLYT-PGHSPGHQSLFIETEQVLLTIDASYEDEVPFAGFDPELALSSIKRLKEVVKKEKIIFFGHDIEQ---KSCRVFPEYI....... 254
47 -23.4002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  18  41..........................LLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLN-----------KIIEGDYEV-VPGVQLLYT-PGHSPGHQSLFIKTEQVLLTIDASYEDEVPFAGFDPELALSSIKRLKEVVKKEKIIFFGHDIEQ---KSCRVFPEYI....... 252
48 -22.8003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  14  2SDTKVYLLDGGSLVLDGYH-FPVYSILIEHAEGRFLIDTGYDYEKHQTIPGALGLLGLEPIDVVVNSHFHFDHCGGNKYFP--HAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATEGIDGDVDL-ARGVKLIST-PGHSIGHYSLLVEFPRILFTIDAAYTLCQAAFHIDPVAGVNSMRKVKKLAEDHGALMYSHDM...................... 254
49 -22.3001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  20  10.....................KDNYAYILHDEDVGVVDPSEAEPIIDSL-----KRSGRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAMDKDRIPGIDMALKD---------------------GDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSSCGKLFEGTPKQMLASLQKITSL-PDDTSIYCGHEYTLSNSK................ 177
50 -21.5001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  18  10.....................TDNYMYLVIDDEAAIVD----PVQPQKVVDAARK-HGVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGGDDRIGAL--------------------------THKITHLSTLQVGSLNVKCLAPCHTSGHICYFVSEPPAVFTGDTLFVGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREK. 196
51 -21.3002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  11  32.....................KDNFSYLINDHTLAAVDVNAD---YKPILTYIEEHLKQTFSTILSTHKHWDHSGGN-----------------AKLKAELEAMNSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDPCHTRGHVLYKVQHPQALFTGDTMFIGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFSEKTFPDR 237
52 -21.1004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  13  8.DVQVLPIATNTKEYALERGTTSNS-YVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRAAFPD-----------------NLNILPMRGKETLDLGKLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFHICGDDVFDDNWESFKEDQRYYKISDLQVRLYAVGHGPLVRTIALTQAYADWSKAQKLE. 256
53 -20.0004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  15  17.....................SCTFTYLLGDREAVLIDPV---ETAPRDAQLIKEL-GLRLLYAVNTHCHADHITGSGLLRSLGCQSVISRLSGAQA--------------------------DLHIEDGDSIRFGRFALETRAPGHTPGCVTFVLNDHSMAFTGDALL-GRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTL........ 195
54 -18.9004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  40...ELKTILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGFSAITDIFLSHAHPDHIGGKLVFPNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQNILIQPKLKFYDLNKTLYQLAPGHTPGLTVTTISSEKLMYVADLIHSDVILFPDTDLDIATASRKKFLKQLADTKARAPGLGFTKVKAPGFE............. 286
55 -18.4004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  14  11.....................SSTYTYLIGDRQAVLIDPVLE--QVDRDLQMVAEL-DLTLTHVFDTHVHADHITASGALRERQATVVGSVNGASCA--------------------------NVQVRHGDEVRVGQLVFQVL-PGHTDDSISYLLGDR--VFTGDALLNGRTDFQNGNASQLYDSLTRVLFTLPDETLVYPGHDYKGRTVTSIAEEKRHNPRVAGKS 194
56 -18.1003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  4GDISIHYLNGGNTKMDGGA-LPTHPILIQTAQYNLIIDAGIGNGKESHIIADLANLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPG-IKMQHSG-GHSFGHTIITIESDKAVHMGDIFPT-VTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGENI........ 267
57 -18.1001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  14  53GDFEITALSDGTVFQKAPLETSVTGYLVNTGSKLVLVDTGAAGLFGPRLAANLKAAGYQPVDEIYITHMHPDHVGGLMVGEQLNAVVRADQKEADFWLSQTNLDKAPDDESKGFFKGAMASLNPYVKAGKFKPFSGNTDLVLASHGHTPGHTTYVVESQKLALLGDLILVAAVQFDDSDSKSVAVERKKAFADAAKGGYLIPGIGHIRAEGKGYRFVPVNYSVVNPK. 331
58 -18.0004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  13  69...DLQSLLARMFVASEKGVQTANAYLINTGDNLVLIDTGAAQCFGPVVQTNLKASGYQPVDTVLLTHLHPDHACG--LVNADGSPAYPNATVEVPQAEDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGELLVASSGHTPGHTSYLFKSQSLLVWGDILINHAVQFADVDSDQARQSRQRILAEAATDKLWVPGLGHVREEAQGYAWVPVEFSPIRSDR 324
59 -17.9004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  13  69...DLQSLLARMFVASEKGVQTANAYLINTGDNLVLIDTGAAQCFGPVVQTNLKASGYQPVDTVLLTHLHPDHACG--LVNADGSPAYPNATVEVPQAEDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEGELLVASPGHTPGHTSYLFKSQSLLVWGDILLNHAVQFADVDSDQARQSRQRILAEAATDKLWVPGLGHVRKEAQGYAWVPVEFSPIRSD. 323
60 -17.9002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  11  13.....................SSTFTYLLADKPALLIDP----KTVDRDLKLIDEL-GLKLIYAMNTHVHADHVTGTGLLKTKGVKSVISKASGSKA--------------------------DLFLEPGDKVSIGDIYLEVRAPGHTAGCVTYVTPQPRMAFTGDAVL-GRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHDYKGFEVSTVGEEMQHNPRLTKDK 207
61 -17.7001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  13  1..MQATKIIDGFHYTLSPMGTTYNA-YLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESH--------------FHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVIFRGADQCTFAVQKYVEYAE.. 248
62 -17.6004nur_A mol:protein length:633 PSdsA  ali model follow..  17  89....LFEVTDGIYQVRN----LSNMTIVEGKDGITIFDPLISQETAKAALDLYYKRPKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAENVMAGTAMSRTTTSAGTVTLIPPTDIIKETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTLHNTYS-DPLAWSKYLEALKLWGDDVQVMYAMHHWPVWGNKQLSLQRDMYRYINDET 354
63 -17.6002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  12  2.KAAAKRISDGVYWTGVLQGTTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREAEFMTVKT-------------GDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFYANLITPLSKLVLKKFDEVKEL-GLLERIQMIAPSHGQIWTDPKIIEAYTGWATGMVDER 258
64 -17.5002cfu_A mol:protein length:658 SDSA1  ali model follow..  17  107....LFEVAEGIYQVRG----LANITFIRGDSGWIVVDTLTTPATARAAYELVSRLGERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKENVLAGNAMMRRATARGPLSLLAPTRLIEEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTLHNLYT-DALGWSKYIQALHRFGRQAEVMFAVHNWPRWGNAVLEKQRDLYGYLHDQT 372
65 -17.4004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  20  89....LFKVTDKMYQVRG----ISNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQRPQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISENVLAGNIMSRRALATGDPSIIAPTKTIVEKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENATHTLHNFYT-DTSKWTEYLETLDMWGNDAEVLFMPHTWPVWGNKYIGKYRDTIKYIHDQT 354
66 -17.4004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  10  3.....IVVKNNIHEYKTLRGSSYNS-YLIREEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPEWNF--------------------NVVKTGDTLDIGNLIFVETPMLHWPDSMMTYLTGDAVLFSNDACQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDTQIVELYLKWAADYQEDR 249
67 -17.3002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  20  117....LFEVMPKLYQVRG----PANMTIIEGDSGLVLIDTLTTAETARAALDLYFQRPKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSENAQVDSGLFKTTATNATNTLVAPNVLIEERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPAMHNLLT-DAKAWAGYIASLEKYGDRTDVLIQQHNWPVWGGDYLADQRDMYAFLNNRA 383
68 -17.1001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  15  2...QPVAITDGIYAFSTHRGTTYNA-YLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKAH--------------YSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKGRIIEAYARWAEGQGKAK 253
69 -16.9004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  13  38...QVHEILKKYYADQEKGVQTSNAFLVNIGKSLILIDSGAASCFGSSVLSNLKASGYQPVDTILLTHLHPDHVCG---ISKDGVANFPNATVYVSNDEASFWLDPKQAAKLPKEKQANYLGTVEKIKQAIAPYQAKQRFKTYKAGHTPGHFSYELKTESIVFIGDIVHSHTVQFDDIDPKKAVETRLKQFANFAKNGQTIPGIGHT..................... 274
70 -16.7002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  12  8..VQDQEMIPGVY-YHTDEGSSYNS-YFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKI---------------YGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGVMHLFKEYTANILGLFSAQMRKAVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQH 254
71 -15.0001vme_A mol:protein length:410 Flavoprotein  ali model follow..  14  12..TERIFDDPEIYVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEG---------------------IKDVTVVKDGEEREIGGKKFKFVMT-HWPDTMVTYL--DGILFSCDVLPEILDDSNESVVERYLPHVTKYKLSSLKIKALLPGHGLI..................... 237
72 -14.7003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  16  1........SNAMYLRRFYDEGLAHASYLVGCQEACVID----PARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAICVSDEGPPEWKSEYVK-----------------AYPHRLLKDGDELHFGNVRIVVM-PGHTPEHVSYLLYDGKALFSGDFVFAGESGSSEALARQMFRSLRKFEAL-PDHVQVLPAHGA...................... 201
73 -14.2002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  3.....SKAKTTVTFHSGILTIGGTVIEVAYKDAHIFFDFGTETLINNRLVPELKDLYDPRLGYVFLSHAHLDHS-RMINYLDPAVPLYTLKETKMILNSLNRKGDFLIPS---PFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDAYGLLIRTPDHFITYTGDLRLHGHNR---EETLAFCEKAKHTELLMMEGVSISFPEREPDPAQIAVVSEEDLVQHLVRLE 248
74 -14.1003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  13  16........SNAMFFKQFYDKHLSQASYLIGCQKAMIID----PIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDD------------------TLGYKNMPNHTHFVQHNDDIYVGNIKLKVL-PGHTPESISFLLTDEGGLFSGDFIFVGVEGSSEIGAKQMFKSIESIKDL-PDYIQIWPGHGA...................... 215
75 -13.2002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  12  5GSVEVQVLIENVVFARNFVAEHGLSLLLKKGNKEIVVDTGQSENFIKNCGLM--GIDVGRIKKVVLTHGHYDHIGGLKGLLERNVKIYTHKEILSFYEKYKNNFVEFTTKNFFVEKEGKRIPDKFLDEVFVVVKEEDGINVVTGCSHA--GILNILETARNRFGVSYIKSLIGHLRGMEEEKVKDIARKIEEY--GVKKVLTGHCTGIDEYGFLKSV........... 262

FFAS is supported by the NIH grant R01-GM087218-01
1 1 8 0 3 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.