current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1ycf_A mol:protein length:398 Nitric oxide reductase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .
# Score Template Links and tools%idFirst SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIADLast
1 -133.0001ycf_A mol:protein length:398 Nitric oxide reductase  ali model  100  1SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD 398
2 -126.0001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  41  2.QATKIIDGFHLVGAIDWNSRDFHG-YTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVIFRDQCTFAVQKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVKLMWCKACHHSQIMSEISDAGAVIVGSPTHNNGILPYVAGTLQYIKGLRPQNKIGGAFGSFGWSGESTKVLAEWLTGMGFDMPATP-VKVKNVPTHADYEQLKTMAQTIARALKA 398
3 -118.0002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  37  9.QDQEMIPGVYWVGIVDWMVRIFHG--YHTDEGSSYNSYFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANILGLFSAQMRKALEVAS--TVEIKYILSAHGVSWRGDMGLAIAEYDRWSKGQHQKKVTVVLDSMYGTTHRMALALLDGARSTGCETVLLEMTSSDITKVALHTYDSGAVAFASPTLNNTMMPSVAAALNYVRGLTLKGKPAFAFGAFGWSNRAVPDIVAELRDCKADVYDEKGITFKFNYTEELLEQAYNAGVDLGKRAIA 405
4 -114.0004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  40  2..SIVVKNNIHWVGQRDWEVRDFHGTEYKTLRGSSYNSYLIREEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGPE----WNFNVVKTGDTLDIGNKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQEDRITIFYDTMSNNTRMMADAIAQGIAETDVAVKIFNVARSDKNEILTNVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRFRNKRASAFGSHGWSGGAVDRLSTRLQDAGFEMS--LSLKAKWRPDQDALKLCREHGREIARQWAL 394
5 -114.0002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  41  4.AAKRISDGVYWTGVLDWDLRNYHGY---TLQGTTYNAYLVCDEGVALIDNSYPGTFDELMARVEDAVGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLKHYPLREAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKFYANLITPLSKLVLKKFDEVKELGLRIQMIAPSHGQIWT-DPMKIIEAYTGWATGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSEGVDVRVYCLHEDDRSEIVKDILESGAIALGAPTIYDEPYPSVGDLLMYLRGLRTLTRKALVFGSMGGNGGATGTMKELLAEAGFDVA--CEEEVYYVPTGDELDACFEAGRKLAAEIRR 404
6 -100.0001vme_A mol:protein length:410 Flavoprotein  ali model follow..  26  13.ERIFDDPEIYVLRIDDDRIRYFEA-VWEIPEGISYNAYLVKNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIHDVEIIASNFGKRLLEGFYGIK--DVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGGGYLLPEILDSNESVVERYLPHVTKYIVTVIGHYKNYILEGAEKLS--SLKIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPKKKVTVIYDSMYGFVENVMKKAIDSLKEKGFTYKFSDEERPAISEILKDIPDSEALIFGVSTYEAEIHPLMRFTLLEIIDKANYEKPVLVFGVHGWAPSAERTAGELLKETKFRIL-SFTEIKGSNMDERKIEEAISLLKKELE.... 404
7 -89.2004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  27  10.QVLPIATNTKVLRARSWSRLRFEI-EYALERGTTSNSYVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAGDLRAAFPDDNLNILPMRGKETLDLGKHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDNWE--SFKEDQRYYFNCLMAPHAIHVEAALEKIS--DLQVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLE.................................................................................................................................................. 256
8 -47.1003hly_A mol:protein length:161 Flavodoxin-like domain  ali model follow..  19  2............................................................................................................................................................................................................................................................SVLIGYLSDYGYSDRLSQAIGRGLVKTGVAVEMVDLRAVDPQELIEAVSSARGIVLGTPPSQPS--EAVATALSTIFAAAHNKQAIGLFDSYGGDDEPIDALLAQFRNLGLHTAFPP-IRVKDQPTEAIYQQCEESGTDLGQWLTR 144
9 -46.0003fni_A mol:protein length:159 Putative diflavin flavoprotein A 3  ali model follow..  12  2........................................................................................................................................................................................................................................................KAETSIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAVDLQELRELVGRCTGLVIGMSPAASA--ASIQGALSTILGSVNEKQAVGIFETGGGDDEPIDPLLSKFRNLGLTTAFPA-IRIKQTPTENTYKLCEEAGTDLGQWVTR 149
10 -30.9002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  17  4SSSGLVPRGSHMLGQLDDDLCLLGD--------VQVPVFLLREASWALVEGGISRDAELVWADLCRWADPSQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAWKEACAWDALPVRAVADGEWLELGPRRLQVIEAH--HSDDHVVFYDVRRRRLFCGDALGEFDEAEGVWRPLVFDDM-----------------EAYLESLERLQRLP-TLLQLIPGHGGLLRGRLAA--GAESAYTECLRLCRRLLWRQSMGESLDELSEELHRAWGGQSVDFLPGELHLGSMRRMLEILSRQA.............................................................................................. 311
11 -29.3001fln_A mol:protein length:138 FLAVODOXIN  ali model follow..  25  1.............................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLN----EDILILGCSAMGPEVLESEFEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVET-PLIVQNEP-DEAEQDCIEFGKKIAN.... 137
12 -26.0002fax_A mol:protein length:138 FLAVODOXIN  ali model follow..  26  1.............................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELL----NEDILILGCSAMGDEVLEESEEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVET-PLIVQNEP-DEAEQDCIEFGKKIAA.... 137
13 -23.3004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  16  42.MPQKVYGNTWYVGT------------------CGISALLVTDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVLSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRT-NIVTLADDGVVSVGPLALTAVASP--HTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARV-----------------AALDCDILVTPHPSASGLW-----------RIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEE....................................................................................................................... 292
14 -23.1001fla_A mol:protein length:138 FLAVODOXIN  ali model follow..  27  1.............................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNID----ELLNEDILILGCSAMDDEVLEEFEPFIEEIST-KISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVET-PLIVQNEP-DEAEQDCIEFGKKIAN.... 137
15 -22.9002fz5_A mol:protein length:137 Flavodoxin  ali model follow..  24  2.............................................................................................................................................................................................................................................................VEIVYWSGTGNTEAMANEIEAAVKAAGADVESVRFEDTNVD----DVASKDVILLGCPAMGSEELEDVEPFFTDLAP-KLKGKKVGLFGSYGWGGEWMDAWKQRTEDTGATVIGTAIV----NEMPDNAPECKELGEAAAKA... 137
16 -22.8004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  18  42.MPLKVYGNTWYVGT------------------CGISALLVTDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVFSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRT-NIVTLADDGVVSVGPLALTAVASP--HTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARV-----------------AALDCDILVTPHP.......................................................................................................................................................................... 251
17 -22.5003kap_A mol:protein length:147 Flavodoxin  ali model follow..  21  1...........................................................................................................................................................................................................................................................SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLADG---YDAVLMGCSAWGMELQDDFAPLFDEMENMGLKGKKLAAFASGDMECGAVPAIEEKARGLGAEVICE-GLKIEGDASSDP-DAVSAFAEDVLKKL.. 147
18 -22.5003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  17  10.QPFTIYGNTHYVGT------------------GGISAVLLSPQGHILVDGTTEKGAQVVAANIRAMFKLSDVKYILSTHSHEDHAGGISAMQKLT-GATVLAGAANVDTLRTGVSPKSDPQRAVADGELVKLGPLAVKAHATP--HTEGGITWTWQSCEQGKCKDV---------VFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEK------LSCDIAIAAHP-----EVNDMWTRQQRAAKEGNSA--YVDNGACRAIAAAGRKRLETRLASE....................................................................................................................... 260
19 -22.4005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  13  15.APFRLFGNTYYVGMKG------------------LSSVLVTPQGHVLIDGGLPESAPKIIANIGALFRIEDVKLILNSHGHIDHAGGLAELQRRS-NALVAASPSAALDLASGEVGPDDP-RLARDGGQFNVGPVYLTAHATP--HTPGGLSWTWQSCD-MVYADSINAVSRPGFKFSASSEYPNALADLRHSFETL-----------------EKLPCDVLISAHP-----EASQLWQRLEASATGGSDA--FVDPQACRAYVAAARTLLDSRLDQEKQQ.................................................................................................................... 271
20 -22.1001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  16  22.APLQIADHTWQIGTED------------------LTALLVQPDGAVLLDGGMPQMASHLLDNMKARVTPRDLRLILLSHAHADHAGPVAELKRRT-GAKVAANAESAVLLARGGSDDL---RIVMDGEVITVGGIVFTAHFMA--HTPGSTAWTWTDTRNGKPVRI---------AYADSLSAPGYQLQGNPRYPHLIEDY----RRSFATVRA--LPCDVLLTPHPGASNWDYAAGARAGAK--------------LTCKAYADAAEQKFDGQLAKETAGAR.................................................................................................................. 269
21 -21.7003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  18  21....................................TVYVMCGEKTVMIDA----------NSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQV-YKAKVLVKSGFKKYLTSEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTP--HARHHMSVLV--DDFLFTGDSAGA-----------------------YFNGVVIPTTPMYMESLKRQ--IELKPKVVGFAHGLVSPKIMEEHLKQMLSKEE------IQINVDIGGVAGEILRKQIEVNLRG........................................................................................................................ 253
22 -21.6003f6r_A mol:protein length:148 Flavodoxin  ali model follow..  20  2...........................................................................................................................................................................................................................................................SKVLIVFGSSTGNTESIAQKLEELIAAGGHEVTLLNAADASAENLADG---YDAVLFGCSAWGMEMQDDFLSLFEEFDRIGLAGRKVAAFASGDQECGAVPAIEERAKELGATIIAE-GLKMEGDASNDP-EAVASFAEDVLKQL.. 148
23 -21.6003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  16  39.EPFQLIDNIYYVGT------------------DGIAVYVIKSQGLILMDTAMPQSTGMIKDNIAKLFKVADIKLILNTHAHLDHTGGFAEIKKET-GAQLVAGERDKPLLEGGYYPGDEKNRAVKEGDRVTLGDTTLTAHATP--HSPGCTSWEMTVKDGKEDREVL--FCSGTVALNRLVGQPTYAGIVDDY------------RATFAKAKA--MKIDVLLGPHPEVYGMQAKR--------EMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQTAALE.................................................................................................................. 292
24 -21.5003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  13  7.IEPPIKNNLH----------IYKTFGVFGGKEYSANSYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNK--GIKTYATAKTNEFLKK--DGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWP-------------------KTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLN.......................................................................................................................................................... 217
25 -21.4001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  14  3.KIEKLKDNLY----------VYTTYNTFNGTKYAANAYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKI--GAKTYSTKMTDSILAK--ENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWT-------------------QSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKAS................................................................................................................................................. 222
26 -21.1001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  15  9.PPFRIAGNLYYVGTDD------------------LASYLIVTPRNILINSDLEANVPMIKASIKKLFKFSDTKILLISHAHFDHAAGSELIKQQT-KAKYMVMDEDVSVILSGGKSDF---KVLHDGERVELGGTVLTAHLTP--HTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAEDY------------KHSIKVLES--MRCDIFLGSHAGMFD--------KNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQ....................................................................................................................... 260
27 -20.8002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  13  12.SISQLNKNVW----------VHTELGSFNGEAVPSNGLVLNSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSL-------------------VKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK.......................................................................................................................................................... 222
28 -20.8001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  15  12.SITQLSDKVY--------TYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRK--GVQSYANQMTIDLAKE--KGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWP-------------------KTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQYIESTSK.................................................................................................................................................. 231
29 -20.6001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  15  12.SITQLSDKVY--------TYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKK--GVQSYANQMTIDLAKE--KGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCM-------------------LKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSK.................................................................................................................................................. 231
30 -20.6004heq_A mol:protein length:146 Flavodoxin  ali model follow..  23  2...........................................................................................................................................................................................................................................................PKALIVYGSTTGNTEGVAEAIAKTLNSEGMETTVVNVADVTAPGLAEG---YDVVLLGCSTWGDDEIEDFVPLYEDLDRAGLKDKKVGVFGSYTYFCGAVDVIEKKAEELGATLVASSLKIDGEPDSAEVLDWAREVLARV...... 146
31 -20.6002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  12  18.SISQLNKNVW----------VHTELGSFNGEAVPSNGLVLNSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCL-------------------VKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK.......................................................................................................................................................... 228
32 -20.4005aeb_A mol:protein length:272 LRA-12  ali model follow..  14  22.RPFRIAGNLYYIGTYD-------------------ACYLITKQGNIIVNTGLAASALQIKNNIKALFKLTDTKILLTTQAHYDHLGAMAEIKKIT-GAKLMADEGDATVMADGGSSDYAFGRLLHDKDTIQLGDTKLVMLHHP--HTKGSCSFLFDTKDEQRSYRIL--ANMPTIVIEKKFSEVSSYPGIAKDY-----------AYTLQAMKN--LSFDIWVASHA-----SQFSMHSKHKP--GDGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN....................................................................................................................... 272
33 -20.0003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  13  12.SISQLNKNVW----------VHTELGSFNGEAVPSSGLVLNSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCL-------------------VKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK.......................................................................................................................................................... 222
34 -19.9005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  17  27.RLYQIADGVW----------SHIATQSFDGAVYPSNGLIVRGDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRKA--GVATYASPSTRRLAEAEGNEIPTHSGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEW-------------------PTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVAE................................................................................................................................................. 248
35 -19.3001akq_A mol:protein length:147 FLAVODOXIN  ali model follow..  23  1...........................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQD-GLRIDGDPRAAR-DDIVGWAHDVRGAI.. 147
36 -19.3004tyf_A mol:protein length:231 NDM-4  ali model follow..  11.VFRQLAPNVW--------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGLVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR....................................................................................................................................................... 231
37 -19.2003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  24.VFRQLAPNVW--------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRKLVPRGS................................................................................................................................................ 251
38 -19.1001f4p_A mol:protein length:147 FLAVODOXIN  ali model follow..  22  1...........................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCWEYFCGAVDAIEEKLKNLGAEIVQD-GLRIDGDPRAAR-DDIVGWAHDVRGAI.. 147
39 -19.0003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  10  17.VFRQLAPNVWHTSYLD----------MPGFGAVASNGLIVRGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR....................................................................................................................................................... 237
40 -19.0003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  16  7.TLTHFKGPLY---------------IVEDKEYVQENSVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTL--GAKIVATQMTYDLQKSQYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCI-------------------LKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHD--VGLIDHYLTLLEKAPK................................................................................................................................................... 233
41 -18.8004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  16  45.RLYQIADGVW----------SHIATQSFDGAVYPSNGLIVRGDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEAEGNEIPTHSGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSANVLYGGCA-------------------VLELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVAE................................................................................................................................................. 266
42 -18.7002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  12  44.RLYKIGDGVW----------SHIATQKLGDTVYSSNGLIVRADELLLIDTWGAKNTVALLAEIEKQIG-LPVTRSISTHFHDDRVGGVDVLRAA--GVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVVRFGPVEVFYPGAAHSGDNLVVYVPAVRVLFGGCA-------------------VHEASRESAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVAE................................................................................................................................................. 265
43 -18.7001i1o_A mol:protein length:147 FLAVODOXIN  ali model follow..  22  2............................................................................................................................................................................................................................................................KALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCHEYFCGAVDAIEEKLKNLGAEIVQD-GLRIDGDPRAAR-DDIVGWAHDVRGAI.. 147
44 -18.6002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  11  8.EVIKIEDGVY--------LHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLARE--------THYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSW-------------------ADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPT................................................................................................................................................ 227
45 -18.6002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  16  45.RLYQIADGVW----------SHIATQSFDGAVYPSNGLIVRDDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEVEGNEIPTHSGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEW-------------------PTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE................................................................................................................................................. 266
46 -18.5004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  10  23.VFRQLAPNVW--------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCL-------------------IKDSKAKSLGNLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR....................................................................................................................................................... 243
47 -18.5005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  10  23.VFRQLAPNVWHTSYLD----------MPGFGAVASNGLIVRGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRLE..................................................................................................................................................... 245
48 -18.4004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  12  15.TATKIDSDVF---------------VVTDRDFYSSNVLVAKDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKM--GAETWSSDLTKQLRLEE--VPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMI-------------------------KPKELGYLGDANVKAWPDSARRLKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMR................................................................................................................................................... 249
49 -18.4004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  12  8.RIEKVKENIF----------LHTSYSRVNGFGVSSNGLVVIDKGNAFI--VDTPWSDRDTETLVHWIRGYELLGSVSTHWHEDRTAGIKWLNDQ--SISTYATTSTNHLLKE---NKKEPAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQW-------------------SRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQPN................................................................................................................................................ 227
50 -18.3004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  10  26.VFRQLAPNVWHTSYLD----------MPGFGAVASNGLIVRGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR....................................................................................................................................................... 246
51 -18.2004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  16  8.KIEKLDEGVY--------VHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTFTAKDTEKLVTWFVER--GYKIKGSISSHFHSDSTGGIEWLNSR--SIPTYASELTNELLKKDGKVQA---TNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGL----------------------GNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEV........................................................................................................................................................................ 200
52 -18.1001j9e_A mol:protein length:147 FLAVODOXIN  ali model follow..  23  2............................................................................................................................................................................................................................................................KALIVYGSTTGNTEYTAETIARELADAGYEVDCRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQD-GLRIDGDPRAAR-DDIVGWAHDVRGAI.. 147
53 -18.1004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  14  9.KIEKLEEGVY--------VHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTFTATDTEKLVNWFVER--GYKIKGTISSHFHSDSTGGIEWLNSQ--SIPTYASELTNELLKKDGKVQA---KNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFV----------------------KPDGLGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKPS................................................................................................................................................ 225
54 -18.1005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  11  25.EVIKIEDGVY--------LHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLARE--------THYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWA-------------------DSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPT................................................................................................................................................ 244
55 -18.0001akr_A mol:protein length:147 FLAVODOXIN  ali model follow..  23  1...........................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWADDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQD-GLRIDGDPRAAR-DDIVGWAHDVRGAI.. 147
56 -18.0001fx1_A mol:protein length:148 FLAVODOXIN  ali model follow..  23  2...........................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARQLANAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQD-GLRIDGDPRAAR-DDIVGWAHDVRGAI.. 148
57 -17.8002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  15  1..MKALLPGLYLLPV-------------PIPYPLKTNLYLLQGGEVALVDT-TRAARGALELHLAELLCFQDVKTILLTHHHPDHYGLSGFFEGL--GARVFLHEEEFARGHRFWREPE-NPLPLRDGEALEVAGKRLRVLWTP--HADGHAAFYLEEEGVLLAGD-------------------ALLEKVSPNVGLWAYTRENPLKDFLRSLDRLDLGARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALL-------DGPKTAWELSLHLFPQELDPAGRRFAFAETLAHLEYLREEGAV............................................................................................ 305
58 -17.8004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  10  50.VFRQLAPNVWHTSYLD----------MPGFGAVASNGLIVRGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR....................................................................................................................................................... 270
59 -17.6001wsb_A mol:protein length:148 FLAVODOXIN  ali model follow..  24  2...........................................................................................................................................................................................................................................................AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDLQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQD-GLRIDGDPRAAR-DDIVGWAHDVRGAI.. 148
60 -17.1001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  15  4.SLTQVSGPVY---------------VVEDNYYVQENSVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSI--GAKVVSTRQTRDLMKSDYPDLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCI-----------------------LKEKLGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPLHG--PELIDHYEALIKAAPQSS................................................................................................................................................. 228
61 -16.4004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  14  7QRVERLSNRVVRVLGCNPGPMTLQGT----------NTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTP--HTDDHMALLLEEENAIFSGDCILGEGTT------------VFEDLYDYMNSL---------------ELLKIKADIIYPGHGPVIHNAEAKIQQYISH--RNIREQQILTLFRENFEKSFTVMELVK--IIYKNTPENLHEMAKHNLLLHLKKLEKEGKIF........................................................................................... 276
62 -16.2002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  11  10.....................LYSWSTFNPARNIDFNGFAWIPEGNILIDP--VALSNHDWKHLESL---GGVVWIVLTNS--DHVRSAKEIADQT-YTKIAGPVAEKENFPIYCD------RWLSDGDELVPG---LKVMELQGSKTPGEL-ALLLEETTLITGDL---------VRAYRAGGLEILPDEKLM---------QKVVASVRRLAALE-KVEAVLVGDGWSVFRDGRDRLKELVA.......................................................................................................................................................... 198
63 -15.9005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  14  22GDTFEVAPGVRWL--------------MPLPFSLDHNLWLLRDAGWTIVDC-SEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGDNVRLWMTLGEYMFGCLMAAGNGSNYRRLREGDAVKIGARTWRVVTGY--HSPEHCALHSEADGVLISGDMVLPRISTNSVFDLEPE------------ANPLALY----LESLGRYETMAPDT-LVLPSHGKPFRGVRTRIAQLRAH-----HDARLEEVRVACAEKPMSAAGIVPIMFRRRELDIHQMTFALGEALAHLNLLWLAGEL............................................................................................ 345
64 -15.1001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  14  27.................................HFSTVVYLEKDRRIIIDPGNLSSMDELEEKFSELISPDDITDVLFTHVHLDHIFNSV----LFENATFYVHEVYKTKNYLSFGISSWKNVVLLKGEE-SLFDEKVKVFHTP--HAREHLSFLLDTENVLITGDIT--------------------PNRLSYYDIIKGYGSVQVKNFLDRVGR----IDLLVFPHDAPLKPEVKK................................................................................................................................................................. 215
65 -15.0004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  20  66.................................GGAEAALEEARGPILVDTGGPWAREALLGALAGQVAPGDVTLVVGTHGHSDHIGNLG----LFPGAALLVSHDFCLPGGRYLPHG------LGEGQPLRLGP-GLEVWATP--HGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV----------------------ADVVVPGHGPPFR...................................................................................................................................................................... 236
66 -14.9002ark_A mol:protein length:188 Flavodoxin  ali model follow..  25  6............................................................................................................................................................................................................................................................KVLVIYDTRTGNTKKMAELVAEGARSEGTEVRLKHVDEATKEDVL----WADGLAVGSPTNMGLVSWKMKRFFDDVLG-EIDGKIACAFSSGGGNEVACMSILTMLMNFGFLVFGVTAVVAGEPRSEEEKEACRRLGRRLAEWVAI 167
67 -13.8003d7n_A mol:protein length:193 Flavodoxin, WrbA-like protein  ali model follow..  16  2......................................................................................................................................................................................................................................................TTNSSSNTVVVYHSGYGHTHRMAEAVAEGAEAT---LHAIDAEGNLSEDGWAALDAADAIIFGTPTYMGGPSWQFKKFADASSKPKWQDKVFGGFTNSA-NGDKLNTLQYLVLLAGQHGGLWVSLGIK-EMSVGDLETARLYGARVANVARQ 186
68 -13.6001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  14  34................................GEATSGYLFEHDGFLLVD-----CGSGVLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKT--VHPVTCFAMRITAGNVVYSADS----SYIPEFIPFTKDADLFICEC-NMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFSGHITLAHSGYVWNS.......................................................................................................................................... 262
69 -12.8004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  16  15..............................PVSCTF-TYLLGDRESVLIDPV-LETAPRDAQLIKEL--GLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQAD----------LHIEDGDSIRFGRFALETRASP--HTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQ---------CAKTLYHSVHEKIFTLPGDCL------------IYPAHD--YHGFTVSTVEEERTLNTLSCEEFVKIMGNLNLPKPQQIDFAVPANMR......................................................................................................................... 230
70 -12.8002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  13  25..............................EHGLSL--LLKKGNKEIVVDT---GQSENFIKNCGLMIDVGRIKKVVLTHGHYDHIGGLKGLLERNPEVKIYTHKEILN--KKYAMRKGGQFEEIGDLSFYEKYKNNFVLIDKDAEIEEGFYVITNTDITYDNEFTTKNFFVEKEGKRDKFLDEVFVVVKEEDGINVVTGCSHAGILNILETARNRFGVSYIKSLIGGFHLRGMEEEKVKDIARKIEEYGVKKVLTGHCTGIDEYGFLKSVLKDKISYLTTSSSI................................................................................................................. 276
71 -12.8001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  17  3..........................VEVLPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARK--HGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALT----------HKITHLSTLQVGSLNVKCLATP--HTSGHICYFVSEPPAVFTGDTLFVAGC-GKFYEGTADEGRLPPDTRVYFARHVEPGNAAIREKLAWAKEKYSIGEPTVPS............................................................................................................................................................................ 213
72 -12.8005f4b_A mol:protein length:202 NAD(P)H dehydrogenase (quinone)  ali model follow..  23  6............................................................................................................................................................................................................................................................KMLVLYYSAYGYMEQMAKAAAEGAREGGAEVTLKRVPELVPEEVAKELADYDAIIIGTATRYGMMASQMKNFLDQTGGLALINKVGSVMVSTATQHGGAELNDVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAK 199
73 -12.7001zwk_A mol:protein length:207 Trp repressor binding protein WrbA  ali model follow..  17  2......................................................................................................................................................................................................................................................ASLSSPYILVLYYSRHGATAEMARQIARGVEQGGFEARVRTVPAVSTECEAVDLKNCAGLALGSPTRFGNMASPLKYFLDGTSSLSLVGKPAAVFTSTA-GGQETTQLSMLLPLLHHGMLVLGGADGKRSLDEHELTLCRALGKRLAETAGK 198
74 -12.7002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  18  14....................................NAYLVTGEGPVLIDPGDEP------EKLLALFQTTGLIAILLTHAHFDHVGAVAPLVEAL-DLPVYLHPLDLPLYEGADLAARAPVRPLEEGMRL----FGFQVLHLP--HSPGHVAFYDPEGAQVFSGDL---------LFRGSVGR-----------YDLPGADPKALFASLKRLLSLPPETRVH-PGHGPGTTLGLEARTNPFLTGLEWEA.................................................................................................................................................... 207
75 -12.7002a5l_A mol:protein length:200 Trp repressor binding protein WrbA  ali model follow..  18  4.........................................................................................................................................................................................................................................................SSPYILVLYYSRHGATAEMARQIARGVEQGGFEARVRTVPAVSTECEAVDLKNCAGLALGSPTRFGNMASPLKYFLDGTSSLSLVGKPAAVFTSTA-GGQETTQLSMLLPLLHHGMLVLGGADGKRSLDEHELTLCRALGKRLAETAGK 197

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 3 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]