current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1znb_A mol:protein length:232 METALLO-BETA-LACTAMASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst AQKSVKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSKPLast
1 -105.0001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model  100  1AQKSVKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSKP 232
2 -105.0001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  97  1AQKSVKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQYIESTSKP 232
3 -96.3002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  32  7KTVIKNETGTISISQLNKNVWVHTELGSFNGEA-VPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK......... 228
4 -96.0001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  28  1.........DVKIEKLKDNLYVYTTYNTFNGTK-YAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKA. 221
5 -96.0002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  33  2.TVIKNETGTISISQLNKNVWVHTELGSFNG-EAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK......... 222
6 -95.6003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  29  6METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR...... 237
7 -95.5003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  32  2.TVIKNETGTISISQLNKNVWVHTELGSFNGEA-VPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK......... 222
8 -94.9003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  29  1.....QVKDFVIEPPIKNNLHIYKTFGVFGGKE-YSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNK........ 218
9 -94.3005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  28  12METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRLE.... 245
10 -94.3004tyf_A mol:protein length:231 NDM-4  ali model follow..  29  1.GPGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR...... 231
11 -93.4002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  33  1....SQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQP 226
12 -93.4004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  28  12METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR...... 243
13 -93.4003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  28  13METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRKLVPR. 249
14 -92.8004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  29  15METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR...... 246
15 -92.5004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  30  1....NDEVPELRIEKVKENIFLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRK-NGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKE-PAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQP 226
16 -92.2005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  32  14LPALAQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQP 243
17 -92.1004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  33  1...AGARLPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVE-RGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSG-VSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG---DANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKP 224
18 -91.7004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  29  39METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRL..... 271
19 -90.9004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  34  1....AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVE-RGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSG-VNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG---DANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKP 223
20 -88.4005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  30  16PTVNEIPVGEVRLYQIADGVWSHIATQSFDG-AVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGTHSLEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVA. 247
21 -86.2002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  28  33PTVDDIPVGEVRLYKIGDGVWSHIATQKLGDTV-YSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPKALSSSGDVVRFGP--VEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVA. 264
22 -85.9004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  30  34PTVNEIPVGEVRLYQIADGVWSHIATQSFDG-AVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVA. 265
23 -85.3002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  29  34PTVSEIPVGEVRLYQIADGVWSHIATQSFDG-AVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGTHSLEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVV. 265
24 -82.7004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  24  4SSDHVDLPYNLTATKIDSDVFVVT------DRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLG---DANVKAWPDSARRLKKF--DAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMR.. 249
25 -80.4003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  25  2......SEKNLTLTHFKGPLYIVE------DKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWKSLPDTVFPGD--FNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN----LGNMSFANRTEYPKTLEKLKGLIEKVDSIIAGHDTIHDVGLIDHYLTLLEKAPK..... 233
26 -79.9001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  27  1........AGMSLTQVSGPVYVV------EDNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWLVLPNVVHDGDFTLQEGK--VRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK----LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPHGPELIDHYEALIKAAPQSS... 228
27 -35.2002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  18  5...........SSGLVPRGSHMLR-DDDLCLLGDVQVPVFLLRGEASWALVEGGISRD-AELVWADLCRADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALFDEAEGVWRPLVFDDMEAYLESLERLQRL-PTLLQLIPGHGGLRGRLAADGAESAYTECLRLCRR. 261
28 -34.6002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  17  1............MKALLPGLYLLP----PIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHLAELGQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHRVHPPQNPLPLRDGEALEVAGKRLRVLW-TPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAENPLKDFLRSLDRLADL--GARVAYAGHFGP--EELKAHHQARLEALLALLDGP 265
29 -34.2001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  12  11YTVDASWLQPMAPLQIADHTWQI---------GTEDLTALLVQTPDGAVLLDGG-MPQMASHLLDNMKARTPRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGG-ANADRIVMDGEVITVGGIVFTAHFM-AGHTPGSTAWTWTDTRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRAL--PCDVLLTPHPGASNWDYAAGARAGAK......... 242
30 -33.8002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  12  6...............HRPDLYSWSTFNPARN---IDFNGFAWIRPEGNILIDPV---ALSNHDWKHLESLGG--VVWIVLTN--SDHVRSAKEIADQYTKIAGPVAEKENFPIY----CDRWLSDGDELVPG---LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVRRLLEKVEAVLVGDGWSVFRDGRDRLKELVATL....... 200
31 -33.1003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  12  6.......SSPQQPFTIYGNTHYV---------GTGGISAVLLSSPQGHILVDGTTEKG-AQVVAANIRAMKLSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSSAKVRAVADGELVKLGPLAVKAHAT-PGHTEGGITWTWQSCEVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKL--SCDIAIAAHPEVND..................... 220
32 -33.1003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  17  28AVAMKKWTAPFEPFQLIDNIYYV---------GTDGIAVYVIKTSQGLILMDTAMPQS-TGMIKDNIAKLKVADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYVKVDRAVKEGDRVTLGDTTLTAHAT-PGHSPGCTSWEMTVKDVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAM--KIDVLLGPHPEVYG..................... 247
33 -32.8002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  18  9................................GPLQENAYLVETGEGPVLIDPGDE---PEKLLALFQT-TGLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLPLPVRPLEEGMRL----FGFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYD-LPGADPKALFASLKRLLSL-PPETRVHPGHGPGTTLGLEARTNPFLTGLEWEA... 207
34 -32.5001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  5.......PNPFPPFRIAGNLYYV---------GTDDLASYLIVTPRGNILINSDLEAN-VPMIKASIKKLKFSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGG-STVDKVLHDGERVELGGTVLTAHLT-PGHTRGCTTWTMKLKDAVIIGSIGVNPGYKLVDNITPKIAEDYKHSIKVLESM--RCDIFLGSHAGMFD..................... 220
35 -32.4003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  13  20....................................ATVYVMCGEKLTVMIDAGVSNSIADFSFL-------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDGLKKVIEVEGNEEFDLGGYRMRLIYT-PGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIPTTVIDYKMYMESLKRQIEL--KPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQIN. 232
36 -32.1005aeb_A mol:protein length:272 LRA-12  ali model follow..  13  18.......SKPYRPFRIAGNLYYI---------GTYDLACYLITTKQGNIIVNTGLAAS-ALQIKNNIKALKLTDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSIIADRLLHDKDTIQLGDTKLVMLHH-PGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKPGIAKDYAYTLQAMKNL--SFDIWVASHASQFS..................... 232
37 -31.6004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  17  38.......NDPAMPQKVYGNTWYV---------GTCGISALLVTSDAGHILVDAAT-PQAGPQILANIRALRPEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPVANIVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASG..................... 255
38 -31.6005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  11  4CEVCATWNADQAPFRLFGNTYYV---------GMKGLSSVLVTSPQGHVLIDGGLPES-APKIIANIGALRIEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVVKDMRLARDGGQFNVGPVYLTAHAT-PGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGPNALADLRHSFETLEKL--PCDVLISAHPEASQ..................... 228
39 -31.6004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  16  31CADDAGWNDPAMPLKVYGNTWYV---------GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALRPEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPVANIVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASGRRYAQGARQRLEKRLAEGARP 303
40 -29.0004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  19  8...........RVERLSNRVVRVLG-CNPGPMTLQGTNTYLVGTGPRRILIDTPAIPEYISCLKQALTE-FNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCILGEGTTVF-----EDLYDYMNSLKELLKI--KADIIYPGHGPV-----IHNAEAKIQQYISHRNI. 220
41 -27.0002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  16  11..................................FSQNCSLIWCEQLAALVDPGGD---AEKIKQEVDAS-GVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQGQPLTPDRWLNDGDRVSVGNVTLQVLHC-PGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSD-FPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD........ 210
42 -26.9005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  12  23...........DTFEVAPGVRWLR----PLPFSLDHINLWLL-GQAGWTIVDCGISSEAIRTHWEQIRHLDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTLGEYMFGCLPAVPPRYRRLREGDAVKIGARTWRVV-TGYGHSPEHCALHSEADGVLISGDMVLPRISTNVSVFDLEPLALYLESLGRYETM-APDTLVLPSHGKP--AQLRAHHDARLEEVRVACAE. 302
43 -26.5004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  18  32EGVGDAVRADGSVTLVLPQTRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPWAR-EALLGALAGVAPGDVTLVVGTHGHSDHIGNLGLFPGAALLV----SHDFCLPGGRYLPHGLGEGQPLRLGPG---LEVWAT-PGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV---ADVVVPGHGPP....................... 234
44 -26.3001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  12  29....................................STVVYLEHKDRRIIIDPGNLSS-MDELEEKFSELGISPITDVLFTHVHLDHIFNSVLF--ENATFYVHEVYKTKNYLSFGTIVGRIYSKVIS-SLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRL-----SYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHD......................... 206
45 -26.2001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  19  9..................................LTDNYMYLVIDDEAAIVD----PVQPQKVVDAARKH-GVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGG--------DDRIGALTHKITHLSTLQVGSLNVKCLAT-PCHTSGHICYFVSKPGAVFTGDTLFVAG---CGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHNNLKFARHVEPGNAAIREKLAWAKE. 202
46 -25.9001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  15  9..................................LKDNYAYILHDEDVGVVDPSEAEPIIDSL-----KRSGRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAMDKDRIPG------DMALKDGDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSLS---CGKLFEGTPKQMLASLQKITSL-PDDTSIYCGHSNSKFALSLEPNNEVLQSYAAHVAE. 198
47 -24.3004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  14  2...SDSKPRDVQVLPIATNTKVLRAEIEYALERGTTSNS-YVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRAPDDNLNILPMRGKETLDLGGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFKEDQRYYFNCLMAPHAIHVEAALEKISDL--QVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLE. 256
48 -24.0002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  15  31..................................LKDNFSYLINDHTLAAVDVNAD---YKPILTYIEEHLKQTFSTILSTHKHWDHSGGNAKLKAEEAMNSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDA-PCHTRGHVLYKVQHPQALFTGDTMFIAG---IGAFFEGDEKDMCRAMEKVYYALDKVTFIFPGH---------EYTSGFMTFSEKT--FP 235
49 -23.9004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  13  28...........................................ESREAVLIDPVLE--TAPRDAQLIKEL-GLRLLYAVNTHCHADHITGSGLLRSL------LPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRAS-PGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTD-FQQGCAKTLYHSVHEKIFTLPGDCLIYPAHD......................... 180
50 -23.5002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  14  41..................................IPVSAYLIQCTDATVLYDTGCHPECMCNLPERLRQLGLSPISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRVNLLNFGTGHASGMLGLAVRLEKFLLVSDACYTATNYGPPARRAGDTIGYDRTVSHIRQYAESRSLVLFGHDREQFASLIKSTDGFYE......... 276
51 -22.4003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  14  3ISMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAF--TNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYVQLLYT-PGHSPGHQSLFIETEQVLLTIDASYKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKIIFFGH-DIEQEKSCRVFPEYI.......... 254
52 -22.3002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  14  11..........IPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAF--TNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYVQLLYT-PGHSPGHQSLFIKTEQVLLTIDASYKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKIIFFGH-DIEQEKSCRVFPEYI.......... 252
53 -22.1004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  21  22...........................................ATRQAVLIDPVLE--QVDRDLQMVAEL-DLTLTHVFDTHVHADHITASGALRER-------TQATVVGSVNGASCANVQVRHGDEVRVGQLVFQVLAT-PGHTDDSISYLLGDR--VFTGDALLVRGNGRTD-FQNGNASQLYDSLTRVLFTLPDETLVYPGHD......................... 171
54 -22.1002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  12  27............................................DKPALLIDPVDK--TVDRDLKLIDEL-GLKLIYAMNTHVHADHVTGTGLLKTK------LPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRAT-PGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTD-FQEGSSDQLYESVHSQIFTLPKDTLIYPAHDYKGFEVSLTKDKETFKTIMSNLNLS 220
55 -21.9002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  19  2.........KAAAKRISDGVY-WTGVLDWD--QGTTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDALMDAARKFYANLITPLSKLVLKKFDEVKELLERIQMIAPSHGQI....................... 236
56 -21.3003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  14  2........SDTKVYLLDGGSLHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYEKHQTIPGALGLLGLEPIDVVVNSHFHFDHCGGNKYF--PHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARVKLIST-PGHSIGHYSLLVEFPRILFTIDAAYTQKSTLCQAAFHIDPVAGVNSMRKVKKLAEDHGALMYSHDM........................ 254
57 -20.7001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  16  1..........MQATKIIDGFH-SRDFHGYTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDILERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVI....................... 229
58 -20.7002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  15  8..........VQDQEMIPGVY-VRIFHGYHTDEGSSYNSYFID-DECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKIGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMKALEVASTV--EIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQHC. 255
59 -20.6001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  15  2...........QPVAITDGIYIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKASHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKA. 252
60 -20.4003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  20  30....................................SQASYLIGCQKAMIID----PIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHT-PGHTPESISFLLTDEGGLFSGDFIFVGKAVKVEGSSEIGAKQMFKSIESIKDL-PDYIQIWPGHGA........................ 215
61 -20.3001vme_A mol:protein length:410 Flavoprotein  ali model follow..  16  12..........TERIFDDPEIYIRYFEAVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEGFYGIKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGLPHVTKYIVTVIGHYKNYILEGAEKLSSL--KIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPKK. 259
62 -19.8003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  16  15....................................AHASYLVGCQEACVID----PARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAIVSDEGPPEWKSEYVKAYPHRLLKDGDELHFGNVRIVVMHT-PGHTPEHVSYLLYDGKALFSGDFVFVGRVAGESGSSEALARQMFRSLRKFEAL-PDHVQVLPAHGA........................ 201
63 -19.8003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  27...............VPKPLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGKESHIIADLANLTPKDIDYVLMTHMHFDHAAGLTDQAGHNAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLIIKMQHSG-GHSFGHTIITIESDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAY....... 270
64 -19.6004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  13  3.............IVVKNNIHVRDFHGTEYKTLRGSSYNSYLIREEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPEWNF--NVVKTGDTLDIGGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDALFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQED. 248
65 -18.0004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  21  13.........DVQITALLDGTILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASSHLGSVLSNLKASGYQPVDTILLTHLHPDHVCG---ISKDGVANFPNATVYVSNDEASFWLDPEKIKQAIAPYQAKQRFKTYKLGAGHTPGHFSYELKTESIVFIGDIVHSHTVPETAIEYDIDPKKAVETRLKQFANFAKNGQTIPGIGHTYSAD................... 278
66 -18.0004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  17  13.........ELELFILTDGYIILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGFSAITDIFLSHAHPDHIGGV-FISKIEHDFWINASIKDFNNSALKAHPERLIQPKLKFYDLNKTLYNFQLAPGHTPGLTVTTISSEKLMYVADLIHSDVIPDWGFSGDTDLDIATASRKKFLKQLADTKARAPGLGFT....................... 278
67 -17.9004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  17  44.........DFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGYQPVDTVLLTHLHPDHACGLEFWLDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEGEL-SLVASPGHTPGHTSYLFKSQSLLVWGDILLNHAVPEVVFEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV....................... 303
68 -17.8004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  17  44.........DFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGYQPVDTVLLTHLHPDHACGLEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGEL-SLVASSGHTPGHTSYLFKSQSLLVWGDILINHAVPEVVWEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV....................... 303
69 -17.2001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  18  54.........DFEITALSDGTQSALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAGPTLGRLAANLKAAGYQPVDEIYITHMHPDHVGGLLAFPNAVVRADQKEADFWLSQTNLDKAPDKPFSGNTDLVPGIKALAS----HGHTPGHTTYVVESQKLALLGDLILVAAVPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIPGIGHI....................... 311
70 -17.1002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  15  16..................................FQDNYIWVLTNDECVIVD----PGEAAPVLKAIAEH-KWMPEAIFLT----DHVGGVKELLQHQMTVYGP-------AETQDKGATHLVGDGDTIRVLGEKFTLFAT-PGHTLGHVCYFSRP--YLFCGDTLFSGG---CGRLFEGTPSQMYQSLMKINSL-PDDTLICCAHANIKFALSILPHDSFINEYYRKVKE. 197
71 -16.4004nur_A mol:protein length:633 PSdsA  ali model follow..  17  89............LFEVTDGIYQVRNYD---------SNMTIVEGKDGITIFDPLISQETAKAALDLYYKRPKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAENLIPPTDIIKETETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTNTYSLRGAKIRDPLAWSKYLNEALKLWGDDVQVMPVWGNKEVREQLSLQRDMYRYINDETLR. 356
72 -16.3002cfu_A mol:protein length:658 SDSA1  ali model follow..  17  107............LFEVAEGIYQVRGFD---------ANITFIRGDSGWIVVDTLTTPATARAAYELVSRLGERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKENLLAPTRLIEGEEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTNLYTLRGAEVRDALGWSKYINQALHRFGRQAEVMPRWGNAEIVEVLEKQRDLYGYLHDQTLH. 374
73 -16.2004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  15  89............LFKVTDKMYQVRGQD---------SNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQRPQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISENIIAPTKTIVRTEKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENATHTNFYTLRGAKTRDTSKWTEYLNETLDMWGNDAEVLPVWGNKHINDYIGKYRDTIKYIHDQTLH. 356
74 -15.9002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  15  117............LFEVMPKLYQVRGLD---------ANMTIIEGDSGLVLIDTLTTAETARAALDLYFQRPKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSENLVAPNVLIEKPERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPANLLTPRGAEVRDAKAWAGYIDASLEKYGDRTDVLPVWGGDKVRTYLADQRDMYAFLNNRALN. 385
75 -15.1004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  17  28...........................................ETRQCALIDSRTCSASADRLVERVNEL-NASVRWVLETHVHADHLSAAAYLKEKGAHITQVQKVFGALFNAEPGFADVLLEDEEGFRIGNLQARALHT-PGHTPACMSFMIEDEIAVFVGDTLF---MPDYGTAPGADARTLYRSIRRLLAF-PDQTRLFMCHDYLPGGRDMQYVTTVAEQRASNI... 235

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 3 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]