current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1ztc_A mol:protein length:221 hypothetical protein TM0894, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MGSDKIMELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHTPWHAREHLSFLLDTENAGRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPLKPEVKKLast
1 -89.8001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model  100  1MGSDKIMELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHTPWHAREHLSFLLDTENAGRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPLKPEVKK 215
2 -59.6003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  19  1...MSDTKVYLLDGGSLVLDPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEATFEGIDGDVD-LARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKELMYSHDMDNFKTYRT 262
3 -58.3002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  21  2..DMTVKKLYFIPAGRCMLDPGKLLNLPVWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHR-----EEYMKECILPHLNYKIIEGDYEVV-PGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPGFDPELALSSIKRLKEVVIIFFGHDIEQEKSCRV 247
4 -58.1003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  21  4..SMTVKKLYFIPAGRCMLDPGKLLNLPVWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHR-----EEYMKECILPHLNYKIIEGDYEVV-PGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPGFDPELALSSIKRLKEVVIIFFGHDIEQEKSCRV 249
5 -56.7002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  20  10LGEIRVDENFIIANSTFVTVSSRLIDIPVSAYLIQCTDATVLYDTGCHPECCNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIATPRNWDLVGRDERERELAPGVNLLFGTGHASGMLGLAVRLEKQPGFLLVSDACYTATNYGPPARRHDTIGYDRTVSHIRQYATVLFGHDREQFASLIK 269
6 -55.8004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  18  15..PGDPYSVVVLLQGYAEPEESPRGSGGAEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPG----------------GRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVATALGTVVVAGDVFERDGDEDSWQASEDPAAQERSRKRVLVADVVVPGHGPPFR..... 236
7 -52.4004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  15  35..RGNVAELKTILK--DNFRADHYIDMAINILLVKTKEKLILMDTGMGERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVLVFPNASIFISKIEHDFWINASIKDFNNSLQNILKAIQPKLKFYDLNKTLYSHFNFQLAPGHTPGLTVTTISSGNE-KLMYVADLIHSDGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPW...... 272
8 -51.0003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  17  40....................ERNQINLPTHPILIQTAQYNLIIDAGIGNEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPGIKMQHSGGHSFGHTIITIESQGD-KAVHMGDIFPTTATAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVK. 259
9 -50.4004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  18  62LKGIDDKDLQSLLARMFVASEK-GVQTAVNAYLINTGDNLVLIDTGAAPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQPYAKMNKLKPYKTEGELL-PGVSLVASPGHTPGHTSYLFKSGGQ-SLLVWGDILLNHAVQFDVDSDQARQSRQRILAEAATDKLWVAGAHLPF...... 297
10 -50.2004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  18  62LKGIDDKDLQSLLARMFVASEK-GVQTAVNAYLINTGDNLVLIDTGAAPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQPYAKMNKLKPYKTEGELL-PGVSLVASSGHTPGHTSYLFKSGGQ-SLLVWGDILINHAVQFDVDSDQARQSRQRILAEAATDKLWVAGAHLPF...... 297
11 -50.1004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  16  31FKDIPQQQVHEILKK-YYADQEKGVQTSINAFLVNIGKSLILIDSGAASHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGIANFPNATVYVSNDEASFWLDPKQAAKLPKEKQANYLGTVEKIKQAKLGDDIQGFKVINTAGHTPGHFSYELKTKGE-SIVFIGDIVHSHAIEYDIDPKKAVETRLKQFANFAKNGQTIAAPHLPF...... 268
12 -49.0001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  12  74..NQPAPKTQSALAKSFQKAP---LETSVTGYLVNTGSKLVLVDTGAAPTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLLAFPNAVVRADQKEADFWLSQTNLDKAMASLNPYVKAGKFKPFSGNTDLV-PGIKALASHGHTPGHTTYVVESQGQ-KLALLGDLILVATTQLDSDSKSVAVERKKAFADAAKGGYLIAASHLSF...... 305
13 -45.2001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  12  38............................LTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGFTAHFMAGHTPGSTAWTWTDTRNGRIAYADSLSAPGYQLQGNPRPHLIEDYRRSFATVRALDVLLTPHPGASNWDYAA 235
14 -44.5004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  15  58............................ISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQGAPVYARAPAIDTLKRGLPDRTDPQFAEPVAPVANIVTLADDGVV-PLALTAVASPGHTPGGTSWTWRSCEGDDQMVYADSLTAISDSDDAAHPGYLAAFRNTLARVAALDILVTPHPSASGLWNRI 260
15 -44.4003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  16  55............................IAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKGAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKVDRAVKEGDRVTLGDLTAHATPGHSPGCTSWEMTVKDGKEVLFFCSGVALNRLVGQPTYAGIVDDYRATFAKAKAMDVLLGPHPEVYGMQAKR 252
16 -44.2004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  16  58............................ISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQGAPVYARAPAIDTLKRGLPDRTDPQFAEPVAPVANIVTLADDGVV-PLALTAVASPGHTPGGTSWTWRSCEGDDQMVYADSLTAISDSDDAAHPGYLAAFRNTLARVAALDILVTPHPSASGLWNRI 260
17 -43.1005aeb_A mol:protein length:272 LRA-12  ali model follow..  18  38............................LACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKGAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIADRLLHDKDTIQLGLVMLHHPGHTKGSCSFLFDTKDEQRILIANMIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLDIWVASHASQFSMHSKH 237
18 -43.1002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  14  36............................VPVFLLRLGESWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPRLPNVQVLASERTCQAWKSESAVRVVERLNRQLLRAEQRAVADGEWLELGPRLQVIEAHGHSDDHVVFY---DVRRRRLFCGDALGEFDEAEGVWRPLVFDDMEAYLESLERLQQLIPGHGGLLRGRLAA 245
19 -42.3001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  17  25............................LASYLIVTPRGNILINSDLEANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQAKYMVMDEDVSVILSSDFHYANDSSTYFTQSTVDKVLHDGERVELGGVLTAHLTPGHTRGCTTWTMKLKDHGQAVIIGSIGVNPGYKLVDNIPKIAEDYKHSIKVLESMDIFLGSHAGMFDLKNKY 225
20 -42.3003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  17  27.............................SAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKATVLAGAANVDTLRTGVSPKSDPQFGSLSGSAKVRAVADGELVKLGPAVKAHATPGHTEGGITWTWQSCEQGDVVFADSLTAVSADSYRSDHPEVVASLRGSFEAVEKLDIAIAAH.......... 215
21 -42.1005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  15  31............................LSSVLVTSPQGHVLIDGGLPESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQNALVAASPSAALDLASEVGPDDPQYHALPKYPPVKDMRLARDGGQFNVGLTAHATPGHTPGGLSWTWQSCDGPNMVYADSIRPGFKFSASSEYPNALADLRHSFETLEKLDVLISAH.......... 223
22 -39.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  20  20............................ATVYVMCGEKLTVMIDAGVSNSIADF--------SFLDKLDYIVLTHLHIDHIGLLPELYKAKVLVKSGFKKYLTSEDGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGMRLIYTPGHARHHMSVLVD-----DFLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQKVVGFAHGGLVSPKIME 217
23 -33.8002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  17  14.............................NAYLVETGEGPVLIDPG--DEPEKLLALFQTTGLIPL---AILLTHAHFDHVGAVAPLVDLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLPVRPLEEGMRLF---GFQVLHLPGHSPGHVAFYDP---EGAQVFSGDLLFRGSVGRYDLPGADPKALFASLKRLLSLPRVHPGHGPGTTLGLEA 194
24 -33.5002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  23  1........MKALLPGYLLPVPIPYPLKTVNLYLLQGAGEVALVDTATRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGARVFLHEEEFEGALQGIRETVEKTRERVHPPQNPLPLRDGEALEVAGRLRVLWTPGHADGHAAFYLEEEG---VLLAGD-VSPNVGLWAYTRENPLKDFLRSLDRLADLGVAYAGHFGPIADVRQR 243
25 -31.6004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  16  69............................SNGLIVRDGDELLLIDTAWGAKTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPG------AAHSTDNLVVYVPSAN---VLYGGCAVLELSNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLP....... 243
26 -31.6005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  16  51............................SNGLIVRDGDELLLIDTAWGAKTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPG------AAHSTDNLVVYVPSAN---VLYGGCAVLALSRVADADLAEWPTSVERIQKHYPEAEVVIPGHGLP....... 225
27 -31.0002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  14  69............................SNGLIVRDGDELLLIDTAWGAKTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPG------AAHSTDNLVVYVPSAS---VLYGGCAIYELSRVADADLAEWPTSIERIQQHYPEAQFVIPGHGLP....... 243
28 -31.0002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  16  68............................SNGLIVRDADELLLIDTAWGAKTVALLAEIEKQIGLP--VTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVVRFGPVEVFYPG------AAHSGDNLVVYVPAVR---VLFGGCAVHEASNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLEL.. 247
29 -30.4002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  14  24............................FNGFAWIRPEGNILIDPV--ALSNHDWKHLESLG----GVVWIVLTNS--DHVRSAKEIAYTKIAGPVAEKENFPIYCDRWLS------------------DGDELVPGLKVMELQGKTPGELALLLE----ETTLITGDVRAYRAGGLEILPDEKLMNKQKVVASVRRLEAVLVGDGWSVFRDGRD 191
30 -29.2001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  15  1......AGMSLTQVSGPVYVVEDNYYVQENSMVYFGAKGVTVVGATWTPDARELHKLIKRVSRKP--VLEVINTNYHTDRAGGNAYWKGAKVVSTRQTRDLMKSDWAEIVAFTRKPDLPLVLPNVVHDGDFTLQEGKVRAFYAPAHTPDGIFVYFPDEQ---VLYGGCILKEKLGNLFADVKAYPQTLERLKAMKLPIKTVIGGHDSPL...... 208
31 -28.8003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  14  1...MSEKNLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPEAETLYKEIRKVSPLP--INEVINTNYHTDRAGGNAYWKGAKIVATQMTYDLQKSQWGSIVNNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLEAHTKDGIFVYFPAER---VLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIKVDSIIAGHDTPI...... 215
32 -28.8004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  18  8....RVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSI-----NNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGLRVLYTPGHTDDHMALLLEEEN---AIFSGDCILGEGTTVFEDLYDYMNSLKELLKI--KADIIYPGHGPVIHNAEAK 210
33 -28.6004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  12  48............................SNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQE---GMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKNLGAADTEHYAASARAFGAAFPKASMIVMSHSAP....... 226
34 -28.5002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  18  36............................SNGLVLNTSKGLVLVDSSWDDKTKELIEMVEKKFQKR--VTDVIITHAHADHIGGIKTLKERGIKAHSTA---------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN---ILVGGSLVKSTSNVADAYVNEWSTSIENVLKRYRNINAVVPGHG......... 206
35 -28.3005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  12  48............................SNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQE---GMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP....... 226
36 -28.2004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  12  51............................SNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQE---GMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP....... 229
37 -28.1003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  12  49............................SNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQE---GMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP....... 227
38 -28.1002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  17  42............................SNGLVLNTSKGLVLVDSSWDDKTKELIEMVEKKFQKR--VTDVIITHAHASRIGGIKTLKERGIKAHSTA---------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN---ILVGGCLVKSTSNVADAYVNEWSTSIENVLKRYRNINAVVPGHG......... 212
39 -28.0003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  12  42............................SNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQE---GMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP....... 220
40 -27.9004tyf_A mol:protein length:231 NDM-4  ali model follow..  12  36............................SNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQE---GLVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP....... 214
41 -27.9004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  12  75............................SNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQE---GMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKNLGDADTEHYAASARAFGAAFPKASMIVMSHSAP....... 253
42 -27.7003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  16  36............................SSGLVLNTSKGLVLVDSSWDDKTKELIEMVEKKFQKR--VTDAIITHAHADRIGGIKTLKERGIKAHSTA---------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN---ILVGGCLVKSTSNVADAYVNEWSTSIENVSKRYRNINAVVPSHG......... 206
43 -27.6004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  13  3..EVPELRIEKVKENTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDRTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIKWLNDQSISTYATT----------STNHLLKENKKEPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPKSK---ILFGGCFVRSLDSEGEAHIDQWSRSAQNALSRYSEAQIVIPGHG......... 201
44 -27.6004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  14  2.ESLPDLKIEKLDEGTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGIEWLNSRSIPTYASE----------LTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERK---ILFGGGFIKPYGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHS......... 198
45 -27.4002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  13  33............................SNGLVVLDNNQAYIIDTPWSEEDTKLL--LSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSE----------LTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSK---ILFGGCLVRSHEWEADASISSWADSIKNIVSKKYPIQMVVPGHG......... 201
46 -27.2002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  14  6...................IPVTAFSQNCSLIWCEQTRLAALVDPG--GDAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNLQVLHCPGHTPGHVVFF---DEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRLGDDVTFIPGHGPLSTLGYER 202
47 -26.9005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  13  50............................SNGLVVLDNNQAYIIDTPWSEEDTKLL--LSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSE----------LTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSK---ILFGGCLVRSHEREGDASISSWADSIKNIVSKKYPIQMVVPGHG......... 218
48 -26.8003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  14  31............................ANSMYLVTKKGVVLFDVPWEKVYQSLMDTIKKRHNLP--VVAVFATHSHDDRAGDLSFFKGIKTYATAKTNEFLKKDGKATSTEIIKTGKP------------RIGGEEFVVDFLEGHTADNVVVWFPKYN---VLDGGCLVKSNSYIKEANVEQWPKTINKLKAKYSKATLIIPGHD......... 201
49 -26.7004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  15  34............................KHGLVVLVNTDAYLIDTPTATDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIEWLNSQSIPTYASE----------LTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKK---ILFGGCFVKPDGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHS......... 199
50 -26.3001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  12  37............................SNGMIVINNHQAALLDTPINDATETLVNWVADSLHAK--VTTFIPNHWHGDCIGGLGYLKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLT------------SLDGMPLQCYYLGGHATDNIVVWLPTEN---ILFGGCMLKDNQNISDADVTAWPKTLDKVKAKFPSARYVVPGHG......... 207
51 -26.2001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  15  1..DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDFKSFTDEIYKKHGKK--VIMNIATHSHDDRAGGLEYFGGAKTYSTKMTDSILAKENKPRAQYTFDNNKS------------KVGKSEFQVYYPKGHTADNVVVWFPKEK---VLVGGCIIKSADSKDEAYVNDWTQSVHNIQQKFSGAQYVVAGHD......... 197
52 -26.2001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  12  37............................SNGMIVINNHQAALLDTPINDATEMLVNWVTD--SLHAKVTTFIPNHWHGDCIGGLGYLKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLT------------SLDGMPLQCYYLGGHATDNIVVWLPTEN---ILFGGCMLKDNQNISDADVTAWPKTLDKVKAKFPSARYVVPGHG......... 207
53 -25.0004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  12  38...............................VAKMLDGTVVIVSSPFENLTQTLMDWVAK--TMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLVFDLKQGKVFSFSNELVEVPAHSPDNVVVYFPKKK---LLFGGCMIK--PKELGYLGDANVKAWPDSARRLKKFDIVIPGHG......... 226
54 -25.0001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  17  14..............................MYLVDETKEAAIVDPV---QPQKVVDAARKHGVK---LTTVLTTHHHWDHAGGVKLESGLKVYGGD-------------------DRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEAVFTGDTLFVA-KFYEGTADEMCKALLEVLGRLPPDTRVYCGHE......... 174
55 -24.0005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  15  44...........................HINLWLLRDQAGWTIVDCGISEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCNVRLWMTLGEYDPAALDKLRSRRSYYSDLVPAVPPRYRRLREGDAVKIG-RVVTGYGHSPEHCALH---SEADGVLISGD-VSVFDLEPEANPLALYLESLGRYETMAPDTLVLPSHGKPFRGVRTR 281
56 -23.0002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  16  1MRGSGSVEVQVLIENVVF--ARNFVAEHGLSLLLKKGNKEIVVDTGQS---ENFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLPEVKIYTHKEILNKKYAMRKGGQFGFDLSFYEKYKNNFVLIDKDAEIEEGFYVITIPDKFLDEVFVVVKEED-GINVVTG----------SHAGILNILETARNRFGVSYIKSLIGGFH......... 221
57 -22.5001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  17  14..............................AYILHDEDTVGVVDPS---EAEPIIDSLKRSGRN---LTYILNTHHHYDHTGGNLELKDRY--------------GAKVIGSAMDKDRIPGIDMALKDGDKMFAGHEVHVMDTPGHTKGHISLYFPGSR---AIFTGDTMFS--GKLFEGTPKQMLASLQKITSLPDDTSIYCGHE......... 170
58 -22.3004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  19  16.........................VSCTFTYLLRESREAVLIDP-VLETAPRDAQLIKELGLR---LLYAVNTHCHADHITGSGLLRSLL-----------------GCQSVISRLSGAQADLHIEDGDSIRFGRALETRASPGHTPGCVTFVL---NDHSMAFTGDAL-GRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHD......... 180
59 -22.2002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  19  12.........................ESSTFTYLLHPDKPALLIDP-VDKTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGTGLLKTKL-----------------GVKSVISKASGSKADLFLEPGDKVSIGDYLEVRATPGHTAGCVTYVTGEGADPRMAFTGDAV-GRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHD......... 184
60 -22.0002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  13  36..............................SYLIHTTHTLAAVDV--NADYKPILTYIEEHLKQQGTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVVGGANDSIPAV---------TKPVREGDRQVGDLSVEVIDAPCHTRGHVLYKVQHPNDGVALFTGDTMFIA-AFFEGDEKDMCRAMEKVYHALDKVTFIFPGHE......... 221
61 -21.8004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  26  10.........................ESSTYTYLIEATRQAVLIDP-VLEQVDRDLQMVAELDLT---LTHVFDTHVHADHITASGALREATVVGSVNG--------------------ASCANVQVRHGDEVRVGQVFQVLATPGHTDDSISYLL-----GDRVFTGDALLVRGNGRTDFQNGNASQLYDSLTRLPDETLVYPGHD......... 171
62 -19.9002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  19  18.....................GAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTDYVKVSNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFCYHAGHVLGAAMFMIEIAGV-KLLYTGDF.............................................. 180
63 -19.5001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  15  18.......AMKMTVVGFWGGFPEA--GEATSGYLFEHDGFRLLVDCGSG-----VLAQLQKY-ITPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLK-HPVTCFAMRITAGND-IVVYSADSCNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTH.......... 229
64 -19.1002ycb_A mol:protein length:636 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  18  186.....................GGFREVGRSCLYLQTPNSRVLLDCGVNVAGGDDKNSLNVPEFTLDSLDAVIITHAHLDHSGFLPYL-DGPVYCTAPDHIDIAHREDEPLPFNVKHVKKSVKHTITLDGEVTDIAPDIRLLHNAGHILGSAMAHLHIGDGQNMVYTGDF.............................................. 353
65 -19.0003af5_A mol:protein length:651 Putative uncharacterized protein PH1404  ali model follow..  16  195.....................GGFREVGRSALLVQTDESFVLVDFGVNVAMLNDPYK-FQYVLREGLLDAIIITHAHLDHCGMLPYLFRYNLFDGPIYTTPPTRDLMVLLQKDFIEIQQSNGQDPLYRGEVRDISPDIRLLHNAGHILGSAIVHLHIGNGLNIAITGDF.............................................. 368
66 -18.8002i7x_A mol:protein length:717 Protein CFT2  ali model follow..  8.....................CDDGSGTTVGSVVRFDNVTLLIDPGWNPSKVSYEQCIKYWEKVIPEIDVIILSQPTIECLGAHSLLYYGRVSTIDSYASAGVIGPYDTNKLDLEDIEISFDHIVPLKYSQLV--DGLTLLANAGVCPGGSIWCISTYSE-KLVYAKRWNHTRDNILN--AASILDATGKPLSTLMRPSAIITTLDRFGSSQPFK 224
67 -18.7003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  19  17.............................ASYLVQETGEACVIDP-----ARDVEPYLLTAKREGLRIVAALETHIHADFVSGMADRAGAAICVSDEGPPEWKS-----------EYVKAYPHRLLKDGDELHFGNRIVVMHTPGHTPEHVSYLLYDGKSGDFVFVGDVLLERVAGESGSSEALARQMFRSLRKFEALPQVLPAHGA........ 201
68 -18.6003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  20  32.............................ASYLIQKTGEAMIIDP-----IRDLSSYIRVADEEGLTITHAAETHIHADFASGVAIKLNANIYVSGE------------SDDTLGYKNMPNHTHFVQHNDDIYVGNKLKVLHTPGHTPESISFLLTDEGSGDFIFVGDILLEKAVKVEGSSEIGAKQMFKSIESIKDLPQIWPGHGA........ 215
69 -18.4004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  14  41..........................TTSNSYVIE-GDKTAIIDPPVESFMKIYLEALQQT-VNLKKLDYVILGHFSPNRIPTFKLAPQITFVCSLPAAGDLRAAFPD----------DNLNILPMRGKETLDLGKGLKFLPIP-RWPA---GLCTYDVQTQILYTDKIFEDQRYYFNCLMAPHAIHVEAALEKISDLQVYAVGHGPLVRTSLIA 241
70 -18.4003h3e_A mol:protein length:267 uncharacterized protein Tm1679  ali model follow..  17  1MGSDKIMRIHVLCDDSS---QNGFESEHGFSVLVDS----VLFDTGKS---DVFLKNARKLGID---PKDVLISHGHYDHAGGLLYLSGKRVWLRKEALDQKYSGERYAGADWNEVLYYNTG--KFVIERITEIGKNMFLLGRKDLFEDEQTLVVRTKE-GLVVITG................................................ 173
71 -18.2001vme_A mol:protein length:410 Flavoprotein  ali model follow..  16  44..........................ISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKI-VDPKEITHIIVNHTEPDHSGSLPATHDVEIIASNFGKR------------LLEGFYGIKDVTVVKDGEEEIGGKKFKFVMTP-HWPDTMVTYLD-----GILFSCDVGGGYLLPEILDDSNESVVERYLPHVTKYIVTVIGHYKNYILEGAEK 221
72 -18.1002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  18  13.....................SGILTIGGTVIEVAYKDAHIFFDFGTEDLPDDHIETLINNRLVPEQHTAVFLSHAHLDHSRMINYLPAVPLYTLKETKMNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPDHDYGASALLIRTPD-HFITYTGDL---------RLHGHNREETLAFCEKAKHTELLM............. 214
73 -18.0002xr1_A mol:protein length:640 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  18  190.....................GGCKEVGRSCFLLSTPESRILIDCGVNVGSDENMTPYVPEVFPLNQIDAVIVTHAHLDHQGLVPLL-EGPVYCTPPDYIDVAAKEGKKIPYESGMVAKTLKHTIPLDEEVTDIAPDIKLFHNAGHILGSAISHFHIGDGLNVVFTGDYKYEKTRLFDPAVNKFPRVETVISEAT.................... 382
74 -17.8002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  18  23...............................VLTNDEGRCVIVDPG---EAAPVLKAIAEHKWM---PEAIFLT----DHVGGVQHFPQMTVYGPAETQ--------------------KGATHLVGDGDTRVLGEKFTLFATPGHTLGHVCYF-----SRPYLFCGDTLFSG-GRLFEGTPSQMYQSLMKINSLPDDTLICCAHE......... 169
75 -17.7002dkf_A mol:protein length:431 metallo-beta-lactamase superfamily protein  ali model follow..  17  7.....................GAAREVTGSAHLLLAGGRRVLLDCGMFQGKEEA-RNHAPFGFDPKEVDAVLLTHAHLDHVGRLPKL-RGPVYATRATVLLMEIVLEDALKVMDEPFFGPEDVEEALG-GEWLRLGALSLFGQAGHLPGSAFVVAQGEGR-TLVYSGDL.............................................. 163

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 3 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]