current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2ohh_A mol:protein length:404 Type A flavoprotein fprA, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400
# Score Template Links and tools%idFirst MKAAAKRISDGVYWTGVLDWDLRNYHGYTLQGTTYNAYLVCGDEGVALIDNSYPGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLKHYPSLREAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKFYANLITPLSKLVLKKFDEVKELGLLERIQMIAPSHGQIWTDPMKIIEAYTGWATGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSEGVDVRVYCLHEDDRSEIVKDILESGAIALGAPTIYDEPYPSVGDLLMYLRGLKFNRTLTRKALVFGSMGGNGGATGTMKELLAEAGFDVACEEEVYYVPTGDELDACFEAGRKLAAEIRRLast
1 -128.0002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model  100  1MKAAAKRISDGVYWTGVLDWDLRNYHGYTLQGTTYNAYLVCGDEGVALIDNSYPGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLKHYPSLREAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKFYANLITPLSKLVLKKFDEVKELGLLERIQMIAPSHGQIWTDPMKIIEAYTGWATGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSEGVDVRVYCLHEDDRSEIVKDILESGAIALGAPTIYDEPYPSVGDLLMYLRGLKFNRTLTRKALVFGSMGGNGGATGTMKELLAEAGFDVACEEEVYYVPTGDELDACFEAGRKLAAEIRR 404
2 -114.0001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  32  1..MQATKIIDGFHLVGAIDWNSRDFHGYSPMGTTYNAYLVE-DEKTTLFDTVKAEYKGELLCGIASV---IDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFH-YKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGAGV--APEFICPDHGVIFRQCTFAVQKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVKLMWCKACHHSQIMSEISDAGAVIVGSPTHNNGILPYVAGTLQYIKGL---RPQNKIGGAFGSFGWSGESTKVLAEWLTGMGFDMPTPVKVKNVPTHADYEQLKTMAQTIARALKA 398
3 -114.0001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  41  2...QPVAITDGIYWVGAVDWNIRYFHGPTHRGTTYNAYLIV-DDKTALVDTVYEPFKEELIAKLKQI---KDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYS-HIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINL--AIKTIAPSHGIIWRDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGL---RPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIPGPTVQWVPRGEDLQRCYELGRKIAARIAD 398
4 -111.0002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  30  8..VQDQEMIPGVYWVGIVDWMVRIFHGYTDEGSSYNSYFID-DECPTVIDSVKYPFAEEWLSRIAAC---CPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYG-MEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANILGLFSAQMRKALEVASTV----EIKYILSAHGVSWRGDGLAIAEYDRWSKGQHQKKVTVVLDSMYGTTHRMALALLDGARSTGCETVLLEMTSSDITKVALHTYDSGAVAFASPTLNNTMMPSVAAALNYVRGLTL--IKGKPAFAFGAFGWSNRAVPDIVAELRDCKADVYKGITFKFNYTEELLEQAYNAGVDLGKRAIA 405
5 -108.0004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  37  1...MSIVVKNNIHWVGQRDWEVRDFHGTTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNE---IDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGPE-----WNFNVVKTGDTLDIGNKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFEQCQRYYANILTPFSRLVTPKITEILGFNL--PVDMIATSHGVVWRNPTQIVELYLKWAADYQEDRITIFYDTMSNNTRMMADAIAQGIAETDVAVKIFNVARSDKNEILTNVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGL---RFRNKRASAFGSHGWSGGAVDRLSTRLQDAGFEMSLSLKAKWRPDQDALKLCREHGREIARQWAL 394
6 -95.8001vme_A mol:protein length:410 Flavoprotein  ali model follow..  26  10IWTERIFDDPEIYVLRIDDDRIRYFEAVIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKI---VDPKEITHIIVNHTEPDHSGSLPATLKTIHDVEIIASNFGKRLLEGFYGI---KDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGGGYLLPEILDSNESVVERYLPHVTKYIVTVIGHYKNYILEGAEKLSSL----KIKALLPGHGLIWKDPQRLLNHYVSVAKGDPKKKVTVIYDSMYGFVENVMKKAIDSLKEKGFTYKFSDEERPAISEILKDIPDSEALIFGVSTYEAEIHPLMRFTLLEIIDKAN---YEKPVLVFGVHGWAPSAERTAGELLKETKFRILSFEIKGSNMDERKIEEAISLLKKELE.... 404
7 -81.9004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  20  7RDVQVLPIATNTKVLRARSWSRLRFEIELERGTTSNSYVIE-GDKTAIIDPPVESFMKIYLEALQQT---VNLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAGDLRAAFP-DDNLNILPMRGKETLDLGKHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDNWE--SFKEDQRYYFNCLMAPHAIHVEAALEKISDL----QVRLYAVGHGPLVRSLIALTQAYADWSKAQKLE................................................................................................................................................... 256
8 -45.6003hly_A mol:protein length:161 Flavodoxin-like domain  ali model follow..  22  2.................................................................................................................................................................................................................................................................SVLIGYLSDYGYSDRLSQAIGRGLVKTGVAVEMVDLRAVDPQELIEAVSSARGIVLGTPPSQPS--EAVATALSTIFAA---AHNKQAIGLFDSYGGDDEPIDALLAQFRNLGLHTAPPIRVKDQPTEAIYQQCEESGTDLGQWLTR 144
9 -44.5003fni_A mol:protein length:159 Putative diflavin flavoprotein A 3  ali model follow..  20  1............................................................................................................................................................................................................................................................TKAETSIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAVDLQELRELVGRCTGLVIGMSPAASA--ASIQGALSTILGSV---NEKQAVGIFETGGGDDEPIDPLLSKFRNLGLTTAPAIRIKQTPTENTYKLCEEAGTDLGQWVTR 149
10 -33.8002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  14  5...SSGLVPRGSHMLRLSAPGQLDDDLCLLGDVQVPVFLLRGEASWALVEGGISRDAELVWADLCRW--VADPSQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAWKSEACAWDALPVRAVADGEWLELGPRRLQVIEAH--HSDDHVVFYDVRRRRLFCGDALGEFDEAEGVWRPLVFDD--------------------MEAYLESLERLQRLPTLLQLIPGHGGLLRGRLAADGAESAYTECLRLCRRLLWRQSMGESLDELSEELHRAWGGQSVDFLPGELHLGSMRRMLEILSRQA............................................................................................... 311
11 -29.4001fln_A mol:protein length:138 FLAVODOXIN  ali model follow..  21  1..................................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELL----NEDILILGCSAMGPEVLEE--SEFEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIAN.... 137
12 -26.7002fax_A mol:protein length:138 FLAVODOXIN  ali model follow..  23  1..................................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELL----NEDILILGCSAMGDEVLEE--SEFEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIAA.... 137
13 -25.6004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  17  41..AMPQKVYGNTWYVGT---------------CGISALLVTSDAGHILVDAATPQAGPQILANIRAL--GFRPEDVRAIVLSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRTDPQFVTLADDGVVSVGPLALTAVASP--HTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRN---------------TLARVAAL----DCDILVTPHPSASGLWNR---------IGPRAAAPLMDTTACRRYAQGARQRLEKRLAEE........................................................................................................................ 292
14 -25.1004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  17  41..AMPLKVYGNTWYVGT---------------CGISALLVTSDAGHILVDAATPQAGPQILANIRAL--GFRPEDVRAIVFSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRTDPQFVTLADDGVVSVGPLALTAVASP--HTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRN---------------TLARVAAL----DCDILVTPHPSASGLWNR---------IGPRAAAPLMDTTACRRYAQGARQRLEKRLAEE........................................................................................................................ 292
15 -24.9003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  14  9..QQPFTIYGNTHYVGT---------------GGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAM--GFKLSDVKYILSTHSHEDHAGGISAMQKLT-GATVLAGAANVDTLRTGVSPKSDPQFRAVADGELVKLGPLAVKAHATP--HTEGGITWTWQSCEQGKCKDV---------VFADSLTAVSADSYRFSDHPEVVASL----RGSFEAVEKL----SCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAI------AAAGRKRLETRLASE........................................................................................................................ 260
16 -24.4005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  16  14..QAPFRLFGNTYYVGMKG---------------LSSVLVTSPQGHVLIDGGLPESAPKIIANIGAL--GFRIEDVKLILNSHGHIDHAGGLAELQRRS-NALVAASPSAALDLASGEVGPDDPQYRLARDGGQFNVGPVYLTAHATP--HTPGGLSWTWQSCD-MVYADSINAVSRPGFKFSASSEYPNALAD---------------LRHSFETLEKL----PCDVLISAHPEASQLWQRL-------ASATGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQQ..................................................................................................................... 271
17 -24.3001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  17  21..MAPLQIADHTWQIGT---------------EDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKAR--GVTPRDLRLILLSHAHADHAGPVAELKRRT-GAKVAANAESAVLLARGGSDDLHFG-RIVMDGEVITVGGIVFTAHFMA--HTPGSTAWTWTDTRNGKPVRI---------AYADSLSAPGYQLQGNPRYPHLIEDY----RRSFATVRAL----PCDVLLTPHPGASN------------WDYAAGARAGAKALTCKAYADAAEQKFDGQLAKETAGAR................................................................................................................... 269
18 -24.0001fla_A mol:protein length:138 FLAVODOXIN  ali model follow..  22  1..................................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNID----ELLNEDILILGCSAMDDEVLEE--SEFEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIAN.... 137
19 -23.9003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  16  38..FEPFQLIDNIYYVGT---------------DGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKL--GFKVADIKLILNTHAHLDHTGGFAEIKKET-GAQLVAGERDKPLLEGGYYPGDEKN-RAVKEGDRVTLGDTTLTAHATP--HSPGCTSWEMTVKDGKEDREV---------LFFCSGTVALNRLVGQPTYAGIVDDY----RATFAKAKAM----KIDVLLGPHPEVYGMQAKRAEMKDGAPNPFIKPGELVTY------ATSLSEDFDKQLAKQTAALE................................................................................................................... 292
20 -23.7001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  13  8..FPPFRIAGNLYYVGTDD---------------LASYLIVTPRGNILINSDLEANVPMIKASIKKL--GFKFSDTKILLISHAHFDHAAGSELIKQQT-KAKYMVMDEDVSVILSGGKSDFHYA-KVLHDGERVELGGTVLTAHLTP--HTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAEDY------------KHSIKVLESM----RCDIFLGSHAGMFDLKNKYVLL------SKGQNNPFVDPTGCKNYIEQKANDFYTELKKQ........................................................................................................................ 260
21 -23.5002fz5_A mol:protein length:137 Flavodoxin  ali model follow..  22  2..................................................................................................................................................................................................................................................................VEIVYWSGTGNTEAMANEIEAAVKAAGADVESVRFEDTNVDDVA----SKDVILLGCPAMGSEELED--SVVEPFFTDLAPKLKGKKVGLFGSYGWGGEWMDAWKQRTEDTGATVIGTAIVNEMP--DNAPECKELGEAAAKA... 137
22 -23.2003kap_A mol:protein length:147 Flavodoxin  ali model follow..  16  1................................................................................................................................................................................................................................................................SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLADG---YDAVLMGCSAWGMEDLELQDDFAPLFDEMENMGLKGKKLAAFASGDMECGAVPAIEEKARGLGAEVICEGLKIEGDASSDPDAVSAFAEDVLKKL.. 147
23 -22.7001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  15  1.DVKIEKLKDNLY--------YTTYNTFNGTKYAANAVYLVTDKGVVVIDC---PWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKI--GAKTYSTKMTDSILAKENKPRAQ---YTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNI---------------------QQKFSGAQYVVAGHDDW........................................................................................................................................................................ 199
24 -22.6003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  20  21...................................TVYVMCGEKLTVMIDA-------------NSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQV-YKAKVLVKSGFKKYLTGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTP--HARHHMSVLV--DDFLFTGDSAGA-----------------------YFNGVVIPTTPMYMESLKRQIELK-----KVVGFAHG.......................................................................................................................................................................... 208
25 -22.6003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  14  5.FVIEPPIKNNLH--------YKTFGVFGGKEYSANSMYLVTKKGVVLFDV---PWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNK--GIKTYATAKTNEFLKKDGKATST---EIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKL---------------------KAKYSKATLIIPGHDEW........................................................................................................................................................................ 203
26 -22.6003f6r_A mol:protein length:148 Flavodoxin  ali model follow..  15  2................................................................................................................................................................................................................................................................SKVLIVFGSSTGNTESIAQKLEELIAAGGHEVTLLNAADASAENLADG---YDAVLFGCSAWGMEDLEMQDDFLSLFEEFDRIGLAGRKVAAFASGDQECGAVPAIEERAKELGATIIAEGLKMEGDASNDPEAVASFAEDVLKQL.. 148
27 -22.4005aeb_A mol:protein length:272 LRA-12  ali model follow..  14  21..YRPFRIAGNLYYIGTYD----------------ACYLITTKQGNIIVNTGLAASALQIKNNIKAL--GFKLTDTKILLTTQAHYDHLGAMAEIKKIT-GAKLMADEGDATVMADGGSSDYAF--RLLHDKDTIQLGDTKLVMLHHP--HTKGSCSFLFDTKRILIANM-------PTIVIEKKFSEVSSYPGIAKDY-----------AYTLQAMKNL----SFDIWVASHA----SQFSMHSKHKP--GDGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN........................................................................................................................ 272
28 -22.4002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  17  10.TISISQLNKNVW--------HTELGSFNGEAVPSNGLVLNTSKGLVLVDS---SWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKER--GIKAHSTALTAELAKKNGYEEPL---GDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSL-------------------VKSTSAKDLGNVADAYVNEWSTSIENV--LKRYRNINAVVPGHGEV........................................................................................................................................................................ 208
29 -22.0002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  16  16.TISISQLNKNVW--------HTELGSFNGEAVPSNGLVLNTSKGLVLVDS---SWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKER--GIKAHSTALTAELAKKNGYEEPL---GDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCL-------------------VKSTSAKDLGNVADAYVNEWSTSIENV--LKRYRNINAVVPGHGEV........................................................................................................................................................................ 214
30 -21.9001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  19  10.DISITQLSDKVYYVSLAEIE---------GMVPSNGMIVINNHQAALLDT---PINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKK--GVQSYANQMTIDLAKEKGLPVPE---HGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCM-------------------LKDNQATSIGNISDADVTAWPKTLDKVKAK--FPSARYVVPGHGDY........................................................................................................................................................................ 209
31 -21.7001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  20  10.DISITQLSDKVY--------VSLAEIEGWGMVPSNGMIVINNHQAALLDT---PINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRK--GVQSYANQMTIDLAKEKGLPVPE---HGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCM-------------------LKDNQTTSIGNISDADVTAWPKTLDKVKAK--FPSARYVVPGHGNY........................................................................................................................................................................ 209
32 -21.4003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  16  10.TISISQLNKNVW--------HTELGSFNGEAVPSSGLVLNTSKGLVLVDS---SWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKER--GIKAHSTALTAELAKKNGYEEPL---GDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCL-------------------VKSTSAKDLGNVADAYVNEWSTSIENV--SKRYRNINAVVPSHGEV........................................................................................................................................................................ 208
33 -21.0004heq_A mol:protein length:146 Flavodoxin  ali model follow..  20  2................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEGVAEAIAKTLNSEGMETTVVNVADVTAPGLAEG---YDVVLLGCSTWGDDEIELQEDFVPLYEDLDRAGLKDKKVGVFGSYTYFCGAVDVIEKKAEELGATLVSSLKIDGEPDSAEVLDAREVLARV...... 146
34 -20.8005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  14  25.EVRLYQIADGVW--------HIATQSFDGAVYPSNGLIVRDGDELLLIDT---AWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKA--GVATYASPSTRRLAEAEGNEIPTHSLGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSANVLYGGCA-------------------VLALSRTSAGNVADADLAEWPTSVERIQKH--YPEAEVVIPGHGLP........................................................................................................................................................................ 225
35 -20.5004tyf_A mol:protein length:231 NDM-4  ali model follow..  15  9.DLVFRQLAPNVWHTSYLDMP---------GAVASNGLIVRDGGRVLVVDT---AWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGLVAAQHSLTFAANEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCL-------------------IKDSKAKSLGNLGDADTEHYAASARAFGAA--FPKASMIVMSHSAP........................................................................................................................................................................ 214
36 -20.4003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  16  15.DLVFRQLAPNVWHTSYLDMP---------GAVASNGLIVRDGGRVLVVDT---AWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCL-------------------IKDSKAKSLGNLGDADTEHYAASARAFGAA--FPKASMIVMSHSAP........................................................................................................................................................................ 220
37 -20.0004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  14  6.ELRIEKVKENIFHTSYSRVN-----------VSSNGLVVIDKGNAFIVDT---PWSDRDTETLVHWIRKNG-YELLGSVSTHWHEDRTAGIKWLNDQ--SISTYATTSTNHLLKE----NKKEPAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNA---------------------LSRYSEAQIVIPGHGKI........................................................................................................................................................................ 203
38 -19.8003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  14  22.DLVFRQLAPNVWHTSYLDMP---------GAVASNGLIVRDGGRVLVVDT---AWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAA--FPKASMIVMSHSAP........................................................................................................................................................................ 227
39 -19.8004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  16  21.DLVFRQLAPNVWHTSYLDMP---------GAVASNGLIVRDGGRVLVVDT---AWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCL-------------------IKDSKAKSLGNLGAADTEHYAASARAFGAA--FPKASMIVMSHSAP........................................................................................................................................................................ 226
40 -19.8002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  17  1....MKALLPGLYLLPV-----------IPYPLKTNLYLLQGAGEVALVDT-TRAARGALELHLAEL--GLCFQDVKTILLTHHHPDHYGLSGFFEGL--GARVFLHEEEFARGHRFWREPEAFNPLPLRDGEALEVAGKRLRVLWTP--HADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKD----------------FLRSLDRLADL----GARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALL------DGPKTAWELSLHLFPQELDPAGRRFAFAETLAHLEYLREEGAV............................................................................................. 305
41 -19.7004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  13  43.EVRLYQIADGVW--------HIATQSFDGAVYPSNGLIVRDGDELLLIDT---AWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEAEGNEIPTHSLGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSANVLYGGCA-------------------VLELSSTSAGNVADADLAEWPTSVERIQKH--YPEAEVVIPGHGLP........................................................................................................................................................................ 243
42 -19.7002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  19  6.PLEVIKIEDGVY--------HTSFKNIEGYGVDSNGLVVLDNNQAYIIDT---PWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLAREGKPVPTHYF----KDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNI---------------------VSKKYPIQMVVPGHGKV-----------------GSSDILDHTIDLAESASNKLMQPTAEASAD......................................................................................................................... 233
43 -19.7004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  18  6.DLKIEKLDEGVY--------TSFEEVNGWGVVPKHGLVVLVNAEAYLIDTFTAKDTEKLVTWFVER-----GYKIKGSISSHFHSDSTGGIEWLNSR--SIPTYASELTNELLKKDGKVQATNSF----SGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFI-KPYGLGNLGDANIEA----------------------PKSAKLLKSK--YGKAKLVVPSHSEV........................................................................................................................................................................ 200
44 -19.7003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  13  5.NLTLTHFKGPLYIVEDKE------------YVQENSMVYIGTDGITIIGA---TWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTL--GAKIVATQMTYDLQKSQWGSIVNFTLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCI-------------------LKENLGNMSFANRTEYPKTLEKLKGLIEQGEL--KVDSIIAGHDTPIHDVGLI................................................................................................................................................................. 221
45 -19.6005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  15  21.DLVFRQLAPNVWHTSYLDMP---------GAVASNGLIVRDGGRVLVVDT---AWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAANEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCL-------------------IKDSKAKSLGNLGDADTEHYAASARAFGAA--FPKASMIVMSHSAP........................................................................................................................................................................ 226
46 -19.5004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  16  24.DLVFRQLAPNVWHTSYLDMP---------GAVASNGLIVRDGGRVLVVDT---AWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCL-------------------IKDSKAKSLGNLGDADTEHYAASARAFGAA--FPKASMIVMSHSAP........................................................................................................................................................................ 229
47 -19.4002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  15  42.EVRLYKIGDGVW--------HIATQKLGDTVYSSNGLIVRDADELLLIDT---AWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAA--GVATYTSPLTRQLAEAAGNEVPAHSLALSSSGDVVRFGPVEVFYPGA---HSGDNLVVYVPAVRVLFGGCA-------------------VHEASRESAGNVADANLAEWPATIKRIQQR--YPEAEVVIPGHGLP........................................................................................................................................................................ 242
48 -19.4001akq_A mol:protein length:147 FLAVODOXIN  ali model follow..  17  1................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI.. 147
49 -19.3004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  17  7.DLKIEKLEEGVYHTSFEEVN-----------VSKHGLVVLVNTDAYLIDT---PFTATDTEKLVNWFVERG-YKIKGTISSHFHSDSTGGIEWLNSQ--SIPTYASELTNELLKKDGKVQAKNSF----SGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFV-------------------------KPDGLGNLGDANLEAWPKSAKILSKYVKAKLVVSSHSEI........................................................................................................................................................................ 201
50 -19.3002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  13  43.EVRLYQIADGVW--------HIATQSFDGAVYPSNGLIVRDGDELLLIDT---AWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEVEGNEIPTHSLGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEW-------------------PTSIERIQQH--YPEAQFVIPGHGLP........................................................................................................................................................................ 243
51 -19.2001f4p_A mol:protein length:147 FLAVODOXIN  ali model follow..  17  1................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCWEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI.. 147
52 -18.9004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  13  48.DLVFRQLAPNVWHTSYLDMP---------GAVASNGLIVRDGGRVLVVDT---AWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAANEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAA--FPKASMIVMSHSAP........................................................................................................................................................................ 253
53 -18.8004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  12  13.NLTATKIDSDVFVVTDRD------------FYSSNVLVAKMLDGTVVI--VSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKM--GAETWSSDLTKQLRLEE-HPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMI-KPKELGYLGDANVKA----------------------PDSARRLKKFD----AKIVIPGHGEW........................................................................................................................................................................ 228
54 -18.7001i1o_A mol:protein length:147 FLAVODOXIN  ali model follow..  17  2.................................................................................................................................................................................................................................................................KALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCHEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI.. 147
55 -18.6005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  18  23.PLEVIKIEDGVYLH------TSFKNIEGYGLVDSNGLVVLDNNQAYIIDT---PWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLAREGKPVPTHYF----KDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSKKY---------------------PIQMVVPGHGKV-----------------GSSDILDHTIDLAESASNKLMQPTAEASAD......................................................................................................................... 250
56 -18.5004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  19  8...RVERLSNRVVRVLGCNPGPMTLQGT-------NTYLVGTGPRRILIDTGEPA-IPEYISCLKQALTEFN-TAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQYVYLKDGDVIKTEGATLRVLYTP--HTDDHMALLLEEENAIFSGDCILGEGTT------------VFEDLYDYMNS------------LKELLKIK-----DIIYPGHGPVIHNAEAKIQQYI--SHRNIREQQILTLFRENFEKSFTVMELVKII--KNTPENLHEMAKHNLLLHLKKLEKEGKIF............................................................................................ 276
57 -18.2001j9e_A mol:protein length:147 FLAVODOXIN  ali model follow..  17  2.................................................................................................................................................................................................................................................................KALIVYGSTTGNTEYTAETIARELADAGYEVDCRDAASVEAGGLFEG---FDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI.. 147
58 -18.0001fx1_A mol:protein length:148 FLAVODOXIN  ali model follow..  17  2................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARQLANAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI.. 148
59 -18.0001akr_A mol:protein length:147 FLAVODOXIN  ali model follow..  17  1................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWADDSIELQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI.. 147
60 -17.6001wsb_A mol:protein length:148 FLAVODOXIN  ali model follow..  17  2................................................................................................................................................................................................................................................................AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDCIELQDDFIPLFDSLEETGAQGRKVACFGCYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI.. 148
61 -17.6001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  12  2.GMSLTQVSGPVYVVEDN------------YYVQENSMVYFGAKGVTVVGA---TWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSI--GAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEDGDFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCIL--------------------------KEKLGNLSFADVKAYPQTLERLAMKLPIKTVIGGHDSPLHGP-ELIDHYEALIKAAPQSS.................................................................................................................................................. 228
62 -17.4001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  17  27................................HFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSEL--GISPDDITDVLFTHVHLDHIFNSV----LFENATFYVHEVYKTKNYLYSKVISSWKNVVLLKGEE-SLFDEKVKVFHTP--HAREHLSFLLDTENVLITGDIT--------------------PNRLSYYDIIKGYGSVQVKNFLDRVGRIDL-----LVFPHDAPLKPEVKK.................................................................................................................................................................. 215
63 -17.4002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  19  20..............................RNIDFNGFAWIRPEGNILIDP--VALSNHDWKHLESL------GGVVWIVLTNS--DHVRSAKEIADQT-YTKIAGPVAEKENF-------PIYCDRWLSDGDELVPG---LKVMELQGSKTPGEL-ALLLEETTLITGDL---------VRAYRAGGLEILPDEKLM-----------KQKVVASVRRLAALEKVEAVLVGDG.......................................................................................................................................................................... 182
64 -17.0004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  18  66................................GGAEAALEEAARGPILVDTGGPWAREALLGALAGQ--GVAPGDVTLVVGTHGHSDHIGNLG----LFPGAALLVSHD-------FCLPGGRYLPHGLGEGQPLRLGP-GLEVWATP--HGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKR------------------------VLVVADVVVPGHGPPFR...................................................................................................................................................................... 236
65 -16.1002ark_A mol:protein length:188 Flavodoxin  ali model follow..  29  6.................................................................................................................................................................................................................................................................KVLVIYDTRTGNTKKMAELVAEGARSEGTEVRLKHVDEATKEDVL----WADGLAVGSPTNMGLVSWKMKRFFDDVLGDLWGEIDGKIACAFSSGGGNEVACMSILTMLMNFGFLVFGAVVAGEPRSEEEKEACRRLGRRLAEWVAI 167
66 -15.4005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  12  23...DTFEVAPGVRWLRM-----------LPFSLDHNLWLLRGQAGWTIVDCISSEAIRTHWEQI--FDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGDNVRLWMTLGEYMFGCLMAAGNGS-RYRRLREGDAVKIGARTWRVVTGY--HSPEHCALHSEADGVLISGDMV----------------------LPRISTNVLEPEANPLALYLESLGRYETMAPDTLVLPSHGKPFRGVRTRIAQLRA----HHDARLEEVRVACAEKPMSAAGIVPIMFRRRELDIHQMTFALGEALAHLNLLWLAGEL............................................................................................. 345
67 -15.1002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  23  14...................................NAYLVETGEGPVLIDPGDEP------EKLLALFQTTGL-IPLAILLTHAHFDHVGAVAPLVEAL-DLPVYLHPLDLPLYEGADLAARAWGLAILEEGMRL----FGFQVLHLP--HSPGHVAFYDPEGAQVFSGDL---------LFRGSVGRYDL---------------GADPKALFASLKRLLSLPPETRVHPGHGP......................................................................................................................................................................... 186
68 -14.1004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  17  8.......................LLRQMFEPVSCTFTYLLGDREEAVLIDPV------ETAPRDAQLIKELGL-RLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQAD-----------LHIEDGDSIRFGRFALETRASP--HTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQ--------GCAKTLYHSVHEKIFTLPGDCL--------------IYPAHDYHGFTVSTVEETLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMR.......................................................................................................................... 230
69 -14.0002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  41................................IPVSAYLIQCTDATVLYDTYIGASECNLPERLRQL--GLSPDDISTVVLSHLHNDHAGCV----EYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDERERELAPGVNLLNFGT--HASGMLGLAVRLEKFLLVSDAC-----TATNYGPPARRAGVLHDTIGYDRT------------VSHIRQYAESRSLTVLFGHDREQFASLIKSTDGFYE........................................................................................................................................................... 276
70 -14.0003d7n_A mol:protein length:193 Flavodoxin, WrbA-like protein  ali model follow..  18  2...........................................................................................................................................................................................................................................................TTNSSSNTVVVYHSGYGHTHRMAEAVAEGAEAT---LHAIDAEGNLSEDGWAALDAADAIIFGTPTYMGGPSWQFKKFADASSKPWFSAKQDKVFGGFTNSA-NGDKLNTLQYLVLLAPMAQSDADAAPEEMSVGDLETARLYGARVANVARQ 186
71 -14.0002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  29....................................SLLLKKGNKEIVVDT---GQSENFIKNCGLM--GIDVGRIKKVVLTHGHYDHIGGLKGLLERNPEVKIYTHKEILN--KKYAMRKGGQFEEIGFDLSFYEKYKNNFVLIDKDAEIEEGFYVITNTDITYDNEFTTKNFFVEKEGKRDKFLDEVFVVVKEEDGINVVTGCSHAGILNILETARNRFGVSYIKLIGGFH--LRGMEEEKVKDIARKIEEYGVKKVLTGHCTGIDEYGFLKSVLKDKISYLTTSSSI.................................................................................................................. 276
72 -12.9002r96_A mol:protein length:198 Flavoprotein WrbA  ali model follow..  25  3.................................................................................................................................................................................................................................................................KVLVLYYSMYGHIETMARAVAEGASKDGAEVVVKRVPETMPPQLFEELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLASGALYGKLASVFSSTGTGGGQEQTITSTWTTLGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVK 195
73 -12.9003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  14  33................................FPVYSILIEHAEGRFLIDTPIQEKHQTIPGALGLL--GLEPRDIDVVVNSHFHFDHCGGN----KYFPHAKKICHRSEVPQACN--TTRANSTFEGIDGDVDLARG---VKLISTP--HSIGHYSLLVEFPRILFTIDAAYTQKSLETLCQAAFHID-----------------PVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFY............................................................................................................................................................. 267
74 -12.9001zwk_A mol:protein length:207 Trp repressor binding protein WrbA  ali model follow..  23  2...........................................................................................................................................................................................................................................................ASLSSPYILVLYYSRHGATAEMARQIARGVEQGGFEARVRTVPAVSTECEAVDLKNCAGLALGSPTRFGNMASPLKYFLDGTSSLLTGSLVGKPAAVFTSTA-GGQETTQLSMLLPLLGASHFAGADGKRSLDEHELTLCRALGKRLAETAGK 198
75 -12.8005f4b_A mol:protein length:202 NAD(P)H dehydrogenase (quinone)  ali model follow..  23  6.................................................................................................................................................................................................................................................................KMLVLYYSAYGYMEQMAKAAAEGAREGGAEVTLKRVPELVPEEVAKELADYDAIIIGTATRYGMMASQMKNFLDQTGGLAKGALINKVGSVMVSTATQHGGAELALISTAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAK 199

FFAS is supported by the NIH grant R01-GM087218-01
1 0 8 9 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.