current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MRGSGSVEVQVLIENVVFARNFVAEHGLSLLLKKGNKEIVVDTGQSENFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPEVKIYTHKEILNKKYAMRKGGQFEEIGFDLSFYEKYKNNFVLIDKDAEIEEGFYVITNTDITYDNEFTTKNFFVEKEGKRIPDKFLDEVFVVVKEEDGINVVTGCSHAGILNILETARNRFGVSYIKSLIGGFHLRGMEEEKVKDIARKIEEYGVKKVLTGHCTGIDEYGFLKSVLKDKISYLTTSSSIVVLast
1 -111.0002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model  100  1MRGSGSVEVQVLIENVVFARNFVAEHGLSLLLKKGNKEIVVDTGQSENFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPEVKIYTHKEILNKKYAMRKGGQFEEIGFDLSFYEKYKNNFVLIDKDAEIEEGFYVITNTDITYDNEFTTKNFFVEKEGKRIPDKFLDEVFVVVKEEDGINVVTGCSHAGILNILETARNRFGVSYIKSLIGGFHLRGMEEEKVKDIARKIEEYGVKKVLTGHCTGIDEYGFLKSVLKDKISYLTTSSSIVV 278
2 -93.4003h3e_A mol:protein length:267 uncharacterized protein Tm1679  ali model follow..  33  1MGSDKIMRIHVLCDDSS-QNGFESEHGFSVLVD----SVLFDTGKSDVFLKNARKLGIDL--PKDVLISHGHYDHAGGLLYLSGKR----VWLRKEALDQKYSGER-----YAGADWNEVLYYNTGKFVIERITEIGKNMFLLGPANLRGKVPTGD--FFVERNGERRKDLFEDEQTLVVRTKEGLVVITGCSHRGIDNILLDIAETFN-ERIKMVVGGFHLLKSSDDEIEKIVKAFNELGVETVVPCHCTGERAVDIFKREFLGKIMDCYAGLKLEV 259
3 -23.0001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  16  1MGSDKIMELKILVTGGNVPGRLNAHFSTVVYLEHKDRRIIIDPGNLDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLF----ENATFYVHEVYKTKNYLSFGTIVG---RIYSKVISSWKNVVLLKGEESLFDEKVKVFH-----------------------TPWHAREHLSFLLDTENGRVLITG-DIIKGYGSVQVKNFLDRVGRIDLLVFPHD......................................................... 206
4 -21.6003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  15  1...MSDTKVYLLDGGSLVLDGYHVFWN-SILIEHAEGRFLIDTGKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYF----PHAKKICHRSEVPQACNPQPFEHLGYSDLSLEGTTRANSTFEGIDGDVDLARGVKLIS-----------------------TPGHSIGHYSLLVEFPRKPILFTIDAAYTQKSL-------------TLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSH............................. 252
5 -21.4004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  13  39....DPAMPQKVYGNT----WYVGTCGISALVTSDAGHILVDAAAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATG-APVYARAP----------------------------------------------IDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTGGTSWTWRSCE--DDCRQMVYADSLTAISDDVAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPL........... 268
6 -21.4003g1p_A mol:protein length:258 Protein phnP  ali model follow..  12  2.....SLTLTLTGTGGAQGVPAWGRQPCSGVVKFNDAITLIDAGL------HDLADRWSPGSFQQFLLTHYHMDHVQGLFPL-GVGDPIPVYGPPDEQGCDDLFKHPGL-------LDFSHTVEPFVVFDLQGLQVTPLPLNHSKLTFGYLLETAHSRVAWLSDTAGLPE----KTLKFLRNNQPQVMVMDCSHP-------------------------ADAPRNHCDLNTVLALNQVIRSPRVILTHISHQFDAWLMENALPSGFEVGFDGMEIGV 251
7 -21.3004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  12  39....DPAMPLKVYGNT----WYVGTCGISALVTSDAGHILVDAAAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATG-APVYARAP----------------------------------------------IDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTGGTSWTWRSCE--DDCRQMVYADSLTAISDDVAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPL........... 268
8 -21.2003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  10  28............................AVLLSSPQGHILVDGTTEKVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTG-ATVLAGAA----------------------------------------------VDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTGGITWTWQSCEQGKCKDV-VFADSLTAVSADSASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRA................ 228
9 -21.0005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  12  33............................SVLVTSPQGHVLIDGGSAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRSN-ALVAASPSAAL----------------------------------------------LASGEVGPDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTGGLSWTWQSCDGPRCLNM-VYADSINAVSRPGADLRHSFETLEKLPCDVLISAHPEASQLWQRLEASATGG............ 240
10 -20.5001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  13  27............................SYLIVTPRGNILINSDLEAMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDV----------------------------------------------SVILSGGKSDFHYANDSSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTGCTTWTMKLKDHGKQYQA-VIIGSIGVNPGYKEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVLLSKGQ............ 232
11 -20.3005aeb_A mol:protein length:272 LRA-12  ali model follow..  12  40............................CYLITTKQGNIIVNTGSALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAE-IKKITGAKLMADEG-------------------DATVMADGGSSDYAFGGHGSMFEPI---------------------------IADRLLHDKDTIQLGDTKLVMLHHPGHTGSCSFLFDTKDEQRSYRILIAFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPG................ 240
12 -20.2002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  13  45............................AYLIQCTDATVLYDTGSECNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYF----GKSRLIAHEDEFATAVRYFATGDHSSPYIVKDI-PRNWDLVGRDERERELAPGVNLLNFGTGHAS----------------------MLGLAVRLEKQPGFLLVS-------DACYTATNYGPPARRAGVLHDTIGYDRTVSHIRQ----YAESRSLTVLFGH............................. 259
13 -20.1001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  14  40............................ALLVQTPDGAVLLDGGMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTG-AKVAANAE-------------------SAVLLARGGSDDLHFGDGITYPP----------------------------ANADRIVMDGEVITVGGIVFTAHFMAGHTGSTAWTWTDTRNGKPVRI-AYADSLSAPGHLIEDYRRSFATVRALPCDVLLTPH............................. 225
14 -20.0003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  13  57............................VYVIKTSQGLILMDTASTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETG-AQLVAGER-------------------DKPLLEGGYYPGDEKNEDLAFPA----------------------------VKVDRAVKEGDRVTLGDTTLTAHATPGHSGCTSWEMTVKDGKEDREV-LFFCSGTVYAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGMQAKRAEMKDGAPNPFIKPGELV. 270
15 -19.9003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  13  41............................CYLLETEEGPILVDTGEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAF----TNTPIIVQRTEYEAALHREE----------MKECILPHLNYKIIEGDYEVVPGVQLLY-----------------------TPGHSPGHQSLFIETEQGSVLLTI-------------DASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGH............................. 239
16 -19.8002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  13  39............................CYLLETEEGPILVDTGEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAF----TNTPIIVQRTEYEAALHREE----------MKECILPHLNYKIIEGDYEVVPGVQLLY-----------------------TPGHSPGHQSLFIKTEQGSVLLTI-------------DASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGH............................. 237
17 -19.2004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  21  70............................AALEEAARGPILVDTGGPEALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLF----PGAALLVSHDFCLP--------------------GRYLPHGLGEGQPLRLGPGLEVWA-----------------------TPGHGGQRDVSVVVTALGTVVVAG-------DVFERDGDEDSWQAL----------SEDPAAQERSRKRVLVV-ADVVVPGH............................. 231
18 -18.7002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  13  37..........................PVFLLRLGEASWALVEGGISELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASER-------------------TCQAWKSESAVRVVERLNRQLLRAEQRLPEACAWDALPVR---------------AVADGEWLELGPRHRLQVIEAHGHS-VVFYDVRRRRLFCGDALGEFDEAEGVWRPDMEAYLESLERLQRLPTLQLIPGH-RGRLAADGAESAYTECLRLC........ 259
19 -18.7004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  14  33APRGNVAELKTILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVD--LVFPNASIFISKDFNNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNKTLYSHFNFQL----APGHTPGLTVTTISSGNEMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTK---ARAFTSHLPWPGLGFTKVKAPGFE........................................ 286
20 -18.3003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  16  22............................VYVMCGEKLTVMIDAGVSNSIAD------SFLDKLDYIVLTHLHIDHIGLLPELLQV-YKAKVLVKSG--FKKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKLDQDKVIEV-------------------------------EGNEEFDLGGYRMRLIYTPGHARHHMSVLVDDFLFTGDSAGAYFNGV---VIDYKMYMESLKRQIELKPKVVGFAH............................. 207
21 -17.9003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  15  50............................PILIQTAQYNLIIDAGIGNGIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKS-TYWDKNKGDYSNKLILFEKHFEPVPGIKMQ----HSGGHSFGHTIITIESQGDKA---HMGDI-FPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAY...................................... 270
22 -17.3003md7_A mol:protein length:293 Beta-lactamase-like  ali model follow..  12  17TSPRNCLRFTLLGCGSSPGVPRINRRRASLLVERNNTVVVIDTGPD-----RMQMIDSGVHMLDAAVYTHPHADHIHGIDDLVDNGRLMDVYANRLTRN-----------------------------------RLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEFSQVHGDIESLGFRIGSVVAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEV 285
23 -17.2004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  11  31FKDIPQQQVHEILKKYYADQEKGVQTSINFLVNIGKSLILIDSGAASCFLSNLKASGYQPEQVDTILLTHLHPDHVCGISK--ANFPNATVYVSND--EASFWLDPKQAAKLPKEKQANYLGTVEKIKQAIAPYQAKQRFKTYKLGDDIQGFKVINTAGHTP-----------HFSYELKTKGESIVFIGDIVHSHTVQFIDPKKAVETRLKQFATIAAPHLPFPGIGHTYSA............................................. 277
24 -17.0004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  13  62LKGIDDKDLQSLLARMFVASEKGVQTAVNYLINTGDNLVLIDTGAAQCVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKAKMNKLKPYKTEGELLPGVSLVA----SSGHTPGHTSYLFKSGGQSL-GDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAATDK---LWVAGAHLPFPGLGHVREEAQGYA........................................ 311
25 -16.9004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  13  62LKGIDDKDLQSLLARMFVASEKGVQTAVNYLINTGDNLVLIDTGAAQCVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKAKMNKLKPYKTEGELLPGVSLVA----SPGHTPGHTSYLFKSGGQSL-GDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDK---LWVAGAHLPFPGLGHVRKEAQGYA........................................ 311
26 -16.2001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  17  51..LLGDFEITALSDGTVA-QSALAKSFQGYLVNTGSKLVLVDTGAAGLLAANLKAAGYQPEQVDEIYITHMHPDHVGGLAVVRADQKEADFWLSQTNLDKAPDDESKGFFKGAMASLNPYVKAG-KFKPFSGNTDLVPGIKALA----SHGHTPGHTTYVVESQGQKL-GDLILVAAVQFDDPSVTTQLDSDSKSVAVERKKAFADAAKGG---YLIAASHLSFPGIGHIRAEGKGYR........................................ 319
27 -15.6001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  13  14.FQSNAMKMTVV--GFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVL---AQLQKYITPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGF-----HSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPVTC---------------------FAMRITAGNDIVVYSADS-PEFIPFTKDADLFICECNMYA--KAGHMNSTEVASIA------KDANVKELLLTHLP-ADLVTEAKQIFSGHITLAHSGYVWN. 261
28 -15.2005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  16  22..PVGEVRLYQIADGVWSHIATQSFDG-GLIVRDGDELLLIDTAWGA---KNTAALLAEIEKVTRAVSTHFHDDRVGGVDVLRKAG--VATYASPST-------------------RRLAEAEGNEIPTHSLEGLSSSGDAV----------RFGPVELFYPGAAHSTDN-------LVVYVPSANVLYGGCA-AEWPTSVERIQKHYPEAEV--VIPG-HGLPGGLDLLQHTANVVTAH...................................... 241
29 -15.0004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  18  2.ESLPDLKIEKLDEGVYVHTSFEEVNGWGLVVLVNAEAYLIDTPFTAKDTEKVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRS--IPTYASELTNE------------------------------------------------------------LLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHT---NVVVWLPER------KILFGG-NLGDANIEAWPKSAKLLKSKKAKLVVPSH............................. 197
30 -14.8004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  14  8.....DVQVLPIATNTKFEIEYALERGTTSYVIEGDKTAIIDPSFMKIYLEALQQT-VNLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAG---------------DLRAAFPDDNLNILPMRGKETLDLG--------------KGHVLKFLPIPSPRWPA------GLCTYDVQTQILYTD-AHICGDDVFDDNWESFKEDQRYYF----CLMAPHAIHVEAALEKISDLQVRLYAVGH............................. 231
31 -14.8004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  17  4..RLPDLKIEKLEEGVYVHTSFEEVNG-GLVVLVNTDAYLIDTPFTATDTEKVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQS--IPTYASELTNE------------------------------------------------------------LLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHT---NVVVWLPEK------KILFGG-NLGDANLEAWPKSAKILMSKKAKLVVSSH............................. 198
32 -14.7001ww1_A mol:protein length:280 tRNase Z  ali model follow..  17  6......................FSKALFSTWIYYSPERILFDAGEG-----VSTTLGSKVYAFKYVFLTHGHVDHIAGLWGVVDREKPLDVFYPEGNRAEEYTEFIKRANPDLRFSFNVHPLKEGERVFLRNAGGFKRYVQPFRTKHVSSEVSFGYHIFEVRRKLKKEFQGLDSKEISRLVKEKGRDFVTEEYHKKVLTISGDSLALDPERGTELLIHECTFLDARDRRIDEVMESVKAAGVKKVILYHISTKSVIKKYREEMPDEILYMDPRKVFEM 280
33 -14.5004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  16  40..PVGEVRLYQIADGVWSHIATQSFDG-GLIVRDGDELLLIDTAWGA---KNTAALLAEIEKVTRAVSTHFHDDRVGGVDVLRAAG--VATYASPST-------------------RRLAEAEGNEIPTHSLEGLSSSGDAV----------RFGPVELFYPGAAHSTDN-------LVVYVPSANVLYGGCA-AEWPTSVERIQKHYPEAEV--VIPG-HGLPGGLDLLQHTANVVKAHK..................................... 260
34 -14.5004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  12  12....YNLTATKIDSDVVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWKTMKPKKVVAINTHFHLDGTGGNEIYKKMG--AETWSSDLTKQ---------------LRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFD------------------LKQGKVFSFSNELVEVSFPGPAHSP--NVVVYFPKK------KLLFGG-YLGDANVKAWPDSARRLKKFDAKIVIPGH--GEWGGPEMVNKTIKVAEKAVGEMRL.. 250
35 -14.4002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  16  40..PVGEVRLYQIADGVWSHIATQSFDG-GLIVRDGDELLLIDTAWGA---KNTAALLAEIEKVTRAVSTHFHDDRVGGVDVLRAAG--VATYASPST-------------------RRLAEVEGNEIPTHSLEGLSSSGDAV----------RFGPVELFYPGAAHSTDN-------LVVYVPSASVLYGGCA-AEWPTSIERIQQHYPEAQF--VIPG-HGLPGGLDLLKHTTNVVKAH...................................... 259
36 -14.2002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  15  39..PVGEVRLYKIGDGVWSHIATQKLGD-GLIVRDADELLLIDTAWGA---KNTVALLAEIEKVTRSISTHFHDDRVGGVDVLRAAG--VATYTSPLT-------------------RQLAEAAGNEVPAHSLKALSSSGDVV----------RFGPVEVFYPGAAHSGDN-------LVVYVPAVRVLFGGCNLAEWPATIKRIQQRYPEAEV--VIPG-HGLPGGLELLQHTTNVVKTH...................................... 258
37 -14.2003bv6_A mol:protein length:379 Metal-dependent hydrolase  ali model follow..  12  42........LNEEIEQTVVEPNTFSMWWLGIWLKSAGNTNLSITQHQMMRMGGVEALQ-AIKEIDAVLASHDHADHID-AAAVLQNCGEHVKFIGPQACVDLWLG-------GVPQERCIVAKVGDVLEIGDVKIRVLDSFDRTALVTLPKGVSSYDKAILDGMDERAV--------NYLIETSGGSVYHSG--DSHYSNYYAKHGNDYQIDVALLSYGENPRGVTDKMTSSDVLRAAESLDCQVVVPFH............................. 300
38 -14.1004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  17  3..EVPELRIEKVKENIFLHTSYSRVNG-GLVVIDKGNAFIVDTPWSDRDTETVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQS--ISTYATTST---------NHLLKENKKEPAKYTLKGNESTLVDGLIEV-----------------------FYPGGGHTIDN-------VVVWLPKSKILFGGCHIDQWSRSAQNALSRYSEAQI--VIPG-HGKIGDIALLKHTKSLAETA...................................... 219
39 -14.1002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  15  20........................KTVNLYLLQGAGEVALVDTALGGALELHLAELGLCFQDVKTILLTHHHPDHY-GLSGFFE-GLGARVFLHEEEFAEAFAEASWRLFLDHGTPEGALQGIRETVEKTRERVHPPQNPLPL------------------------------RDGEALEVAGKRLRVLWTPGHAGHAAFYLEEEGV--------LLAGDALLEKVSPNVGRSLDRLADLGARVAYAGH............................. 233
40 -14.0002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  37............................AYLVCGDEGVALIDNGTFDELMARVEDAQVGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKLKHYPSLREAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRL--DREIPEYILMDAARKFYANLITPLSKLVLKKFDEVKELGLLERIQ-MIAPSHIWTDPMKIIEAYTGWATGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSEGVDVRV.. 290
41 -14.0002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  18  2..RVFPVTLGPLQEN-------------AYLVETGEGPVLIDPGDEEKLLALFQTTGL---IPLAILLTHAHFDHVGAVAPLVEA--DLPVYLHPL------------------------------------------------DLPLYEGADLAARAWGLAIPKPPLPVRPLEEGMRLFG----FQVLHLPGHSGHVAFYDPEGAQVGDLLFRGSVGRYDLPGADPKALFASLKRLLSLPPERVHPGH............................. 184
42 -13.9003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  10  2..SEKNLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEKVSPLPINEVINTNYHTDRAGGNAYWKTLG--AKIVATQMTYD---------------LQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDG-------IFVYFPAERVLYGNCNRTEYPKTLEKLKGLIEQGELKVIIAGHDTPIHDVGLIDHYLTLLEKA...................................... 231
43 -13.9004z7r_A mol:protein length:299 Coenzyme PQQ synthesis protein B  ali model follow..  11  1......MHVVILSLAWAGDSRVRPRTQSSIAVSPDGERLLLNASPD-ANPQMHPREGLRHSPIHAVLLTNGDVDHVAGLLT-LREGQPFTLYATPGILAS--------------VSDNRVFDVMAADVVKRQTIALNETFEPVPGLSVTLFSVPGKVPLWLEDASMEIGAETETTVGTMIEAGGKRLAYI----PGCARVTEDLKARIAGADALLFDGGWRMGHIQMNGETGSIASLADIEIGRRVFVHINNTNPVYERASVEARGWTVAHDGLTLDL 299
44 -13.8003rpc_A mol:protein length:264 possible metal-dependent hydrolase  ali model follow..  14  3....AMTQYTHI-------------RNATGKLTIKNTTFLIDYQQRMPMVDLPLSMDDLLSNVTAVVVTHTHLDH----TAINSIPKSLPIFVQNTA------------------DKELITSQGFIDVRIIFESLEFNGITLRKTGGSHGTVEMYANPVLAPLAGDAMG-------VIFEAADEPTVYLVG--DTVWTSDVEKALLRFDPNVIIMNTGYAQILGFEDSIIKDIGRMVVRKPEAKIIAVHMDTVNHTATSRKDVRKFIKGNNIESHVAV 255
45 -13.7003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  13  12..RFGDLVFRQLAPNVWQHTSYLDMPG-GLIVRDGGRVLVVDTAWTDDQTAQILNWQEINLPVALAVVTHAHQDKMGGMDALHAAG--IATYANALSNQ---------------LAPQEGMVAAQHSLTFAANGWVEPATAP----------NFGPLKVFYPGPGHTSDN-------ITVGIDGTDIAFGGCDTEHYAASARAFGAAFPKASM--IVMS-HSAPDSRAAITHTARMADKLR..................................... 237
46 -13.6002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  20  2.QGHKPLEVIKIEDGVYLHTSFKNIEG-GLVVLDNNQAYIIDTPWSEEDTKLLSWATDRGYQVMASISTHSHEDRTAGIKLL--NSKSIPTYTSELTKK------------------------------------------------------------LLAREGKPVPTHYFKDDEFTLGNGLIELYYPGAGHTE--NIVAWLPKS------KILFGG-ALGYVGDASISSWADSIKNIPIQMVVPGH............................. 200
47 -13.5005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  13  18..RFGDLVFRQLAPNVWQHTSYLDMPG-GLIVRDGGRVLVVDTAWTDDQTAQILNWQEINLPVALAVVTHAHQDKMGGMDALHAAG--IATYANALSNQ---------------LAPQEGMVAAQHSLTFAANGWVEPATAP----------NFGPLKVFYPGPGHTSDN-------ITVGIDGTDIAFGGCDTEHYAASARAFGAAFPKASM--IVMS-HSAPDSRAAITHTARMADKLRLE................................... 245
48 -13.4004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  13  18..RFGDLVFRQLAPNVWQHTSYLDMPG-GLIVRDGGRVLVVDTAWTDDQTAQILNWQEINLPVALAVVTHAHQDKMGGMDALHAAG--IATYANALSNQ---------------LAPQEGMVAAQHSLTFAANGWVEPATAP----------NFGPLKVFYPGPGHTSDN-------ITVGIDGTDIAFGGCDTEHYAASARAFGAAFPKASM--IVMS-HSAPDSRAAITHTARMADKLR..................................... 243
49 -13.4004tyf_A mol:protein length:231 NDM-4  ali model follow..  14  5.QRFGDLVFRQLAPNVWQHTSYLDMPG-GLIVRDGGRVLVVDTAWTDDQTAQILNWQEINLPVALAVVTHAHQDKMGGMDALHAAG--IATYANALS---------------------------NQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPLKVFYPG---PGHTSDNITVGIDGTD--IAFGGCDTEHYAASARAFGAAFPKASM--IVMS-HSAPDSRAAITHTARMADKLR..................................... 231
50 -13.3004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  12  27.....................YKTLRGSSYYLIREEKNVLIDTKFSREFVQNLRNE-IDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAI--DSINGPEWNFNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLF--NDEVDQTELFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQEDRITIFYDTMSNNTRMMADAIAQGIAETDPRVAVKI 283
51 -13.2001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  12  1....AGMSLTQVSGPVYVVEDNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLRVSRKPVLEVINTNYHTDRAGGNAYWKSIG--AKVVSTRQT-------------------RDLMKSDWAEIV------------------------AFTRKGLPEYPDLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTGIFVYFPDEQVLYGGCILKEKLG--NLSFADVKAYPQTLERLKAMPIKTVIGGHDSPLHGPELIDHY................ 217
52 -13.2002ycb_A mol:protein length:636 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  14  174KYDNDWARLTAMGGFREVG-------RSCLYLQTPNSRVLLDCGDDKNSYPYLNVPEFTLDSLDAVIITHAHLDHSGFLPYLYHYGYDGPVYCTATLLQLDHIDIAHREDEPLPFNVKHVKKSVKHTITLDEVTDIAPDIHILGSAMAHLHIGDGQHNMVYTGDFKYEQSRLLEAAANRFPRIETLVMESTYGGHEDVQPSRNRAEKELVKTIYSTLGGKILIPVAVGRAQELMIVLEEY...................................... 431
53 -13.2004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  13  21..RFGDLVFRQLAPNVWQHTSYLDMPG-GLIVRDGGRVLVVDTAWTDDQTAQILNWQEINLPVALAVVTHAHQDKMGGMDALHAAG--IATYANALSNQ---------------LAPQEGMVAAQHSLTFAANGWVEPATAP----------NFGPLKVFYPGPGHTSDN-------ITVGIDGTDIAFGGC--EHYAASARAFGAAFPKASM--IVMS-HSAPDSRAAITHTARMADKLR..................................... 246
54 -13.1002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  20  7..ETGTISISQLNKNVWVHTELGSFNG-GLVLNTSKGLVLVDSSWDDKLTKELIEMKKFQKRVTDVIITHAHADHIGGIKTLKERG--IKAHSTALT-----------------------------------------------------------AELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTE--NIVVWLPQY------NILVGG-DLGNVADAYVNEWSTSIENVNINAVVPGH............................. 205
55 -13.0003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  13  19..RFGDLVFRQLAPNVWQHTSYLDMPG-GLIVRDGGRVLVVDTAWTDDQTAQILNWQEINLPVALAVVTHAHQDKMGGMDALHAAG--IATYANALSNQ---------------LAPQEGMVAAQHSLTFAANGWVEPATAP----------NFGPLKVFYPGPGHTSDN-------ITVGIDGTDIAFGGC--EHYAASARAFGAAFPKASM--IVMS-HSAPDSRAAITHTARMADKLR..................................... 244
56 -13.0002dkf_A mol:protein length:431 metallo-beta-lactamase superfamily protein  ali model follow..  17  14..........................GSAHLLLAGGRRVLLDCGQGKEEARNHAPFGFDPKEVDAVLLTHAHLDHVGRLPKLFREGYRGPVYATRATVL---------------MEIVLEDALKVMDEPFFGPEDVEEALGHLRPLEYGEWLRLGALSLAFGQAG-----HLPGSAFVVAQGEGRTLVYSGDLGNREKDVLPDPSLPPLADLVEGTYGDPH-YRETVREFLEILEKTLSQGGKVLIPTFAVE.......................... 226
57 -13.0003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  15  1.QVKDFVIEPPIKNNLHIYKTFGVFGG-SMYLVTKKGVVLFDVPWEKVQYQSLMDTKRHNLPVVAVFATHSHDDRAGDLSFFNNKG--IKTYATAKT-----------------------------------------------------------NEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTA--NVVVWFPKY------NVLDGG-DLGYIKEANVEQWPKTINKLKATLIIPGH-KGGGHVEHTLELLNKK............ 219
58 -12.9002wyl_A mol:protein length:360 L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG  ali model follow..  14  24........LNEEIEQEQVAPGTFAMWWLGIWLKSEGGTNVCVQGHQMQRMAGVKKLQ-AIRQIDAVLATHDHNDHID-AAAVMQNCADDVPFIGPKTCVDLWIG---------------WGVPKERCIVVKPGDVVKVKDIEIHALDAFDRTALITLPADQKAAGVLPDGMDDRAVNYLFKTPGGSLYHSG--DSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFH............................. 281
59 -12.9004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  13  47....GDLVFRQLAPNVWQHTSYLDMPG-GLIVRDGGRVLVVDTAWTDDQTAQILNWQEINLPVALAVVTHAHQDKMGGMDALHAAG--IATYANALSNQ---------------LAPQEGMVAAQHSLTFAANGWVEPATAP----------NFGPLKVFYPGPGHTSDN-------ITVGIDGTDIAFGGC--EHYAASARAFGAAFPKASM--IVMS-HSAPDSRAAITHTARMADKLR..................................... 270
60 -12.8002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  11  1MESKAKTTVTFH-------SGILTIGGTVIEVAYKDAHIFFDFGTEPRLGYEYHGAEDKDYQHTAVFLSHAHLDHSRMINYL---DPAVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGE----------------------ISVEIVPVDHDAYGASALLIRTPDHFITYTG-LHGHNREETLAFCEKAKHTEL-LMMEGVSISFPEREPDPAQIAVVSEEDLVQHLVRLELENPNRQITFNGYPANVERF........ 268
61 -12.8001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  13  1...MKVEVLPALTDN----------YMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTV---LTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALTHKITHL---------STLQVGSLNVKCLATPCHTSGHICY------------------------FVSKPGGSEPPAVFTGD--TLFVAGCGEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEE............ 218
62 -12.8005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  20  19.QGHKPLEVIKIEDGVYLHTSFKNIEG-GLVVLDNNQAYIIDTPWSEEDTKLLSWATDRGYQVMASISTHSHEDRTAGIKLL--NSKSIPTYTSELTKK------------------------------------------------------------LLAREGKPVPTHYFKDDEFTLGNGLIELYYPGAGHTE--NIVAWLPKS------KILFGG-GLGYVGDASISSWADSIKNIPIQMVVPGH............................. 217
63 -12.8001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  13  31........................HRGTTYYLIVDDKTALVDTPFKEELIAKLKQI-KDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDKAHYSHIDFNYTIVK-TGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRF--DDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKL.. 285
64 -12.8002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  19  13..ETGTISISQLNKNVWVHTELGSFNG-GLVLNTSKGLVLVDSSWDDKLTKELIEMKKFQKRVTDVIITHAHASRIGGIKTLKERG--IKAHSTALT-----------------------------------------------------------AELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTE--NIVVWLPQY------NILVGG-DLGNVADAYVNEWSTSIENVNINAVVPGH............................. 211
65 -12.7003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  18  7..ETGTISISQLNKNVWVHTELGSFNG-GLVLNTSKGLVLVDSSWDDKLTKELIEMKKFQKRVTDAIITHAHADRIGGIKTLKERG--IKAHSTALT-----------------------------------------------------------AELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTE--NIVVWLPQY------NILVGG-DLGNVADAYVNEWSTSIENVNINAVVPSH............................. 205
66 -12.7002xr1_A mol:protein length:640 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  15  178TSKDQWVRVTALGGCKEVG-------RSCFLLSTPESRILIDCGDENMTPYLYVPEVFPLNQIDAVIVTHAHLDHQGLVPLLFKYGYEGPVYCTPVLLQLDYIDVAAKEGKKIPYESGMVAKTLKHTIPLDEVTDIAPDIKLT-----------------FHNAGHILGSAISH---FHIGDGLHNVVFTGDYKYEKTRLFDPAVNKFPRVESEATYGNANAFQPAEKHLQMVVKNTIERGGIAVIPAFAVGRSQEVMI................... 429
67 -12.5001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  17  1.....DVKIEKLKDNLYVYTTYNTFNG-AVYLVTDKGVVVIDCPWGEDKFKSFTDEKKHGKKVIMNIATHSHDDRAGGLEYFGKIG--AKTYSTKMT-----------------------------------------------------------DSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTA--NVVVWFPKE------KVLVGG-DLGYIGEAYVNDWTQSVHNIGAQYVVAGHWKDQRSIQHTLDLINEYQQKQKAS..... 222
68 -12.4002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  12  31...................HGYHTDEGSSYYFIDDECPTVIDSPFAEEWLSRIAAC-CPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEKILYGMEKATWLIVD-DKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRW--ADECDVSHVMHLFKEYTANILGLFSAQMRKALEVASTV-------KYILSAHGVSWRGDAMGLAIAEYDRWS-KKVTVVLDSMYGTTHRMALALLDGARSTGCETVL.. 290
69 -12.3001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16  9....DDISITQLSDKVYTYVSLAEIEG-GMIVINNHQAALLDTPINDAQTEMLVNWDSLHAKVTTFIPNHWHGDCIGGLGYLQRKG--VQSYANQMTID-----------------------------------------------------------LAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHA---NIVVWLPTE------NILFGG-SIGNISDADVTAWPKTLDKVSARYVVPGH............................. 206
70 -12.2001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16  9....DDISITQLSDKVYTYVSLAEIEG-GMIVINNHQAALLDTPINDAQTETLVNWDSLHAKVTTFIPNHWHGDCIGGLGYLQKKG--VQSYANQMT-----------------------------------------------------------IDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHA---NIVVWLPTE------NILFGG-SIGNISDADVTAWPKTLDKVSARYVVPGH............................. 206
71 -11.8003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  16  18TKSGKELTITFIKHG-------------SLMLTYDNHSIQVDPVSEYADYT-------TFPKADIILITHEHGDHLDPKAIQAVEKSDTEIIANENS----------------------QKKLGKGKVLKNGDTDTSISYMKIEAVPAYNTTPGRDKYHPRHRDNGY------------ILTFDGLRVY----IAGDTEDIPEMKDLKDIDIAFLPVNQPYTMTVSQ-----AAKAARMFSPKILYPYH--GDTKIGELKDALKDSGIDVRI...... 225
72 -11.7004ojv_A mol:protein length:369 3`,5`-cyclic-nucleotide phosphodiesterase 1  ali model follow..  11  1...MVVFEITIL-----GANGGPTEYGTQCFITEDPELIAVDGGAGMYQLREMKKTYEVFQGITDYYITHPHLDHISGLVVNSENSKKKTIWGLPHTIDV-LQKHVFNDLIWPDLTAERSRKLKLKCLNPKEVQKCTIFPWDVIPFKVHHGIGVKTGAPVYSTF-----------YIFRDRKSKDCIIVCG-EESLLEEFWSYVAENIPLVHLKGIL---HLLINELSNLNTLYNSSKGLSGLNVIVTHVKSTPAKRDPRLTILEELRFALEGHTLFL 369
73 -11.7001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  13  30........................PMGTTYYLVEDEKTTLFDTEYKGELLCGIASV-IDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKESHFHYKDWPVQVVK-HGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERF--SDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVIFRGADQFAVQKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVKL.. 286
74 -11.3004qn9_A mol:protein length:393 N-acyl-phosphatidylethanolamine-hydrolyzing p  ali model follow..  12  134............................TVMVEMDELIFLTD----PIFSSRASPSQYELPPIDAVLISHNHYDHYNSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVL--------------------------GSWSVLGPWNRFFFAG--DTGYCPAFEEIGKRFGPFDLAAIIGAYEFMKYQHVDPEEAVRIHTDVQTKKSMAIH-VKLNEALERYGLNAEDFFVLKHGESRYL 386
75 -11.2003af5_A mol:protein length:651 Putative uncharacterized protein PH1404  ali model follow..  15  183EYKSRWIRITGLGGFREVG-------RSALLVQTDESFVLVDFGVNVAMLNDPYKYVLREGLLDAIIITHAHLDHCGMLPYLFRYNLDGPIYTTPVLLQKDFIEIQQSNGQDPLYRPRDIKEVIKHTITLDEVRDISPDIHILGSAIVHLHIGNGLHNIAITGDFKFIPTRLLEPANAKFPRLETLVMESTYGGANDIQMPREEAEKRLIEVIHNTIGGKVLIPAAVGRAQEVMMVLEEY...................................... 446

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 3 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]