current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2p97_A mol:protein length:201 Hypothetical protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst GMKSLHRPDLYSWSTFNPARNIDFNGFAWIRPEGNILIDPVALSNHDWKHLESLGGVVWIVLTNSDHVRSAKEIADQTYTKIAGPVAEKENFPIYCDRWLSDGDELVPGLKVMELQGSKTPGELALLLEETTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVRRLAALEKVEAVLVGDGWSVFRDGRDRLKELVATLALast
1 -95.1002p97_A mol:protein length:201 Hypothetical protein  ali model  100  1GMKSLHRPDLYSWSTFNPARNIDFNGFAWIRPEGNILIDPVALSNHDWKHLESLGGVVWIVLTNSDHVRSAKEIADQTYTKIAGPVAEKENFPIYCDRWLSDGDELVPGLKVMELQGSKTPGELALLLEETTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVRRLAALEKVEAVLVGDGWSVFRDGRDRLKELVATLA 201
2 -52.1002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  22  7.................TLGPLQENAYLVETGEGPVLIDPGDEPEKLLALFQTTGIPLAILLTHADHVGAVAPLVEALDLPVYLHPLDLPLYPPLPVRPLEEGMRLF-GFQVLHLPG-HSPGHVAFYDPEAQVFSGDLLFRGSVGRYDLPGA----DPKALFASLKRLLSLPPETRVHPGHGPGTTLGLEARTNPFLTGLE 204
3 -41.5003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  14  1....MPCRGLHSIPAGPVEFPEIATVYVMCGEKLTVMIDAG--VSNSIADFSFLDKLDYIVLTHLDHIGLLPELLQVYKAKVLVKSGFKKYLDQDKVIEVEGNEEFDLGMRLIYTPG-HARHHMSVLVDD-FLFTGDSAFNGVVIPTTPPV----IDYKMYMESLKRQIELKP-KVVGFAHGGLVSPKIMEEHLKQMLS.. 225
4 -39.5001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  18  37......................DLTALLVQTPDGAVLLDGPQMASHLLDNMKARGDLRLILLSHADHAGPVAELKRRTGAKVAANAESAVLLPANADRIVMDGEVITVGFTAHFMAG-HTPGSTAWTWTTRNGKPVRIAYADSLSAPGY-NPRYPHLIEDYRRSFATVRAL-PCDVLLTPHPGASNWDYAAGARAGAKALT 245
5 -38.6005aeb_A mol:protein length:272 LRA-12  ali model follow..  18  34...................GTYDLACYLITTKQGNIIVNTAASALQIKNNIKALGDTKILLTTQADHLGAMAEIKKITGAKLMADEGDATVMPIIADRLLHDKDTIQLGLVMLHHPG-HTKGSCSFLFDTRILIANMPVIEKKFSEVSSYPG----IAKDYAYTLQAMKNLS-FDIWVASHASQFSMHSKHKPGD...... 241
6 -37.9002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  24  7.................PVTAFSQNCSLIWCEQLAALVDPGGDAEKIKQEVDASGTLMQILLTHGDHVGAASELAQHYGVPVIGPEKEDEFWPLTPDRWLNDGDRVSVGLQVLHCPG-HTPGHVVFFDEQQLLISGDVIFKGGVGRSDFPRG----DHTQLIDAIKKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQ... 209
7 -37.2003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  16  51...................GTDGIAVYVIKTSQGLILMDTPQSTGMIKDNIAKLGDIKLILNTHADHTGGFAEIKKETGAQLVAGERDKPLLAVKVDRAVKEGDRVTLGLTAHATPG-HSPGCTSWEMTREVLFFCSG---TVALNRLVGQPTYAGIVDDYRATFAKAKAM-KIDVLLGPHPEVYGMQAKRAEMK...... 256
8 -37.1004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  18  57......................GISALLVTSDAGHILVDAPQAGPQILANIRALGDVRAIVLSHEDHAGSLAELQKATGAPVYARAPAIDTLPVANIVTLADDGVVSVGLTAVASPG-HTPGGTSWTWRCRQMVYADSLTAISDDVYRYSDDAAHPGYAAFRNTLARVAAL-DCDILVTPHPSASGLWNRIGPRA...... 264
9 -37.0001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  17  24......................DLASYLIVTPRGNILINSEANVPMIKASIKKLGDTKILLISHADHAAGSELIKQQTKAKYMVMDEDVSVIQSTVDKVLHDGERVELGLTAHLTPG-HTRGCTTWTMKKDHGKQYQAVIIGSIGVNPGYKITYPKIAEDYKHSIKVLESM-RCDIFLGSHAGMFDLKNKYVLLS...... 229
10 -36.7004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  17  57......................GISALLVTSDAGHILVDAPQAGPQILANIRALGDVRAIVFSHEDHAGSLAELQKATGAPVYARAPAIDTLPVANIVTLADDGVVSVGLTAVASPG-HTPGGTSWTWRCRQMVYADSLTAISDDVFRYSDDAAHPGYAAFRNTLARVAAL-DCDILVTPHPSASGLWNRIGPRA...... 264
11 -36.6005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  17  27...................GMKGLSSVLVTSPQGHVLIDGPESAPKIIANIGALGDVKLILNSHGDHAGGLAELQRRSNALVAASPSAALDLPVKDMRLARDGGQFNVGLTAHATPG-HTPGGLSWTWQSNMVYADSINAVSRPGFKFSASSEYPNALADLRHSFETLEKL-PCDVLISAHPEASQLWQRLEASA...... 237
12 -36.2005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  15  31.....IADGVWSHIATQSFDGYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKVTRAVSTHDDRVGGVDVLRKA-GVATYASPSTRRLAEAELEGLSSSGDAVRFGPVELFYPGAHSTDNLVVYVPSNVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKH--YPEAEVVIPGHGLPGGLDLLQHTANVVTAH. 241
13 -35.7003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  15  22...................GTGGISAVLLSSPQGHILVDGEKGAQVVAANIRAMGDVKYILSTHSDHAGGISAMQKLTGATVLAGAANVDTLGSAKVRAVADGELVKLGVKAHATPG-HTEGGITWTWQCEQGKCKDVVFADSVSADSYRFSDHPEVVASLRGSFEAVEKL-SCDIAIAAHPEVNDMWTRQQRAA...... 229
14 -35.1002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  13  49.....IADGVWSHIATQSFDGYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKVTRAVSTHDDRVGGVDVLRAA-GVATYASPSTRRLAEVELEGLSSSGDAVRFGPVELFYPGAHSTDNLVVYVPSSVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQH--YPEAQFVIPGHGLPGGLDLLKHTTNVVKAHT 260
15 -35.1004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  15  49.....IADGVWSHIATQSFDGYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKVTRAVSTHDDRVGGVDVLRAA-GVATYASPSTRRLAEAELEGLSSSGDAVRFGPVELFYPGAHSTDNLVVYVPSNVLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKH--YPEAEVVIPGHGLPGGLDLLQHTANVVKAHK 260
16 -35.0002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  16  35......................QVPVFLLRLGEASALVEGGRDAELVWADLCRWVQVHYWLITHKDHCGLLPYLCPRLNVQVLASERTCQAWDALPVRAVADGEWLELGLQVIEAHG-HSDDHVVFYDVRRRLFCGDALGEFDEAEGVWRP-LVFDDMEAYLESLERLQRLPTLLQLIPGHGGLLRGRLAAD......... 246
17 -34.6002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  14  48.....IGDGVWSHIATQKLGDYSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKVTRSISTHDDRVGGVDVLRAA-GVATYTSPLTRQLAEAALKALSSSGDVVRFGVEVFYPGAAHSGDNLVVYVPARVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQR--YPEAEVVIPGHGLPGGLELLQHTTNVVKTHK 259
18 -34.2004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  11  27.....LAPNVWQHTSYLDMPGVASNGLIVRDGGRVLVVDTADQTAQILNWIKQEINVALAVVTHQDKMGGMDALHAA-GIATYANALSNQLAPQEANGWVEPATAPNFGLKVFYPGPGHTSDNITVGIDGDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAA--FPKASMIVMSHSAPDSRAAITHTARMADKL. 242
19 -33.9004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  12  30.....LAPNVWQHTSYLDMPGVASNGLIVRDGGRVLVVDTADQTAQILNWIKQEINVALAVVTHQDKMGGMDALHAA-GIATYANALSNQLAPQEANGWVEPATAPNFGLKVFYPGPGHTSDNITVGIDGDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAA--FPKASMIVMSHSAPDSRAAITHTARMADKL. 245
20 -33.8005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  12  27.....LAPNVWQHTSYLDMPGVASNGLIVRDGGRVLVVDTADQTAQILNWIKQEINVALAVVTHQDKMGGMDALHAA-GIATYANALSNQLAPQEANGWVEPATAPNFGLKVFYPGPGHTSDNITVGIDGDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAA--FPKASMIVMSHSAPDSRAAITHTARMADKLR 243
21 -33.8004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  15  12.....VKENIFLHTSYSRVNGVSSNGLVVIDKGNAFIVDTPRDTETLVHWIRKNGELLGSVSTHEDRTAGIKWLNDQ-SISTYATTSTNHLLKENPAKYTLKGNESTLVIEVFYPGGGHTIDNVVVWLPKKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNA--LSRYSEAQIVIPGHGKIGDIALLKHTKSLAETA. 219
22 -33.8001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  12  16.....LSDKVYTYVSLAEIEGVPSNGMIVINNHQAALLDTPAQTETLVNWVADSLHVTTFIPNHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEKPEHGFTDSLTVSLDLQCYYLGGGHATDNIVVWLPTNILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAK--FPSARYVVPGHGDYGGTELIEHTKQIVNQY. 225
23 -33.8001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  12  16.....LSDKVYTYVSLAEIEGVPSNGMIVINNHQAALLDTPAQTEMLVNWVTDSLHVTTFIPNHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKPEHGFTDSLTVSLDLQCYYLGGGHATDNIVVWLPTNILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAK--FPSARYVVPGHGNYGGTELIEHTKQIVNQY. 225
24 -33.8003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  12  21.....LAPNVWQHTSYLDMPGVASNGLIVRDGGRVLVVDTADQTAQILNWIKQEINVALAVVTHQDKMGGMDALHAA-GIATYANALSNQLAPQEANGWVEPATAPNFGLKVFYPGPGHTSDNITVGIDGDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAA--FPKASMIVMSHSAPDSRAAITHTARMADKL. 236
25 -33.6003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  14  11.....IKNNLHIYKTFGGGKEYSANSMYLVTKKGVVLFDVPVQYQSLMDTIKKRHNVVAVFATHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKDSTEIIKTGKPYRIGFVVDFLGEGHTADNVVVWFPKNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAK--YSKATLIIPGHDEWKGGGHVEHTLELLNK.. 218
26 -33.5004tyf_A mol:protein length:231 NDM-4  ali model follow..  12  15.....LAPNVWQHTSYLDMPGVASNGLIVRDGGRVLVVDTADQTAQILNWIKQEINVALAVVTHQDKMGGMDALHAA-GIATYANALSNQLAPQEANGWVEPATAPNFGLKVFYPGPGHTSDNITVGIDGDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAA--FPKASMIVMSHSAPDSRAAITHTARMADKL. 230
27 -33.3003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  12  28.....LAPNVWQHTSYLDMPGVASNGLIVRDGGRVLVVDTADQTAQILNWIKQEINVALAVVTHQDKMGGMDALHAA-GIATYANALSNQLAPQEANGWVEPATAPNFGLKVFYPGPGHTSDNITVGIDGDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAA--FPKASMIVMSHSAPDSRAAITHTARMADKL. 243
28 -33.1001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  11  7.....LKDNLYVYTTYNTFNGYAANAVYLVTDKGVVVIDCPDKFKSFTDEIYKKHGVIMNIATHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKEAQYTFDNNKSFKVGFQVYYPGKGHTADNVVVWFPKKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQK--FSGAQYVVAGHDDWKDQRSIQHTLDLINEY. 215
29 -33.0004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  12  54.....LAPNVWQHTSYLDMPGVASNGLIVRDGGRVLVVDTADQTAQILNWIKQEINVALAVVTHQDKMGGMDALHAA-GIATYANALSNQLAPQEANGWVEPATAPNFGLKVFYPGPGHTSDNITVGIDGDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAA--FPKASMIVMSHSAPDSRAAITHTARMADKL. 269
30 -33.0002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  16  16.....LNKNVWVHTELGSFNGVPSNGLVLNTSKGLVLVDSSKLTKELIEMVEKKFQVTDVIITHADHIGGIKTLKER-GIKAHSTALTAELAKKNPLGDLQTVTNLKFGVETFYPGKGHTEDNIVVWLPQNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKR--YRNINAVVPGHGEVGDKGLLLHTLDLLK... 222
31 -32.5001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  21  11......................DNYAYILHDEDTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHDHTGGNLELKDRYGAKVIGSAMDKDRIP-GIDMALKDGDKWMFAVHVMDTPG-HTKGHISLYFPGRAIFTGDTMFSLSCGKL--------GTPKQMLASLQKITSLPDDTSIYCGH.................... 169
32 -32.5003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  15  16.....LNKNVWVHTELGSFNGVPSSGLVLNTSKGLVLVDSSKLTKELIEMVEKKFQVTDAIITHADRIGGIKTLKER-GIKAHSTALTAELAKKNPLGDLQTVTNLKFGVETFYPGKGHTEDNIVVWLPQNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENV--SKRYRNINAVVPSHGEVGDKGLLLHTLDLLK... 222
33 -32.5002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  16  22.....LNKNVWVHTELGSFNGVPSNGLVLNTSKGLVLVDSSKLTKELIEMVEKKFQVTDVIITHASRIGGIKTLKER-GIKAHSTALTAELAKKNPLGDLQTVTNLKFGVETFYPGKGHTEDNIVVWLPQNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENV--LKRYRNINAVVPGHGEVGDKGLLLHTLDLLK... 228
34 -32.1004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  20  8..................DSESSTYTYLIGDEATAVLIDPVEQVDRDLQMVAELDTLTHVFDTHADHITASGALRERTQATVVGSVNGASCA----NVQVRHGDEVRVGFQVLATPG-HTDDSISYLLGDR-VFTGDALLVRGNGRTDFQNG----NASQLYDSLRVLFTLPDETLVYPGHGRTVTSIAEEK......... 184
35 -31.5004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  19  14..................EPVSCTFTYLLGDRESAVLIDPVETAPRDAQLIKELGRLLYAVNTHADHITGSGLLRSLLPGCQSVISRLS---GAQADLHIEDGDSIRFGLETRASPG-HTPGCVTFVLNDSMAFTGDALLIRGCGRTDFQQG----CAKTLYHSVEKIFTLPGDCLIYPAHGFTVSTVEEER......... 193
36 -31.4004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  13  12.....LDEGVYVHTSFEEVNGVPKHGLVVLVNAEAYLIDTPKDTEKLVTWFVERGKIKGSISSHSDSTGGIEWLNSR-SIPTYASELTNELLKKDATNSFSGVNYWLVKIEVFYPGPGHTPDNVVVWLPEKILFGGGFIKPYGLGNLG-------ANIEAWPKSAKLLKSKGKAKLVVPSHSEVGDASLLKLTLEQAVKG. 216
37 -31.0005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  15  29.....IEDGVYLHTSFKNIEGVDSNGLVVLDNNQAYIIDTPEDTKLLLSWATDRGQVMASISTHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREPTHYFKDDEFTLGNIELYYPGAGHTEDNIVAWLPKKILFGGCLVRSHEREGLGYVGDASISSWADSIKNI--VSKKYPIQMVVPGHGKVGSSDILDHTIDLAESA. 236
38 -31.0002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  14  12.....IEDGVYLHTSFKNIEGVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATQVMASISTHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREPTHYFKDDEFTLGNIELYYPGAGHTEDNIVAWLPKKILFGGCLVRSHEWEALGYVGDASISSWADSIKNI--VSKKYPIQMVVPGHGKVGSSDILDHTIDLAESA. 219
39 -31.0004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  14  13.....LEEGVYVHTSFEEVNGVSKHGLVVLVNTDAYLIDTPTDTEKLVNWFVERGKIKGTISSHSDSTGGIEWLNSQ-SIPTYASELTNELLKKDAKNSFSGVSYWLVKIEVFYPGPGHTQDNVVVWLPEKILFGGCFVKPDGLGNLG-------ANLEAWPKSAKILMSKVKAKLVVSSHSEIGDASLLKRTWEQAVKG. 217
40 -30.9002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  23  1.MKAL-LPGLYLLPVPIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHQDVKTILLTHPDHYGLSGFF-EGLGARVFLHEEEFARGPPQNPLPLRDGEALEVALRVLWTPG-HADGHAAFYLEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLADL-GARVAYAGHFGPIA-DVRQRAEELKAH.. 250
41 -30.7002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  20  10..................ENESSTFTYLLADDKPALLIDPVKTVDRDLKLIDELGKLIYAMNTHADHVTGTGLLKTKLPGVKSVISKAS---GSKADLFLEPGDKVSIGLEVRATPG-HTAGCVTYVTGERMAFTGDAVLIRGCGRTDFQEG----SSDQLYESVSQIFTLPKDTLIYPAHGFEVSTVGEEM......... 197
42 -30.4001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  14  29.......................STVVYLEHKDRRIIIDPGSSMDELEEKFSELGDITDVLFTHVDHIFNSVLFE---NATFYVHEVYKTKNYLSFGTIVGEESLFDEKVKVFHTPW-HAREHLSFLLDGRVLITGD-ITPNRLSYYDIIKGYGSVQVKNFLDRVGRI------DLLVFPHDAPLKPEVKK.......... 215
43 -29.8004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  19  31......................GTNTYLVGTGPRRILIDTGEYISCLKQALTEFNAIQEIVVTHRDHSGGIGDICKSINNDTTYQREEIIGNGEQQYVYLKDGDVIKTELRVLYTPG-HTDDHMALLLEENAIFSGDCILGEGTTVFE--------DLYDYMNSLKELLKIKA-DIIYPGHG-PVIHNAEAKIQQYISH.. 217
44 -29.2004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  15  66.....................GGAEAALEEAARGPILVDTPWAREALLGALAGQGDVTLVVGTHGDHIGNLGLFP---GAALLVSHDFCLPGGRYLPHGLGEGQRLGPGLEVWATPG-HGGQRDVSVVVAGVVVAGDVFERDGDEDS---WQALSEDPAAQERSRKRVLVVAD--VVVPGHGPPFRVLRE........... 240
45 -29.2003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  24  13....................GLAHASYLVGCQEEACVIDPARDVEPYLLTAKREGRIVAALETHADFVSGAREMADRAGAAICVSDEGPPEWKSEPHRLLKDGDELHFGIVVMHTPG-HTPEHVSYLLYDGALFSGDFVFVGDVGRPDLLERVAGESGSSMFRSLRKFEALPDHVQVLPAHGAGSACGKA........... 208
46 -29.1003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  13  11.....FKGPLY---IVEDKEYVQENSMVYIGTDGITIIGATETAETLYKEIRKVSPINEVINTNTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQPDTVFPGDFNLQNGIRAMYLGEAHTKDGIFVYFPARVLYGNCILKEN----LGNMSFANRTEYPKTLEKLKGLIEQGKVDSIIAGHDTPI--HDVGLIDHYLTLL. 228
47 -28.7003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  15  29.....................LSQASYLIGCQKEAMIIDPIRDLSSYIRVADEEGTITHAAETHADFASGIRDVAIKLNANIYVSGESDDTLGYKHTHFVQHNDDIYVGLKVLHTPG-HTPESISFLLTDEGLFSGDFIFVGDIGRPDLLEKAVKVEGSSMFKSIESIKDLPDYIQIWPGHGAGSPCGKS........... 222
48 -28.6003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  20  16GRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGTEEDRIVNILKRVGDLLYIISSH-DHAGGNGAFT---NTPIIVQRTEYEAALHREEKIIEGDYEVVPGVQLLYTPG-HSPGHQSLFIEGSVLLTIDASYTKE--NFEDEVPFAGFDPELALSSIKRLKEVVKKEIIFFGH.................... 239
49 -28.5003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  17  12GSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGEKHQTIPGALGLLGDIDVVVNSH-DHCGGNKYFP---HAKKICHRSEVPQACNPQPEGIDGDVDLARGVKLISTPG-HSIGHYSLLVEKPILFTIDAAYTQKSLETLCQAAFHI-DPVAGVNSMRKVKKLAEDHELMYSH.................... 252
50 -28.5002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  20  14GRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGTEEDRIVNILKRVGDLLYIISSH-DHAGGNGAFT---NTPIIVQRTEYEAALHREEKIIEGDYEVVPGVQLLYTPG-HSPGHQSLFIKGSVLLTIDASYTKE--NFEDEVPFAGFDPELALSSIKRLKEVVKKEIIFFGH.................... 237
51 -28.3001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  15  11......................DNYMYLVIDDETAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHDHAGGNEKLVKLEGLKVYGGDDRIGAL----THKITHLSTLQVGVKCLATPC-HTSGHICYFVSKPAVFTGDTLFVAGCGKF--------GTADEMCKALEVLGRLPPDTRVYCGH.................... 173
52 -28.3002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  19  1AMADIGSMNLNSIPAFQ-----DNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKMPEAIFLT--DHVGGVKELLQHFQMTVYGPAETQ----KGATHLVGDGDTIRVKFTLFATPG-HTLGHVCYFSRP-YLFCGDTLFSGGCGRL--------GTPSQMYQSLMKINSLPDDTLICCAH.................... 168
53 -28.3001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  11  8.....VSGPVY---VVEDNYYVQENSMVYFGAKGVTVVGATDTARELHKLIKRVSRVLEVINTNTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDPNVVHDGDFTLQEGVRAFYAGPAHTPDGIFVYFPDQVLYGGCILKEK-------LGNLSFADVKAYPQTLERLKAMKPIKTVIGGHDSPLHPELIDHYEALIKAA. 224
54 -28.1002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  15  33......................DNFSYLINDHTTLAAVDVNADYKPILTYIEEH-TFSTILSTHKDHSGGNAKLKAELEAPVVVVGGANDSIP-AVTKPVREGDRVQVGVEVIDAPC-HTRGHVLYKVQHVALFTGDTMFIAGIGAF--------GDEKDMCRAMEKVYALDKVTFIFPGH.................... 220
55 -28.1004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  13  19.....IDSDVF---VVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWPKKVVAINTHLDGTGGNEIYKKM-GAETWSSDLTKQLRPADNVFDLKQGKVFSFSVEVSFPGPAHSPDNVVVYFPKKLLFGGCMIKPKELGYLG-------ANVKAWPDSARRLKKF-DAKIVIPGHGEWGGPEMVNKTIKVAEKA. 244
56 -27.8002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  15  36................SRLIDIPVSAYLIQCTDATVLYDTGASECNLPERLRQLGDISTVVLSH-DHAGCVEYFGK---SRLIAHEDEFATANWDLVGRDERERELAPGVNLLFGTG-HASGMLGLAVRPGFLLVSDACYTATNYGPPARRAGVLHDTIGYDRTVSHIRQYAESRTVLFGHDREQFASLIKSTDGFYE... 276
57 -23.7005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  21  22GDTFEVAPGVRWLRMPLPFSLDHINLWLLRDQAGWTIVDCGISSEAIRTHWEQILPVLRVLVTH-DHFGLANWLCERWNVRLWMTLGEYMFGCLPRYRRLREGDAVKIGWRVVTGYG-HSPEHCALHSEAGVLISGDMVLPRISTNVSVFDLEPEANLALYLESLGRYETMAPDTLVLPSHGKPFR-GVRTRIAQLRAH.. 288
58 -22.2004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  18  16....................ATSTISYLVMDRETRALIDSSASADRLVERVNELNSVRWVLETHADHLSAAAYLKEKLGGHTAIGAHGFARDGSQFDVLLEDEEGFRIGARALHTPG-HTPACMSFMIEDAAVFVGDTLFMPDYGTARC--DFPGADARTLYRSIRRLLAFPDQTRLFMCH.................... 212
59 -21.6004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  21  14....................ATCTISYLLFDSGSGALIDSTASADQLIARVAALGRVRWLLETHADHLSAAPYLKTRVGGEIAIGRHAFAHDGSQFDRLLDDGDTLALGIRAMHTPG-HTPACMTYVVTEAAAFVGDTLFMPDYGTARC--DFPGGDARSLYRSIRKVLSLPPATRLYMCH.................... 216
60 -20.2004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  14  35...............YALERGTTSNSYVI-EGDKTAIIDPPVES-EALQQTVNLKKLDYVILGHFNRIPTFKALLELAQITFVCSLPAAGDLRAAFPLPMRGKETLDLGLKFLPIPSPRWPAGLCTYVQTQILYTDKIVFDDNWESFKEDQRYYFNCLIHVEAALEKISDL-QVRLYAVGHGPLVRTSLIALTQAYAD... 248
61 -19.6003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  15  45....................NLPTHPILIQTAQYNLIIDAGDEESHIIADLANYNDIDYVLMTH-DHAAGLTDQAGH-NAIHVVQQDEWHEFIAPNIRLFEKHFEPVPGIKMQHSGG-HSFGHTIITIEDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWF....................... 247
62 -19.0001vme_A mol:protein length:410 Flavoprotein  ali model follow..  17  12.TERIFDDPEIYVLRWEIPEGISYNAYLVKLNGANVLIDGGNYAKEFIDALSKIKEITHIIVNHTDHSGSLPATLKTIDVEIIASNFGKRLLEIKDVTVVKDGEEREIGFKFVMTPWLHWP-DTMVTYLDGILFSCDVGGGYLLPEILDDSNESVVE-NYILEGAEKLSSL-KIKALLPGHGLIWKKDPQRLLNHYVS... 251
63 -18.6004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  20  55....................QTSINAFLVNIGKSLILIDSGSHLGSVLSNLKASGQVDTILLTHPDHVCGISKDGVANNATVYVSNDEASFWLDPKQAKTYKLGDDIQGFKVINTAG-HTPGHFSYELKTKIVFIGDIVHSHTVQFDRPETAIEYIDPKKAVETRLKQFANFAKNGQFPGIGHTYSADGK........... 280
64 -18.5004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  15  52................DHYIDMAINILLVKTKEKLILMDTGERTGFLLKSLQKAGDITDIFLSHPDHIGGVVDKQNKLNASIFISKIEHDFWINASIKFYDLNKTLYSHFNFQLAPG-HTPGLTVTTISSGLMYVADLIHSDVILFPHPDWGFSGTDLDIATASRKKFLKQLADTKAWPGLG................... 276
65 -18.4001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  17  74NQPAPKTQSALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGPTLGRLAANLKAAGQVDEIYITHPDHVGGLMVGEQLANAVVRADQKEADFWLSQTNKPFSGNTDLVPGIKALASHG-HTPGHTTYVVESQLALLGDLILVAAVQFDDPSVTTQLSDSKSVAVERKKAFADAAKGGYFPGIG................... 309
66 -18.2004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  19  86....................QTAVNAYLINTGDNLVLIDTGPTLGVVQTNLKASGQVDTVLLTHPDHACGLVNADGS-NATVEVPQAEAEFWLDEATKPYKTEGELLPGVSLVASSG-HTPGHTSYLFKSGLLVWGDILINHAVQFAKPEVVWEFVDSDQARQSRQRILAEAATDKLFPGLG................... 301
67 -18.2004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  19  86....................QTAVNAYLINTGDNLVLIDTGPTLGVVQTNLKASGQVDTVLLTHPDHACGLVNADGS-NATVEVPQAEAEFWLDEATKPYKTEGELLPGVSLVASPG-HTPGHTSYLFKSGLLVWGDILLNHAVQFAKPEVVFEFVDSDQARQSRQRILAEAATDKLFPGLG................... 301
68 -17.7004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  15  21.........DFHGTEYKTLRGSSYNSYLIR-EEKNVLIDTHKFSREFVQNLRNEADIDYIVINHADHAGALTELMAQIDTPIYCTANAIDSINGP--NVVKTGDTLDIGLIFVETPMLHWPDSMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELRLVTPKITEILGFNPVDMIATSHGVVWRDNPTQIVELYLK... 240
69 -17.4002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  19  31...................QGTTYNAYLVCGDEGVALIDNPGTFDELMARVEDAERVDYIIQNHVDHSGVLVELHRRFEAPIYCTEVAVKGLREAEFMTVKTGDVLDLGLTFLETPLLHWPDSMTLLDEDGILFSNDARLDREIPEYILMDAARKF-VLKKFDEVKELGLLERIQMIAPSHG................... 234
70 -16.8002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  12  26........MVRIFHGYHTDEGSSYNSYFID-DECPTVIDSYPFAEEWLSRIAACDKIKYVVMNHADHASSLKDHYHKFNATFVCTKKCQEHLKILYGLIVDDKYTLKIGLKFIPVPLLHWPDSTTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVAQMRKALEVASTV-EIKYILSAHGVSWRGDAMGLAIAEYDRWS 250
71 -16.2001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  11  22.........YFHGPAFSTHRGTTYNAYLIV-DDKTALVDTEPFKEELIAKLKQIVKLDYLVVNHTDHAGAFPAIMELCDAHVLCTQRAFDSLKAHYSTIVKTGTSVSLGLTFIEAPMLHWPDSMTYVPEEALLLPNDARFDDQVDAGLIMDEAAKY--NLITKKLDEIQKINAIKTIAPSHGIIWRKDPGRIIEAYAR... 244
72 -15.6001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  13  1.MQATKIIDGFHLVGAIDPMGTTYNAYLVE-DEKTTLFDTAEYKGELLCGIASVKKIDYLVIQHLDHAGALPALIEACPEKIFTSSLGQKAMESHFHQVVKHGETLSLGVTFYETRMLHWPDSMSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLPQTLKAIETLVGAGAPEFICPDHG................... 227
73 -14.9003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  14  29.....................IKHGSLMLTYDNHSIQVDPVSEYAD----YTTFPKADIILITHGDHLDKAIQAVEKSDTEIIANENSQKKLGKGKVLKNGDTDTSISYMKIEAVPAYNTTGYILTFDGLRVYIAGDT--MKDLKDIDIAFLPVNQPYTMTVSQAAKAARMFSPKILYPYH.................... 203
74 -14.3005aho_A mol:protein length:336 5` EXONUCLEASE APOLLO  ali model follow..  16  8...............................PHTPIAVDF---------SLRRAGTARLFFLSHSDHTVG---LSSTWARPLYCSPITAHLLEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGTILYTGDFRYTPSMDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIG---LYSLGKESLLEQLALEFQ 199
75 -13.1001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  12  23.........VVGFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVLAQLQKYITPSDIDAVVLSHHDHVADIGVLQQLPELPIYGHTFDENGFPHTKGIPYNPEETLQIGFSISFLKTVHPVTCFAMRITAGVVYSADSFIPFTKDADLFICECNMYAHQEAAKAGHSIAKDANVKELLLTH.................... 229

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 5 7 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.