current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2q9u_A mol:protein length:414 A-type flavoprotein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MSSKPKYVQDQEMIPGVYWVGIVDWMVRIFHGYHTDEGSSYNSYFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCETVLLEMTSSDITKVALHTYDSGAVAFASPTLNNTMMPSVAAALNYVRGLTLIKGKPAFAFGAFGWSNRAVPDIVAELRDGCKADVYDEKGITFKFNYTEELLEQAYNAGVDLGKRAIAYCEKNAPKQLast
1 -131.0002q9u_A mol:protein length:414 A-type flavoprotein  ali model  100  1MSSKPKYVQDQEMIPGVYWVGIVDWMVRIFHGYHTDEGSSYNSYFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCETVLLEMTSSDITKVALHTYDSGAVAFASPTLNNTMMPSVAAALNYVRGLTLIKGKPAFAFGAFGWSNRAVPDIVAELRDGCKADVYDEKGITFKFNYTEELLEQAYNAGVDLGKRAIAYCEKNAPKQ 414
2 -118.0001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  37  2........QPVAITDGIYWVGAVDWNIRYFHGFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQNLAIKTIAPSHGIIWRKD-PGRIIEAYARWAEGQG-KAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRP-KNKVGLAFGAYGWGGGAQKILEERLKA-AKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD......... 398
3 -117.0001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  31  1.......MQATKIIDGFHLVGAIDWNSRDFHGYLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGVAPEFICPDHGVIFRGDQCTFAVQKYVEYAEQKP-TNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVKLMWCKACHHSQIMSEISDAGAVIVGSPTHNNGILPYVAGTLQYIKGLRP-QNKIGGAFGSFGWSGESTKVLAEWLTG-MGFDMPATP-VKVKNVPTHADYEQLKTMAQTIARALKAKLAA..... 402
4 -111.0002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  30  3.......AAAKRISDGVYWTGVLDWDLRNYHGY-TLQGTTYNAYLVCDEGVALIDNSYPGTFDELMARVEDAVGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLKHYPLREAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKFYANLITPLSKLVLKKFDEVKELRIQMIAPSHGQIWTDP--MKIIEAYTGWATGMV-DERVTVIYDTMHGSTRKMAHAIAEGAMSEGVDVRVYCLHEDDRSEIVKDILESGAIALGAPTIYDEPYPSVGDLLMYLRGLKFTLTRKALVFGSMGGNGGATGTMKELLAE-AGFDVA--CEEEVYYVPTGDELDACFEAGRKLAAEIRR......... 404
5 -107.0004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  30  2.........SIVVKNNIHWVGQRDWEVRDFHGYKTLRGSSYNSYLIREEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGPE----WNFNVVKTGDTLDIGNKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFEQCQRYYANILTPFSRLVTPKITEILNLPVDMIATSHGVVWRDN-PTQIVELYLKWAADYQ-EDRITIFYDTMSNNTRMMADAIAQGIAETDVAVKIFNVARSDKNEILTNVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRF-RNKRASAFGSHGWSGGAVDRLSTRLQD-AGFEMS--LSLKAKWRPDQDALKLCREHGREIARQWALAPLPQSTVN 403
6 -101.0001vme_A mol:protein length:410 Flavoprotein  ali model follow..  24  12.......TERIFDDPEIYVLRIDDDRIRYFEAWEIPEGISYNAYLVKNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIHDVEIIASNFGKRLLEGFYGIK--DVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGGGYLLPEILDSNESVVERYLPHVTKYIVTVIGHYKNYILEGAEKLSSLKIKALLPGHGLIWKKD-PQRLLNHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKEKGFTYKFSDEERPAISEILKDIPDSEALIFGVSTYEAEIHPLMRFTLLEIIDKAN-YEKPVLVFGVHGWAPSAERTAGELL-KETKFRIL-SFTEIKGSNMDERKIEEAISLLKKELE............. 404
7 -91.6004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  24  3.DSKPRDVQVLPIATNTKVLRARSWSRLRFEIYALERGTTSNSYVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAGDLRAAFPDDNLNILPMRGKETLDLGKHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDNWE--SFKEDQRYYFNCLMAPHAIHVEAALEKISDLQVRLYAVGHGPLVRTS-LIALTQAYADWSKAQKLE.............................................................................................................................................................. 256
8 -44.5003hly_A mol:protein length:161 Flavodoxin-like domain  ali model follow..  19  2.................................................................................................................................................................................................................................................................SVLIGYLSDYGYSDRLSQAIGRGLVKTGVAVEMVDLRAVDPQELIEAVSSARGIVLGTPPSQPS--EAVATALSTIFAAA-HNKQAIGLFDSYGGDDEPIDALLAQFRNL----HTAFPPIRVKDQPTEAIYQQCEESGTDLGQWLTRADAIQTMKS 153
9 -42.5003fni_A mol:protein length:159 Putative diflavin flavoprotein A 3  ali model follow..  17  1............................................................................................................................................................................................................................................................TKAETSIGVFYVSEYGYSDRLAQAIINGITKTGVGVDVVDLGAVDLQELRELVGRCTGLVIGMSPAASA--ASIQGALSTILGSV-NEKQAVGIFETGGGDDEPIDPLLSKFRNL----TTAFPAIRIKQTPTENTYKLCEEAGTDLGQWVTRDRLE..... 153
10 -32.8002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  11  5........SSGLVPRGSHML-RLSAPGQLDDDLCLLGDVQVPVFLLREASWALVEGGISRDAELVWADLCRWADPSQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAWKEACAWDALPVRAVADGEWLELGPRRLQVIEAH--HSDDHVVFYDVRRRRLFCGDALGEFDEAEGVWRPLVFDD------------------EAYLESLERLQRLPLLQLIPGHGGLLRGRLAADGAESAYTECLRLCRR---LLWRQSMGESLDELSEELHRAWGGQSVDFLPGELHLGSMRRMLEILSRQA......................................................................................................... 311
11 -27.3001fln_A mol:protein length:138 FLAVODOXIN  ali model follow..  16  1..................................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLN----EDILILGCSAMGPEVLEESEFEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGY---CVVVETPLIVQNEP-DEAEQDCIEFGKKIAN............. 137
12 -25.7004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  13  41.......AMPQKVYGNTWYVGT----------------CGISALLVTDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVLSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRTANIVTLADDGVVSVGPLALTAVASP--HTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRN---------------TLARVAALDCDILVTPHP------------SASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEE.................................................................................................................................. 292
13 -25.2003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  14  5.........................GLHSIPAGPVEFPEIATVYVMCGEKTVMIDA----------NSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQV-YKAKVLVKSGFKKYLTSEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTP--HARHHMSVLV--DDFLFTGDSAGA-----------------------YFNGVVIPTTPMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS................................................................................................................................... 260
14 -25.2004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  12  41.......AMPLKVYGNTWYVGT----------------CGISALLVTDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVFSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRTDPQVTLADDGVVSVGPLALTAVASP--HTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRN---------------TLARVAALDCDILVTPHP------------SASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEE.................................................................................................................................. 292
15 -25.1003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  13  9.......QQPFTIYGNTHYVGT----------------GGISAVLLSPQGHILVDGTTEKGAQVVAANIRAMFKLSDVKYILSTHSHEDHAGGISAMQKLT-GATVLAGAANVDTLRTGVSPKSDPQRAVADGELVKLGPLAVKAHATP--HTEGGITWTWQSCEQGKCKDV---------VFADSLTAVSADSYRFSDHPEVVASL----RGSFEAVEKLSCDIAIAAHPEV----------DMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASE.................................................................................................................................. 260
16 -24.9005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  12  14.......QAPFRLFGNTYYVGMKG----------------LSSVLVTPQGHVLIDGGLPESAPKIIANIGALFRIEDVKLILNSHGHIDHAGGLAELQRRS-NALVAASPSAALDLASGEVGPDDP-RLARDGGQFNVGPVYLTAHATP--HTPGGLSWTWQSCD-MVYADSINAVSRPGFKFSASSEYPNALAD---------------LRHSFETLEKLPCDVLISAHPEA----------QLWQRLEASATGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQQ............................................................................................................................... 271
17 -24.7002fax_A mol:protein length:138 FLAVODOXIN  ali model follow..  16  1..................................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLN----EDILILGCSAMGDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGY---CVVVETPLIVQNEP-DEAEQDCIEFGKKIAA............. 137
18 -24.2003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  12  38.......FEPFQLIDNIYYVGT----------------DGIAVYVIKSQGLILMDTAMPQSTGMIKDNIAKLFKVADIKLILNTHAHLDHTGGFAEIKKET-GAQLVAGERDKPLLEGGYYPGDEKNRAVKEGDRVTLGDTTLTAHATP--HSPGCTSWEMTVKDGKEDREVL--FCSGTVALNRLVGQPTYAGIVDDY------------RATFAKAKAMKIDVLLGPHPEV---------YGMQAKRAEMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQTAALE............................................................................................................................. 292
19 -23.9001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  12  8.......FPPFRIAGNLYYVGTDD----------------LASYLIVTPRNILINSDLEANVPMIKASIKKLFKFSDTKILLISHAHFDHAAGSELIKQQT-KAKYMVMDEDVSVILSGGKSDFHYAKVLHDGERVELGGTVLTAHLTP--HTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAEDY------------KHSIKVLESMRCDIFLGSHAGM----------DLKNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQ.................................................................................................................................. 260
20 -23.8001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  10  21.......MAPLQIADHTWQIGTED----------------LTALLVQPDGAVLLDGGMPQMASHLLDNMKARVTPRDLRLILLSHAHADHAGPVAELKRRT-GAKVAANAESAVLLARGGSDDL---RIVMDGEVITVGGIVFTAHFMA--HTPGSTAWTWTDTRNGKPVRI---------AYADSLSAPGYQLQGNPRYPHLIEDY----RRSFATVRALPCDVLLTPHP---------------GASNWDYAAGARAGAKALTCKAYADAAEQKFDGQLAKETAGAR............................................................................................................................. 269
21 -23.1005aeb_A mol:protein length:272 LRA-12  ali model follow..  11  21.......YRPFRIAGNLYYIGTYD-----------------ACYLITTKQNIIVNTGLAASALQIKNNIKALFKLTDTKILLTTQAHYDHLGAMAEIKKIT-GAKLMADEGDATVMADGGSSDYAFGRLLHDKDTIQLGDTKLVMLHHP--HTKGSCSFLFDTKDEQRSYRIL--ANMPTIVIEKKFSEVSSYPGIAKDY-----------AYTLQAMKNLSFDIWVASHASQ---------FSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN.................................................................................................................................. 272
22 -22.5003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  15  1..QVKDFVIEPPIKNNLH----------IYKTFGVFGGKEYSAYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNK--GIKTYATAKTNEFLKK--DGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWP-------------------KTINKLKAKKATLIIPGHDEWKGGGHVEHTLELLNK...................................................................................................................................................................... 218
23 -22.0001fla_A mol:protein length:138 FLAVODOXIN  ali model follow..  16  1..................................................................................................................................................................................................................................................................MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNID----ELLNEDILILGCSAMDDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGGKWMRDFEERMNGY---CVVVETPLIVQNEP-DEAEQDCIEFGKKIAN............. 137
24 -21.9001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  15  2.......VKIEKLKDNLY----------VYTTYNTFNGTKYAAYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKI--GAKTYSTKMTDSILAK--ENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKF------------------GAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKASN............................................................................................................................................................. 223
25 -21.5002fz5_A mol:protein length:137 Flavodoxin  ali model follow..  17  2..................................................................................................................................................................................................................................................................VEIVYWSGTGNTEAMANEIEAAVKAAGADVESVRFEDTNVDDVA----SKDVILLGCPAMGSEELEDSVVEPFFTDLAPKLKGKKVGLFGSYGWGSGEWMDAWKQRTEDTGATVIGTAIV----NEMPDNAPECKELGEAAAKA............ 137
26 -21.0001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  14  11.......ISITQLSDKVY--------YVSLAEIEGWGMVPSNGIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRK--GVQSYANQMTIDLAKE--KGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWP-------------------KTLDKVKAKSARYVVPGHGNYGGTELIEHTKQIVNQYIESTSK............................................................................................................................................................... 231
27 -20.8002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  13  4IKNETGTISISQLNKNVW----------VHTELGSFNGEAVPSVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSL-------------------VKSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEVGDKGLLLHTLDLLK....................................................................................................................................................................... 222
28 -20.7001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  15  11.......ISITQLSDKVY--------YVSLAEIEGWGMVPSNGMIVINHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKK--GVQSYANQMTIDLAKE--KGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWP-------------------KTLDKVKAKSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSK............................................................................................................................................................... 231
29 -20.5002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  12  11.KNETGTISISQLNKNVW--------VHTELGSFNGEAVPSNGLVLNSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRY-----------------RNINAVVPGHGEVGDKGLLLHTLDLLK....................................................................................................................................................................... 228
30 -20.4004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  10  14.......LTATKIDSDVF--------------VTDRDFYSSNVLVAKDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKM--GAETWSSDLTKQLRLE---VPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMI---KPKELGYLGDANVKAWP-------------------DSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVG................................................................................................................................................................... 246
31 -20.4003kap_A mol:protein length:147 Flavodoxin  ali model follow..  15  1................................................................................................................................................................................................................................................................SKVLILFGSSTGNTESIAQKLEELVAAGGHEVTLLNAAEASADNLADG---YDAVLMGCSAWGMEDLELQDDFAPLFDEME-LKGKKLAAFASGDMEYEHYCGAVPAIEEKARGLEVICEGLKIEGDASSDP-DAVSAFAEDVLKKL........... 147
32 -20.2005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  12  26.......VRLYQIADGVW--------SHIATQSFDGAVYPSNGLIVRGDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRKA--GVATYASPSTRRLAEAEGNEIPTHSGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWP-------------------TSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVAE.............................................................................................................................................................. 248
33 -20.2004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  12  1.NDEVPELRIEKVKENIF----------LHTSYSRVNGVSSNGLVVIDKGNAFI--VDTPWSDRDTETLVHWIRGYELLGSVSTHWHEDRTAGIKWLNDQ--SISTYATTSTNHLLKE---NKKEPAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRY------------------EAQIVIPGHGKIGDIALLKHTKSLAETASN................................................................................................................................................................... 221
34 -20.1003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  11  4IKNETGTISISQLNKNVW----------VHTELGSFNGEAVPSVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRY-----------------RNINAVVPSHGEVGDKGLLLHTLDLLK....................................................................................................................................................................... 222
35 -19.8002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  15  1.SQGHKPLEVIKIEDGVY--------HTSFKNIEGYGLVDSNGLVVLDNNAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLAR---------THYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVS-----------------KKYPIQMVVPGHGKVGSSDILDHTIDLAESASN................................................................................................................................................................... 221
36 -19.7003f6r_A mol:protein length:148 Flavodoxin  ali model follow..  17  2................................................................................................................................................................................................................................................................SKVLIVFGSSTGNTESIAQKLEELIAAGGHEVTLLNAADASAENLADG---YDAVLFGCSAWGMEDLEMQDDFLSLFEEFD-LAGRKVAAFASGDQEYEHFCGAVPAIEERAKELTIIAEGLKMEGDASNDP-EAVASFAEDVLKQL........... 148
37 -19.6004tyf_A mol:protein length:231 NDM-4  ali model follow..  10  4.DQRFGDLVFRQLAPNVW--------HTSYLDMPGFGAVASNGLIVRGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGLVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADK...................................................................................................................................................................... 229
38 -19.4003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  10  10.DQRFGDLVFRQLAPNVW--------HTSYLDMPGFGAVASNGLIVRGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADK...................................................................................................................................................................... 235
39 -19.1003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  11  23.......LVFRQLAPNVW--------HTSYLDMPGFGAVASNGIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRK................................................................................................................................................................... 245
40 -19.0004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  12  44.......VRLYQIADGVW--------SHIATQSFDGAVYPSNGLIVRGDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEAEGNEIPTHSGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEW-------------------PTSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVAE.............................................................................................................................................................. 266
41 -18.9002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  10  43.......VRLYKIGDGVW----------SHIATQKLGDTVYSSIVRDADELLLIDTWGAKNTVALLAEIEKQIG-LPVTRSISTHFHDDRVGGVDVLRAA--GVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVVRFGPVEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEW-------------------PATIKRIQQREAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVAE.............................................................................................................................................................. 265
42 -18.9002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  13  44.......VRLYQIADGVW----------SHIATQSFDGAVYNGLIVRDDELLLIDTWGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEVEGNEIPTHSGLSSSGDAVRFGPVELFYPGA---HSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEW-------------------PTSIERIQQHEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE.............................................................................................................................................................. 266
43 -18.9004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  14  1.AESLPDLKIEKLDEGVY----------VHTSFEEVNGVPKHGLVVLNAEAYLIDTFTAKDTEKLVTWFVER--GYKIKGSISSHFHSDSTGGIEWLNSR--SIPTYASELTNELLKK---------TNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYG--------------------KAKLVVPSHSEVGDASLLKLTLEQAVKGLN................................................................................................................................................................... 218
44 -18.9002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  11  1.........MKALLPGLYLL-----------PVPIPYPLKTNLYLLQGGEVALVDT-TRAARGALELHLAELLCFQDVKTILLTHHHPDHYGLSGFFEGL--GARVFLHEEEFARGHRFWREPEANPLPLRDGEALEVAGKRLRVLWTP--HADGHAAFYLEEEGVLLAGDAL---------------LEKVSPNVGLWAYTRENPLKDFLRS-LDRLADLGARVAYAGHFGPIADQRAEELKAHH---------QARLEALLALL--DGPKTAWELSLHLFPQELDPAGRRFAFAETLAHLEYLREEGAV....................................................................................................... 305
45 -18.8005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  14  17LAQGHKPLEVIKIEDGVY--------HTSFKNIEGYGLVDSNGLVVLNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLAR---------THYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVS-----------------KKYPIQMVVPGHGKVGSSDILDHTIDLAESASN................................................................................................................................................................... 238
46 -18.8004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  10  22.......LVFRQLAPNVW--------HTSYLDMPGFGAVASNGIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADK...................................................................................................................................................................... 241
47 -18.8005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  10  16.DQRFGDLVFRQLAPNVW--------HTSYLDMPGFGAVASNGLIVRGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRL................................................................................................................................................................... 244
48 -18.7003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  13  2...SEKNLTLTHFKGPLY--------------VEDKEYVQENSVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTL--GAKIVATQMTYDLQKS-YPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCIL-----ENLGNMSFANRTEYPKTLEK-------------LKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAP................................................................................................................................................................... 232
49 -18.7004heq_A mol:protein length:146 Flavodoxin  ali model follow..  16  2................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEGVAEAIAKTLNSEGMETTVVNVADVTAPGLAEG---YDVVLLGCSTWGDDEIELQEDFVPLYEDLD-LKDKKVGVFGSYTYFCGAVDVIEKKAEEL---ATLVASSLKIDGEPDSAEVLDAREVLARV............... 146
50 -18.7004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  10  19.DQRFGDLVFRQLAPNVW--------HTSYLDMPGFGAVASNGLIVRGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYA-------------------ASARAFGAAKASMIVMSHSAPDSRAAITHTARMADK...................................................................................................................................................................... 244
51 -18.6004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  13  2.GARLPDLKIEKLEEGVY----------VHTSFEEVNGVSKHGLVVLNTDAYLIDTFTATDTEKLVNWFVER--GYKIKGTISSHFHSDSTGGIEWLNSQ--SIPTYASELTNELLKK---------KNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGL----NLGDANLEAWPKSAKIL-----------------MSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLN................................................................................................................................................................... 219
52 -18.2004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  10  49.......LVFRQLAPNVW--------HTSYLDMPGFGAVASNGIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGPLKVFYPGP---HTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHY-------------------AASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRL................................................................................................................................................................... 271
53 -17.9004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  16  8........RVERLSNRVVRVLGCNPGPMTLQG---------NTYLVGTGPRRILIDTGEPAIPEYISCLKQALTNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTP--HTDDHMALLLEEENAIFSGDCILGEGTT------------VFEDLYDYMNS------------LKELLKIKADIIYPGHGPVIHNAE-----AKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKII--KNTPENLHEMAKHNLLLHLKKLEKEGKIF...................................................................................................... 276
54 -17.0001akq_A mol:protein length:147 FLAVODOXIN  ali model follow..  14  1................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDSIELQDDFIPLFDSLE-AQGRKVACFGCYEYFCGAVDAIEEKLKNL---AEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI........... 147
55 -16.9001f4p_A mol:protein length:147 FLAVODOXIN  ali model follow..  14  1................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDSIELQDDFIPLFDSLE-AQGRKVACFGCWEYFCGAVDAIEEKLKNL---AEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI........... 147
56 -16.8002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  12  9.........................DLYSWSTFNPARNIDFNGFAWIPEGNILIDP--VALSNHDWKHLESL---GGVVWIVLTNS--DHVRSAKEIADQT-YTKIAGPVAEKENFPIYCD------RWLSDGDELVPG---LKVMELQGSKTPGEL-ALLLEETTLITGDLVRAYRAGGLEILPDEKLMNK----------------QKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKELVATLA.................................................................................................................................................................... 201
57 -16.7001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  12  3.......MSLTQVSGPVY--------------VEDNYYVQENSVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSI--GAKVVSTRQTRDLMKS-YPDLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCI-------------------LKEKLGNLSFADVKAYPQTLERL--KAMKLPIKTVIGGHDSPLHGPELIDHYEALIKAAPQSS................................................................................................................................................................ 228
58 -16.4001i1o_A mol:protein length:147 FLAVODOXIN  ali model follow..  14  2.................................................................................................................................................................................................................................................................KALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDSIELQDDFIPLFDSLE-AQGRKVACFGCHEYFCGAVDAIEEKLKNL---AEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI........... 147
59 -16.2005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  14  23........DTFEVAPGVRWL-----------RMPLPFSLDHNLWLLRDAGWTIVDC-SEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGDNVRLWMTLGEYMFGCLMAAGNGSNYRRLREGDAVKIGARTWRVVTGY--HSPEHCALHSEADGVLISGDMVLPRISTNSVFDLEPE------------ANPLALY----LESLGRYETMAPDLVLPSHGKPFRGTRIAQLRAHH---------DARLEEVRVACAEKPMSAAGIVPIMFRRRELDIHQMTFALGEALAHLNLLWLAGEL....................................................................................................... 345
60 -15.8001j9e_A mol:protein length:147 FLAVODOXIN  ali model follow..  14  2.................................................................................................................................................................................................................................................................KALIVYGSTTGNTEYTAETIARELADAGYEVDCRDAASVEAGGLFEG---FDLVLLGCSTWGDDSIELQDDFIPLFDSLE-AQGRKVACFGCYEYFCGAVDAIEEKLKNL---AEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI........... 147
61 -15.7001fx1_A mol:protein length:148 FLAVODOXIN  ali model follow..  14  2................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARQLANAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDSIELQDDFIPLFDSLE-AQGRKVACFGCYEYFCGAVDAIEEKLKNL---AEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI........... 148
62 -15.6001akr_A mol:protein length:147 FLAVODOXIN  ali model follow..  14  1................................................................................................................................................................................................................................................................PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWADDSIELQDDFIPLFDSLE-AQGRKVACFGCYEYFCGAVDAIEEKLKNL---AEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI........... 147
63 -15.5001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  13  27......................................HFSTVVYLEKDRRIIIDPGNLSSMDELEEKFSELISPDDITDVLFTHVHLDHIFNSV----LFENATFYVHEVYKTKNYLSFGISSWKNVVLLKGEE-SLFDEKVKVFHTP--HAREHLSFLLDTENVLITGDIT--------------------PNRLSYYDIIKGYGSVQVKNFLDRVGRIDL-LVFPHDAPLKPE.................................................................................................................................................................................. 212
64 -15.5004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  15  66......................................GGAEAALEEARGPILVDTGGPWAREALLGALAGQVAPGDVTLVVGTHGHSDHIGNLG----LFPGAALLVSHDFCLPGGRYLPHG------LGEGQPLRLGP-GLEVWATP--HGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV--------------------ADVVVPGHGPPFR................................................................................................................................................................................... 236
65 -15.2001wsb_A mol:protein length:148 FLAVODOXIN  ali model follow..  14  2................................................................................................................................................................................................................................................................AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEG---FDLVLLGCSTWGDDCIELQDDFIPLFDSLE-AQGRKVACFGCYEYFCGAVDAIEEKLKNL---AEIVQDGLRIDGDPRAAR-DDIVGWAHDVRGAI........... 148
66 -14.5002ark_A mol:protein length:188 Flavodoxin  ali model follow..  22  6.................................................................................................................................................................................................................................................................KVLVIYDTRTGNTKKMAELVAEGARSEGTEVRLKHVDEATKEDVL----WADGLAVGSPTNMGLVSWKMKRFFDDVLG-GEIDGKIACAFSSSG-GGGNEVACMSILTMLMNFGFLV--AVVAGEPRSEEEKEACRRLGRRLAEWVAIFVDGRKE.. 174
67 -14.1003d7n_A mol:protein length:193 Flavodoxin, WrbA-like protein  ali model follow..  15  3............................................................................................................................................................................................................................................................TNSSSNTVVVYHSGYGHTHRMAEAVAEGAEAT---LHAIDAEGNLSEDGWAALDAADAIIFGTPTYMGGPSWQFKKFADASSKPAKWQDKVFGGFNSASLNGDKLNTLQYLVLLAGQHGGLQSDADAAPEEMSVGDLETARLYGARVANVARQHKSTER... 192
68 -13.9004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  13  8............................LLRQMFEPVSCTF-TYLLGDRESVLIDPV-LETAPRDAQLIKEL--GLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQAD----------LHIEDGDSIRFGRFALETRASP--HTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQ---------CAKTLYHSV------------EKIFTLPGDLIYPAHD--YHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCG................................................................................................................................. 232
69 -13.4001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  11  14..........................................MYLVIDDETKEAAIVDPVQPQKVVDAARK--HGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALT----------HKITHLSTLQVGSLNVKCLATP--HTSGHICYFVSEPPAVFTGDTLFVAGC-GKFYEGTADEGRLPPDTRVYFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAV.................................................................................................................................................... 248
70 -13.1004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  15  2............................IFRQLFDSESSTY-TYLIGDEATVLIDPVLEQ-VDRDLQMVAEL--DLTLTHVFDTHVHADHITASGALRERTQATVVGSVNGASCA------------VQVRHGDEVRVGQLVFQVLATP--HTDDSI-SYLLGDRV-FTGDALLVRGNGRTDFQN---------NASQLYDSL------------RVLFTLPDELVYPGHDYKGRTVTSIAEEKRHNPRVAGKSREEFIHIMENLNLPRPKLIDAAVPANRA.................................................................................................................................... 222
71 -13.0002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  15  14.........................................NAYLVTGEGPVLIDPGDEP------EKLLALFQTTGLIAILLTHAHFDHVGAVAPLVEAL-DLPVYLHPLDLPLYEGAIPKPPLPVRPLEEGMRL----FGFQVLHLP--HSPGHVAFYDPEGAQVFSGDL---------LFRGSVGR-----------YDLPGADPKALFASLKRLLSLPPETVHPGHGP...................................................................................................................................................................................... 186
72 -12.4002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  12  20..............................RNFVAEHGLSL--LLKKGNKEIVVDT---GQSENFIKNCGLMIDVGRIKKVVLTHGHYDHIGGLKGLLERNPEVKIYTHKEILN--KKYAMRKGGQFEEIGDLSFYEKYKNNFVLIDKDAEIEEGFYVITNTDITYDNEFTTKNFFVEKEGKRDKFLDEVFVVVKEEDGINVVTGCSHAGILNILETARNR--SLIGGFHLRGMEEEKVKDIARKIEEYG------KKVLTGHCTGIDEYGFLKSVLKDKISYLTTSSSI............................................................................................................................ 276
73 -12.4001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  12  34.....................................GEATSGYLFEDGFRLLVD-----CGSGVLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKT--VHPVTCFAMRITAGNVVYSADS----SYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKANVKELLLTHLPHTGN.................................................................................................................................................................................. 235
74 -12.3005f4b_A mol:protein length:202 NAD(P)H dehydrogenase (quinone)  ali model follow..  23  6.................................................................................................................................................................................................................................................................KMLVLYYSAYGYMEQMAKAAAEGAREGGAEVTLKRVPELVPEEVAKELADYDAIIIGTATRYGMMASQMKNFLDQTGGLGALINKVGSVMVSTATQHGGAEL....................................................... 126
75 -12.3002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  10  1MGNKLFVLDEIRVDENFIIANSTFVTPQKPTVSSRLIDIPVSAYLIQTDATVLYDTYIGASECNLPERLRQLLSPDDISTVVLSHLHNDHAGCV----EYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKERERELAPGVNLLNFGT--HASGLAVRLEKQPGFLLVSDAC-----TATNYGPPARRAGVLHDTIGYDRTV---------SHIRQYAESRSLTVLFGHDR...................................................................................................................................................................................... 261

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 3 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]