current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2uyx_A mol:protein length:228 BETA-LACTAMASE II, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst ASQKVEKTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLKLast
1 -105.0002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model  100  1ASQKVEKTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK 228
2 -102.0002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  98  1......KTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK 222
3 -101.0003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  97  1......KTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK 222
4 -99.0003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  34  1...........QVKDFVIEPPIKNNLHIYKTFGVFGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLN 217
5 -98.0001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  36  1...............DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLIN 213
6 -96.8001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  32  1......AQKSVKISDDISITQLSDKVYTYVSLAEIEGWGVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVN 223
7 -96.3001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  32  1......AQKSVKISDDISITQLSDKVYTYVSLAEIEGWGVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVN 223
8 -94.6003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  29  1.SNANYMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 234
9 -92.0004tyf_A mol:protein length:231 NDM-4  ali model follow..  30  3.........GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 228
10 -91.8005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  29  6PTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 240
11 -91.3002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  36  1..........SQGHKPLEVIKIEDGVYLHTSFKNIEGYGVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAE 217
12 -91.3004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  28  6PTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 240
13 -90.6004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  29  9PTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 243
14 -90.6005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  36  10EPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGTHSLEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVT 239
15 -90.5004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  36  1..........NDEVPELRIEKVKENIFLHTSYSRVNGFGVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRK-NGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKE-PAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAE 217
16 -90.4003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  29  7PTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 241
17 -89.8005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  35  8LILLVALPALAQGHKPLEVIKIEDGVYLHTSFKNIEGYGVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAE 234
18 -89.5004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  29  33PTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 267
19 -89.0004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  32  1.........AGARLPDLKIEKLEEGVYVHTSFEEVNGWGVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVE-RGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSG-VSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG---DANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAV 215
20 -88.3004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  37  28EPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVK 257
21 -88.3002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  34  27QPGGEYPTVDDIPVGEVRLYKIGDGVWSHIATQKLGDTVYSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPKALSSSGDVVRFGP--VEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVK 256
22 -87.7002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  36  28DSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGTHSLEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVK 257
23 -87.5004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  35  1..........AESLPDLKIEKLDEGVYVHTSFEEVNGWGVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVE-RGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSG-VNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG---DANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAV 214
24 -82.0004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  27  2....PKSSDHVDLPYNLTATKIDSDVFVVT-----DRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLG---DANVKAWPDSARRLKK--FDAKIVIPGHGEWGGPEMVNKTIKVAE 242
25 -80.7003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  23  1...........MSEKNLTLTHFKGPLYIVED-----KEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWKSLPDTVFPG--DFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN----LGNMSFANRTEYPKTLEKLKGLILKVDSIIAGHDTIHDVGLIDHYLTLLE 229
26 -79.8001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  28  1..............AGMSLTQVSGPVYVVE-----DNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWLVLPNVVHDGDFTLQEGK--VRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK----LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPHGPELIDHYEALIK 222
27 -34.5002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  14  5.................SSGLVPRGSHMLRLSAPGQGDVQVPVFLLRLGEASWALVEGGISRD-AELVWADLCRADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALFDEAEGVWRPLVFDDMEAYLESLERLQR-LPTLLQLIPGHGGLLRGRLAADGAE... 249
28 -34.4001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  15  5LPQLRAYTVDASWLQPMAPLQIADHTWQIGTED--------LTALLVQTPDGAVLLDGG-MPQMASHLLDNMKARTPRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSDNADRIVMDGEVITVGGIVFTAHFM-AGHTPGSTAWTWTDTRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRAL--PCDVLLTPHPGASNWDYAAGARAGAK 242
29 -33.3003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  15  22TIKDFLAVAMKKWTAPFEPFQLIDNIYYVGTDG--------IAVYVIKTSQGLILMDTAMPQS-TGMIKDNIAKLKVADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYPKVDRAVKEGDRVTLGDTTLTAHAT-PGHSPGCTSWEMTVKDVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAM--KIDVLLGPHPEVYG............ 247
30 -33.2003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  17  6.............SSPQQPFTIYGNTHYVGTGG--------ISAVLLSSPQGHILVDGT-TEKGAQVVAANIRAMKLSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPAKVRAVADGELVKLGPLAVKAHAT-PGHTEGGITWTWQSCEVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKL--SCDIAIAAHPEVND............ 220
31 -32.5001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  12  5.............PNPFPPFRIAGNLYYV--------GTDDLASYLIVTPRGNILINSDLEAN-VPMIKASIKKLKFSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKSTVDKVLHDGERVELGGTVLTAHLT-PGHTRGCTTWTMKLKDAVIIGSIGVNPGYKLVDNITPKIAEDYKHSIKVLESM--RCDIFLGSHAGMFD............ 220
32 -32.5002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  16  6.....................HRPDLYSWSTFNPARN--IDFNGFAWIRPEGNILIDPV---ALSNHDWKHLESLGG--VVWIVLTN--SDHVRSAKEIADQYTKIAGPVAEKENFPIY----CDRWLSDGDELVPG---LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVLAALEKVEAVLVGDGWSVFRDGRDRLKELVA 198
33 -32.4002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  13  1..................MKALLPGLYLLPVPIPYPLKTV--NLYLLQGAGEVALVDTALGTRAARGALELHLAELGQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHR-HPPQNPLPLRDGEALEVAGKRLRVLW-TPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAENPLKDFLRSLDRLADL--GARVAYAGHFGPIAEELKAHHQARLE 256
34 -32.2004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  13  25APASRGCADDAGWNDPAMPQKVYGNTWYVGTCG--------ISALLVTSDAGHILVDAAT-PQAGPQILANIRALRPEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDGYLAAFRNTLARVAA--LDCDILVTPHPSASG............ 255
35 -32.1002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  19  11.......................................LQENAYLVETGEGPVLIDPGDE---PEKLLALFQTT-GLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLALPVRPLEEGMRL----FGFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYD-LPGADPKALFASLKRLLS-LPPETRVHPGHGPGTTLGLEARTNPFLT 201
36 -32.0004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  12  25APASRGCADDAGWNDPAMPLKVYGNTWYV--------GTCGISALLVTSDAGHILVDAAT-PQAGPQILANIRALRPEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPVANIVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASG............ 255
37 -31.9003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  12  20.........................................ATVYVMCGEKLTVMIDAGVSNSIADFSFL-------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDGQDKVIEVEGNEEFDLGGYRMRLIYT-PGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIPTTVIDYKMYMESLKRQIEL--KPKVVGFAHGGLVSPKIMEEHLKQML 224
38 -31.7005aeb_A mol:protein length:272 LRA-12  ali model follow..  10  5QKVKEPTVSNADWSKPYRPFRIAGNLYYI--------GTYDLACYLITTKQGNIIVNTGLAAS-ALQIKNNIKALKLTDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSIIADRLLHDKDTIQLGDTKLVMLHH-PGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKPGIAKDYAYTLQAMKNL--SFDIWVASHASQFS............ 232
39 -31.7005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  13  1...TPGCEVCATWNADQAPFRLFGNTYYVGMKG--------LSSVLVTSPQGHVLIDGGLPES-APKIIANIGALRIEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVVKDMRLARDGGQFNVGPVYLTAHAT-PGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGPNALADLRHSFETLEKL--PCDVLISAHPEASQ............ 228
40 -28.6004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  16  8.................RVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGAIPEYISCLKQALTE-FNTAIQEIVVTHWHRDHSGGIGDICKSYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCILGEGTTVF-----EDLYDYMNSLKELLKI--KADIIYPGHGPV.............. 203
41 -28.1001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  17  29.........................................STVVYLEHKDRRIIIDPGNLSS-MDELEEKFSELGISPITDVLFTHVHLDHIFNSVLFENATFYVHEVYTIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRL-----SYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHD................ 206
42 -27.5004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  15  3TEPLCGASPLLVPGDPYSVVVLLQGYAEPEGVGDAPRGSGGAEAALEEAARGPILVDTGGPWAR-EALLGALAGVAPGDVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPGLEV--------WATPGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV---ADVVVPGHGPP.............. 234
43 -27.2002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  16  11.......................................FSQNCSLIWCEQLAALVDPGGD---AEKIKQEVDAS-GVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQGQPLTPDRWLNDGDRVSVGNVTLQVLHC-PGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSD-FPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQ 209
44 -25.8001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  19  9.......................................LTDNYMYLVIDDEAAIVD----PVQPQKVVDAARKH-GVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGG--------DDRIGALTHKITHLSTLQVGSLNVKCLAT-PCHTSGHICYFVSKPGAVFTGDTLFVAG---CGKFYEGTADEMCKALLEVLGRLPPDTRVYCGH---------EYTINNLK 181
45 -25.1005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  15  23.................DTFEVAPGVRWLRMPLPFSLDHI--NLWLL-GQAGWTIVDCGISSEAIRTHWEQIRHLDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTLGEYMFGCLPAVPPRYRRLREGDAVKIGARTWRVVT-GYGHSPEHCALHSEADGVLISGDMVLPRISTNVSVFDLE-LALYLESLGRYETMAPD-TLVLPSHGKP.............. 274
46 -25.0002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  11  41.......................................IPVSAYLIQCTDATVLYDTGCHPECMCNLPERLRQLGLSPISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRVNLLNFGTGHASGMLGLAVRLEKFLLVSDACYTATNYGPPARRAGDTIGYDRTVSHIRQYAESRSLVLFGHDREQFASLIKSTDGFYE 276
47 -24.7001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  17  9.......................................LKDNYAYILHDEDVGVVDPS----EAEPIIDSLKRS-GRNLTYILNTHHHYDHTGGNLELKDR----YGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSLS---CGKLFEGTPKQMLASLQKITS-LPDDTSIYCGHEYTLSNSKFALSLE... 183
48 -23.8002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  14  31.......................................LKDNFSYLINDHTLAAVDV---NADYKPILTYIEEHLKQTFSTILSTHKHWDHSGGNAKLKAEEAMNSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDA-PCHTRGHVLYKVQHPQALFTGDTMFIAG---IGAFFEGDEKDMCRAMEKVYHIHKGNDYALDGH---------EYTSGFMT 228
49 -23.8004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  14  2.........SDSKPRDVQVLPIATNTKVLRARS---ERGTTSNSYVIEGDK-TAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRAPDDNLNILPMRGKETLDLGGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFKEDQRYYFNCLMAPHAIHVEAALEKISD--LQVRLYAVGHGPLVRTSLIALTQAYAD 248
50 -23.6004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  15  28................................................ESREAVLIDP----ETAPRDAQLIKEL-GLRLLYAVNTHCHADHITGSGLLRSL------LPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRAS-PGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTD-FQQGCAKTLYHSVHEKIFTLPGDCLIYPAHD................ 180
51 -23.0003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  13  2..............SDTKVYLLDGGSLVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYEKHQTIPGALGLLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQEGTTRANSTFEGIDGDVDLARGVKLIST-PGHSIGHYSLLVEFPRILFTIDAAYTQKSTLCQAAFHIDPVAGVNSMRKVKKLAEDHGALMYSHDM............... 254
52 -22.8002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  13  35.......................................LPVWCYLLETEEGPILVDTGMPESAVNNIVNILKRVEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEY-EAALHREEYMKECILPHLNYKIIEGDYEV-QLLYTPGHSPGHQSLFIKTEQVLLTIDASYKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIFFGH-DIEQEKSCRVFPEYI. 252
53 -22.8003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  13  21.......................DHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNIVNILKRVEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEY-EAALHREEYMKECILPHLNYKIIEGDYEV-QLLYTPGHSPGHQSLFIETEQVLLTIDASYTKEN-----FAGFDPELALSSIKRLKEVVKKEKPIFFGH-DIEQEKSCRVFPEYI. 254
54 -22.0004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  21  22................................................ATRQAVLIDPVLE--QVDRDLQMVAEL-DLTLTHVFDTHVHADHITASGALRER---------ATVVGSVNGASCANVQVRHGDEVRVGQLVFQVLAT-PGHTDDSISYLLGDR--VFTGDALLVRGNGRTD-FQNGNASQLYDSLTRVLFTLPDETLVYPGHD................ 171
55 -22.0002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  16  2...............KAAAKRISDGVY-LRNYHGYTLQGTTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDALMDAARKFYANLITPLSKLVLKKFDEVLGLLERIQMIAPSHGQI.............. 236
56 -21.9002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  15  27.................................................DKPALLIDP----KTVDRDLKLIDEL-GLKLIYAMNTHVHADHVTGTGLLKTK------LPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRAT-PGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTD-FQEGSSDQLYESVHSQIFTLPKDTLIYPAHD................ 184
57 -20.6001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  12  2.................QPVAITDGIYYFHGPAFSTHRGTTYNAYLIV-DDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKASHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYAR 244
58 -20.5002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  12  2..........SSKPKYVQDQEMIPGVYVRIFHGYHTDEGSSYNSYFID-DECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKIGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANIVEIKYILSAHGVSWRGDAMGLAIAEYD 247
59 -20.4001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  14  1................MQATKIIDGFHLVGAIDTLSPMGTTYNAYLVE-DEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDILERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVI.............. 229
60 -20.2004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  13  3...................IVVKNNIHDFHGTEYKTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSIN--GPEWNFNVVKTGDTLDIGGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDALFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLK 240
61 -19.8001vme_A mol:protein length:410 Flavoprotein  ali model follow..  16  42.....................................EGISYNAYLVKLNGANVLIDG-WKGNYAKEFIDALSKIVDKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEGFYGIKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGGGYLLPEILDDSNESIGHYKNYILEGAEKLLKIKALLPGHGLIWKKDPQRLLNHYVS 251
62 -19.7004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  16  59..........................................NAFLVNIGKSLILIDSGAASSHLGSVLSNLKASGYQPVDTILLTHLHPDHVCGIANFPNATVYVSNDEAKLPKEKQANYLGTVEKIKQAIAPYQAKQRFKTYKLGAGHTPGHFSYELKTESIVFIGDIVHSHTVPETAIEYDIDPKKAVETRLKQFANFAKNGQTIPGIGHTYSAD.......... 278
63 -19.6003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  13  5...............DISIHYLNGGNTKMDGANERNQINLPTHPILIQTAQYNLIIDAGIGNGKESHIIADLANLTPKDIDYVLMTHMHFDHAAGLAIFENAIHVVQQDEAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPV-MQHSGGHSFGHTIITIESDKAVHMGDIFPTTAHPLWVTAYDDYPMQSIREKERMIPYFIQQQYWF--HDENYFAVKYSDDGENID 268
64 -19.2004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  19  1...DDLSGFKKIKLGELELFILTDGYILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGFSAITDIFLSHAHPDHIGGVLVFPNASIFISKIEFNNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNPGHTPGLTVTTISSEKLMYVADLIHSDVIPDWGFSGDTDLDIATASRKKFLKQLADTKARAPGLGFTKVKA.......... 282
65 -19.1004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  16  29QQKTQVPGYYRMALGDFEVTALYDGLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGYQPVDTVLLTHLHPDHACGLPAYPNATVEVPQAEMAQQAVAPYAKMNKLKPYKTEGELLPGVSLVAS----PGHTPGHTSYLFKSQSLLVWGDILLNHAVPEVVFEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV.............. 303
66 -19.1004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  16  29QQKTQVPGYYRMALGDFEVTALYDGLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGYQPVDTVLLTHLHPDHACGLPAYPNATVEVPQAEMARQAVAPYAKMNKLKPYKTEGELLPGVSLVAS----SGHTPGHTSYLFKSQSLLVWGDILINHAVPEVVWEFDVDSDQARQSRQRILAEAATDKLWVPGLGHVREEA.......... 307
67 -18.9003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  14  3SGVDLGTENLYFQSNAMFFKQFYDK--------------HLSQASYLIGCQKAMIID----PIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHT-PGHTPESISFLLTDEGGLFSGDFIFVGKAVKVEGSSEIGAKQMFKSIESIKD-LPDYIQIWPGHGA............... 215
68 -18.8001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  14  39QVRTSAPGYYRMLLGDFEITALSDGTVALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAGPTLGRLAANLKAAGYQPVDEIYITHMHPDHVGGLLAFPNAVVRADQKEGAMASLNPYVKAGKFKPFSGNTDLVPGIKALAS----HGHTPGHTTYVVESQKLALLGDLILVAAVPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIPGIGHI.............. 311
69 -18.2003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  18  15.........................................AHASYLVGCQEACVID----PARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRAAICVSDEGPPEWKSEYVKAYPHRLLKDGDELHFGNVRIVVMHT-PGHTPEHVSYLLYDGKALFSGDFVFVGRVAGESGSSEALARQMFRSLRKFEA-LPDHVQVLPAHGA............... 201
70 -16.5004nur_A mol:protein length:633 PSdsA  ali model follow..  15  89..................LFEVTDGIYQVRNYD-------LSNMTIVEGKDGITIFDPLISQETAKAALDLYYKHRKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAETLIPPTDIIKETETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDS-THTLHNTYSLRGAKIRDWSKYLNEALKLWGDDVQVMPVWGNKEVREQLSLQRDMYR 348
71 -16.4002cfu_A mol:protein length:658 SDSA1  ali model follow..  19  107..................LFEVAEGIYQVRGFD-------LANITFIRGDSGWIVVDTLTTPATARAAYELVSRELERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKENLLAPTRLIEGEEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENV-VGTLHNLYTLRGAEVRDWSKYINQALHRFGRQAEVMPRWGNAEIVEVLEKQRDLYG 366
72 -16.2004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  14  89..................LFKVTDKMYQVRGQD-------ISNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQHRQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISESIIAPTKTIVRTEKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENA-THTLHNFYTLRGAKTRDWTEYLNETLDMWGNDAEVLPVWGNKHINDYIGKYRDTIK 348
73 -16.0002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  16  117..................LFEVMPKLYQVRGLD-------PANMTIIEGDSGLVLIDTLTTAETARAALDLYFQHRKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSENLVAPNVLIEKPERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNA-PPAMHNLLTPRGAEVRDWAGYIDASLEKYGDRTDVLPVWGGDKVRTYLADQRDMYA 377
74 -15.6002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  13  23............................................VLTNDEGRCVIVD----PGEAAPVLKAIAEH-KWMPEAIFLT----DHVGGVKELLQHQMTVYG--------AETQDKGATHLVGDGDTIRVLGEKFTLFAT-PGHTLGHVCYFSRP--YLFCGDTLFSGG---CGRLFEGTPSQMYQSLMKINS-LPDDTLICCAH................. 168
75 -15.5003x2x_A mol:protein length:227 UPF0173 metal-dependent hydrolase TM_1162  ali model follow..  14  8.........................................GHAVVLIEGKKNIIID----PFISGNPVCPVKLEGLPKIDYILVTAGHGDHLGDAVEIAKKDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYIEGKKIYHAGDTGLTREMELLAEIGGNFVMDVEDAV--RAAVMIKPKKVVPMH................. 191

FFAS is supported by the NIH grant R01-GM087218-01
1 1 8 0 3 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.