current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQDLast
1 -109.0002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model  100  1MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD 210
2 -89.6002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  38  1MRVFPVTLGPLQENAYLVET--GEGPVLIDPGDEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEALDLPVYL-HPLDLPLYEGADLAARAWGLAIPKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPGADPKALFASLK-RLLSLPPETRVHPGHGPGTTLGLEARTNPFLTG 202
3 -47.9001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  20  29...HTWQIGTEDLTALLVQTPD--GAVLLDGGQMASHLLDNMKARGVTLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDTVRALPCDV-LLTPHPGASNWDYAAGARAGAKA 243
4 -47.1004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  28  22...............YLLGDRESREAVLIDPVLEAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLS--------------------GAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHD-VSTVEEERTLNPRLT. 200
5 -45.9005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  23  22...NTYYVGMKGLSSVLVTSPQG--HVLIDGGESAPKIIANIGALGFRVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGGPDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGSEYPNALADLRETLEKLPCDV-LISAHPEASQLWQRLEADAFVDP 247
6 -45.8001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  20  7......PFPPFRGNLYYVGTDDLASYLIVTPRGNVPMIKASIKKLGFKTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYANDTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKKIAEDYKHSI-KVLESMRCDI-FLGSHAGMFDLKNKYVNNPFVDP 239
7 -45.4004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  31  16...............YLIGDEATRQAVLIDP-EQVDRDLQMVAELDLTLTHVFDTHVHADHITASGALRERTQATVVGSVNGAS---------------------CANVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLGDR--VFTGDALLVRGNGRTDFQNGNASQLYDSLTRVLFTLPDETLVYPGHD-VTSIAEEKRHNPRVA. 191
8 -45.4005aeb_A mol:protein length:272 LRA-12  ali model follow..  20  26IAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGHGMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMFSEVSSYPGIAKDYAYTL-QAMKNLSFDI-WVASHASQFSMHSKHKPKSFMDR 251
9 -45.0003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  21  17...NTHYVGTGGISAVLLSSPQG--HILVDGTKGAQVVAANIRAMGFKVKYILSTHSHEDHAGGISAMQKLTGATVLGAANVDTLRTGVSPKSDPQFGLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLSADSYRFSDHPEVVASLREAVEKLSCDI-AIAAHPEVNDMWTRQQNSAYVDN 239
10 -44.4003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  23  46...NIYYVGTDGIAVYVIKTSQ--GLILMDTAQSTGMIKDNIAKLGFKIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSVGQPTYA-GIVDDYRATFA-KAKAMKIDV-LLGPHPEVYGMQADGAPNPFIKP 266
11 -43.9002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  29  24...................SHPDKPALLIDP-KTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKAS--------------------GSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVQPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHD-VSTVGEEMQHNPRLTK 205
12 -42.7001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  28  1..MQIELVPCLKDNAYILHDEDTGTVGVVDPS-EAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKD------------------RIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKL---EGTPKQMLASL-QKITSLPDDTSIYCGH--PTTVKMEKACNPFLR. 222
13 -42.0001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  25  1..MKVEVLPALTDNMYLVIDDETKEAAIVDPV-QPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLEGLKVYGGDD---------------------RIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFGSEPPAVFTGDTLFVAGCGK--FYEGTADEMCKALLEVLGRLPPDTRVYCGH--PSTLAEEFTYNPFMR. 226
14 -41.3003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  19  5.GLHSIPAGPVEFTVYVMCGEK--LTVMIDAGVSNSIADFSFLD---KLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSE-DLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLV--DDFLFTGDAYFNGVVIPTTPPVIDYKMYMESL-KRQIELKPKV-VGFAHGGLVSPKIMEEHLKQMLS 225
15 -38.2002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  25  21SAFSVTVVPTLKDNSYLINDHTTHTLAAVDVNADYKPILTYIEEHTYTFSTILSTHKHWDHSGGNAKLKAELEA--------------NSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKPNDGVALFTGDTMFIAGIGA--FFEGDEKDMCRAMEKNDYALDKVTFIFPGH--PSSLAEEKRQNLFLR. 278
16 -37.9002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  24  18......PARNIDFNGFAWIRPE--GNILIDPVALSNHDWKHLESLG-GVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENF-----------------PIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDNKQKVVASVR-RLAALEKVEAVLVGDGWSVFRDGRDRLKELVA. 198
17 -37.3002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  26  6GSMNLNSIPAFQDNYIWVLTNDEGRCVIVDPG-EAAPVLKAIAEHKWMPEAIFLT----DHVGGVKELLQHFQMTVYGPAET--------------------QDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSRP--YLFCGDTLFSGGCGRL---EGTPSQMYQSL-MKINSLPDDTLICCAH--PVILKNERKINLFLR. 221
18 -35.1003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  32  4MYLRRFYDEGLAHASYLVGCQETGEACVIDPARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEWKSEYVKA-------------PHRLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKALFSGDFVFVGDVGRPDLSEALARQMFRSLR-KFEALPDHVQVLPAHGPSSTVGYEKLVNWALQH 229
19 -34.6003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  29  19MFFKQFYDKHLSQASYLIGCQKTGEAMIIDPIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKLNANIVSGESDDTLGYKNMPNHTHF--------------VQHNDDIYVGNIKLKVLHTPGHTPESISFLAQVPMGLFSGDFIFVGDIGRPDLLEKA-KQMFKSIE-SIKDLPDYIQIWPGHGPTSTLGYEKQTNWAFSE 243
20 -34.0002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  24  24LDDDLCLLGDVQVPVFLL--LGEASWALVEGGRDAELVWADLCRWVAQVHYWLITHKHYDHCGLLPYLCPRLNVQVLASERTCQAWKSQLLRAEQRLPEACAWDALPVRAVADGEWLELGPHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALDEAEGVWRPLVFDDMEAYLESL-ERLQRLPTLLQLIPGHGGLLR............. 240
21 -32.6004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  21  40......PAMPQKCGISALLVTSDAGHILVDAAQAGPQILANIRALGFRVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAIS-HPGYLAAFRNTL-ARVAALDCDI-LVTPHPSASGLWNRIGPAPLMDT 271
22 -32.5004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  28  22...............YLVMDRETRQCALIDSVLDADRLVERVNELNASVRWVLETHVHADHLSAAAYLKEKLGTAIGAHITQVQKVFGALFNAEPGFARDGSQ----DVLLEDEEGFRIGNLQARALHTPGHTPACMSFMDAGEIAVFVGDTLFMPDYGRCDFPGADARTLYRSIR-RLLAFPDQTRLFMCHD-VTTVAEQRASNIHIHQ 239
23 -32.0004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  21  40......PAMPLKCGISALLVTSDAGHILVDAAQAGPQILANIRALGFRVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTDDAAHPGYLAAFRNTL-ARVAALDCDI-LVTPHPSASGLWNRIGAAPLMDT 271
24 -31.9004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  29  20...............YLLFDSGSGECALIDSVLDADQLIARVAALGARVRWLLETHVHADHLSAAPYLKTRVGIAIGRHVTRVQDVFGKLFNAGPAFAHDGSQ----DRLLDDGDTLALGALSIRAMHTPGHTPACMTYVDARDAAAFVGDTLFMPDYGRCDFPGGDARSLYRSIR-KVLSLPPATRLYMCHD-ASTVADELRENVHIRE 243
25 -30.5004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  16  31..........VSSNGLVVIDKG--NAFIVDTPWSTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQ-SISTYATTSTNHLLKE--------------NKKEPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAET 218
26 -28.7004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  17  31..........VPKHGLVVLVNA--EAYLIDTPFTTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKK--------------DGKVQATNSFSGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG--DANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVK 215
27 -28.5004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  15  32..........VSKHGLVVLVNT--DAYLIDTPFTTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQ-SIPTYASELTNELLKK--------------DGKVQAKNSFSGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG--DANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVK 216
28 -28.5004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  23  26......PMTLQGTNTYLV--TGPRRILIDTGEPAISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKK--------LPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCI----LGEGTTVFEDLYDYMNSL-KELLKIKADI-IYPGHGPVIHNAEAK........ 210
29 -28.1005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  17  49..........YPSNGLIVRDGD--ELLLIDTAWGTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEAE----------NEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTA 240
30 -28.0003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  17  29..........YSANSMYLVTKKG--VVLFDVPWEYQSLMDTIKKHNLPVVAVFATHSHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKD-------------GKATSTEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNK 218
31 -28.0004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  17  67..........YPSNGLIVRDGD--ELLLIDTAWGTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEAE----------NEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKA 258
32 -27.6002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  17  34..........VPSNGLVLNTSK--GLVLVDSSWDTKELIEMVEKKQKRVTDVIITHAHADHIGGIKTLKER-GIKAHSTALTAELAKKN-------------GYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK. 222
33 -27.5002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  18  67..........YPSNGLIV--RDGDELLLIDTAWGTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEVE----------NEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKA 258
34 -27.2002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  16  40..........VPSNGLVLNTSK--GLVLVDSSWDTKELIEMVEKKQKRVTDVIITHAHASRIGGIKTLKER-GIKAHSTALTAELAKKN-------------GYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK. 228
35 -27.2001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  14  20.....VPGRLNAHFSTVVYLEHKDRRIIIDPGSSMDELEEKFSELGISITDVLFTHVHLDHIFNSVLFE---NATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEK--VKVFHTPWHAREHLSFLENAGRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDR----VGRIDLLVFPHDAPLKPEVKK........ 215
36 -27.1003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  15  34..........VPSSGLVLNTSKG--LVLVDSSWDTKELIEMVEKKQKRVTDAIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKN-------------GYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK. 222
37 -27.0001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16  35..........VPSNGMIVINNH--QAALLDTPINTETLVNWVADSHAKVTTFIPNHWHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEK-------------GLPVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQATSIGISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQ 224
38 -27.0002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  16  31..........VDSNGLVVLDNN--QAYIIDTPWSTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLARE-------------GKPVPTHYFKD-DEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAES 218
39 -26.9001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  13  25..........YAANAVYLVTDKG--VVVIDCPWGFKSFTDEIYKHGKKVIMNIATHSHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKE-------------NKPRAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINE 214
40 -26.8002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  17  66..........YSSNGLIVRDAD--ELLLIDTAWGTVALLAEIEKQGLPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAEAA----------NEVPAHSLKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVK. 256
41 -26.8005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  16  48..........VDSNGLVVLDNN--QAYIIDTPWSTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLARE-------------GKPVPTHYFKD-DEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAES 235
42 -26.8001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16  35..........VPSNGMIVINNH--QAALLDTPINTEMLVNWVTDSHAKVTTFIPNHWHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEK-------------GLPVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQ 224
43 -26.0004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  11  46..........VASNGLIVRDGG--RVLVVDTAWTTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD. 240
44 -26.0004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  18  34............SNVLVAKMLD-GTVVIVSSPFETQTLMDWVAKTKPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRLEENKKDKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKKLLFGGCMIKPKELG---LGDANVKAWPDSA-RRLKKFDAKI-VIPGHGEWGGPEMVNKTIKVAE. 242
45 -25.6004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  11  49..........VASNGLIVRDGG--RVLVVDTAWTTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD. 243
46 -25.5003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  11  40..........VASNGLIVRDGG--RVLVVDTAWTTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD. 234
47 -25.4002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  23  13.....VPIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELCFQDVKTILLTHHHPDHYGLSGFF-EGLGARVFLHEEEPEAFAEASWRLFLDHGTPEVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLAGARVAYAGHFGPIADVRQRAEE..... 246
48 -25.4005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  11  46..........VASNGLIVRDGG--RVLVVDTAWTTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD. 240
49 -25.2004tyf_A mol:protein length:231 NDM-4  ali model follow..  11  34..........VASNGLIVRDGG--RVLVVDTAWTTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGLVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD. 228
50 -25.1003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  11  47..........VASNGLIVRDGG--RVLVVDTAWTTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD. 241
51 -24.8001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  13  21..........VQENSMVYFGAKG--VTVVGATWTARELHKLIKRSRKPVLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDWAEIVAFTEYPDLPLVLPNVVHDGDFTLQEGKVRA-FYAGPAHTPDGIFVYFPDEQVLYGGCILKE---KLGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPLH............. 209
52 -24.7004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  11  73..........VASNGLIVRDGG--RVLVVDTAWTTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD. 267
53 -24.4003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  11  24..........VQENSMVYIGTDG--ITIIGATWTAETLYKEIRKSPLPINEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSIVNF-KYPNLEKSLPDTVFP--GDFNLQNGSIRAMYLEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGEKVDSIIAGHDTPIH............. 216
54 -23.6004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  23  62........PRGSGGAEAALEEAARGPILVDTGWAREALLGALAGQGVAVTLVVGTHGHSDHIGNLGLFP---GAALLVSHDFCLPGGRYLPHG-----------------LGEGQPLRLGP-GLEVWATPGHGGQRDVSVTALGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVVAD--VVVPGHGPPFRVLREASQ...... 243
55 -23.6005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  23  38.....LPFSLDHINLWLLRDEIDGQATIVDCGISSEAIRTHWEQDGLPVLRVLVTHCHPDHFGLANWLCEGGDQGRWNVR-TDPAALDKLRSRRSYYSDLVPAVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALHSEADGVLISGDMVLPRSVFDLEPEANPLALYLESL-GRYETMAPDTLVLPSHGKPFRGVRTRIAQ..... 284
56 -20.4004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  17  45LKDNFRADHYIDMAINILLVKTKEKLILMDTGERTGFLLKSLQKAGFSITDIFLSHAHPDHIGGVVDKQNKLVFPIFISKIEHDFWINASIKDFNNSALKAHPERLNQKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTSGNEKLMYVADLIHSDVILHPDWGFSGDTDLDIATASRKKFLKTKARAFTSHLPWPGLGFTKVKA..... 282
57 -19.9002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  16  40.........DIPVSAYLI--QCTDATVLYDTGASECNLPERLRQLGLSISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDEFATAVRYFATGDHSSPYIVATPRNWDLVGRDERERELAPGVNLLNFGTGHASGMAVRLEKQPGFLLVSDACYATNYGPPARRAGDTIGYDRTVSHRQYAESRSLTVLFGHDREQFASLIKSTDGFYE. 276
58 -19.4003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  13  45.........NLPTHPILI--QTAQYNLIIDAG-EESHIIADLANYNLTIDYVLMTHMHFDHAAGLTDQAGHAIFEHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKILFEKHFEPVPG---IKMQHSGGHSFGHTIITSQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPQQYWFLFYHDENYFAVKYSDDG..... 264
59 -18.7003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  15  33..........FPVYSILI--EHAEGRFLIDTGEKHQTIPGALGLLGLEIDVVVNSHFHFDHCGGNKYFP---HAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRAVKLISTPGHSIGHLVEFPRRKPILFTIDAAYTQKSLETLCQAADPVAGVNSMRKKKLAEDHGAELMYSHDMDNFKTYRTGTQFY... 267
60 -18.6001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  19  91........APLETSVTGYLVNTGSKLVLVDTGATLGRLAANLKAAGYQVDEIYITHMHPDHVGGLMVGEQLANAVVRADQKEADFWLSQTNLDKAPDDLNPYVKAGKFKPFSGNTDLVPG---IKALASHGHTPGHTTYVSQGQKLALLGDLILVAAVQSVTTQLDSDSKSVAVERKKAFAAKGGYLIAASHLSFPGIGHIRAEG..... 315
61 -18.5004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  26  90.............NAYLI--NTGDNLVLIDTGATLGVVQTNLKASGYQVDTVLLTHLHPDHACGLVNADGSPAYPVEVPQAEAEFWLDKAPEGMQGMFKMARQAVAP-KPYKTEGELLPG---VSLVASSGHTPGHTSYLSGGQSLLVWGDILINHAV-QFAKPE-DSDQARQSRQRILAEAATDKLWVAGHLPFPGLGHVREEA..... 307
62 -18.5004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  22  83........KGVQTAVNAYLINTGDNLVLIDTGATLGVVQTNLKASGYQVDTVLLTHLHPDHACGLVNADGSPAYPVEVPQAEAEFWLDKAPEGMQGMFKMAQQAVAP-KPYKTEGELLPG---VSLVASPGHTPGHTSYLSGGQSLLVWGDILLNHAVQEVVFEFDVDSDQARQSRQRILAATDKLWVAGAHLPFPGLGHVRKEA..... 307
63 -18.3002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  18  37..............VWCYLLETEEGPILVDTGTEEDRIVNILKRVGYELLYIISSHLHFDHAGGNGAFTNT----IVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHFIKTEQSGSVLLTIDASYTKENFEDEVPF-DPELALSSIKRKEVVKKEKPIIFFGHDIEQ.............. 241
64 -18.1003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  18  39..............VWCYLLETEEGPILVDTGTEEDRIVNILKRVGYELLYIISSHLHFDHAGGNGAFTNT----IVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHFIETEQSGSVLLTIDASYTKENFEDEVPF-DPELALSSIKRKEVVKKEKPIIFFGHDIEQ.............. 243
65 -17.8004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  20  52........KGVQTSINAFLVNIGKSLILIDSGAHLGSVLSNLKASGYQVDTILLTHLHPDHVCGISKDGVANNATVYVSNDEASFWLDPKQAEKIKQAIAPYQAKQRFKTYKLGDDIQ-----FKVINTAGHTPGHFSYETKGESIVFIGDIVHSHTVQETAIEYDIDPKKAVETRLKQFAAKNGQTIAAPHLPFPGIGHTYSAD..... 278
66 -14.4004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  17  42...........TSNSYVIEGDKT---AIIDPPVELEALQQTVNLK--KLDYVILGHFSPNRIPTFKALLELAQITFVCSLPAAGDLRAAFPDDNLNI-----------LPMRGKETLDLGKHVLKFLPIP-RWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDAPHAIHVEAALEKISDLQVRL-YAVGHGPLVRTSLIALTQAY... 246
67 -14.4003x2x_A mol:protein length:227 UPF0173 metal-dependent hydrolase TM_1162  ali model follow..  16  2.....MKVTFLGHAVVLI---EGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTAGHGDHLGDAVEIAKKNDATVISNYEICHYL-KGVKTHAMHIGVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKK----IYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMH.................. 191
68 -12.3001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  17  35...........TYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPKLDYLVVNHTESDHAGAFPAIMELCDAHVLCTQRAFDSLKAHYSHIDFNY-----------TIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVPEEALLLPNDARFDDQVDAGLI--MPFSNLITKKLDEIQKINLAIKTIPSHGIIWRKDPGRIIEAYAR. 244
69 -12.2002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  13  40...........SYNSYFIDDECP---TVIDS---LSRIAACCPLD--KIKYVVMNHAEGDHASSLKDHYHKFNATFVCTKKCQEHLKILYGMEKATWLI-----------VDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCPEDKILFSNDGRWADECDVSHV--GLFSAQMRKALEVASTVEIKY-ILSAHGVS............... 233
70 -12.1001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  17  34...........TYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKIDYLVIQHLELDHAGALPALIEACPEKIFTSSLGQKAMESHFHYKDWPV-----------QVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFADEKVLISNDIRFSDQIPVHTL--NPYAPQTLKAIETLVGAGVAPEFIPDHGVI............... 229
71 -11.7001vjn_A mol:protein length:220 Zn-dependent hydrolase of metallo-beta-lactam  ali model follow..  17  5...KIMKITWFGHACFAL--EMEGKTIVTDPFDES----VGYPIPNVTADVVTESHQHFDHNAHHLVKGNFRVIDRPGAYTVNGVKIKGVET-----------------FHDPSHGRERGKNIVFVFEGEGIKVCHL------GDLGHVLTPAQVEEIGEIDVPVGGTYTIGPKEAKEVADLLNAKVIIPMHYKTKYLKFNLPVDDFLK. 185
72 -11.7003jxp_A mol:protein length:321 Coenzyme PQQ synthesis protein B  ali model follow..  11  39...........RTQSSIALSDDGVHWILCNASPDIRAQLQAFAPRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMM---GADCLLVDG................... 223
73 -11.3002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  19  34...........TYNAYLVCGDE--GVALIDN---MARVEDALQQVGMRVDYIIQNHVEKDHSGVLVELHRRFEAPIYCTEVAVKGLLKHYPSLREA------------MTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLDEDGILFSNDARLDREIPEYIL--TPLSKLVLKKFDEVKELGRIQMIAPSHGQI............... 236
74 -11.2004b87_A mol:protein length:367 DNA CROSS-LINK REPAIR 1A PROTEIN  ali model follow..  22  51...............................................GCTAYFLTHFHSDHYAG---LSKHFTFPVYCSEITGNLLKNKLHVQEQYI-------------LPLDTECIVNGVKVVLLDA-NHCPGAVMI-------------LFYLPNGTVILHTGDFRADPSMERSLLADQKVHMLYL-----DTTYCSPEYTFP.... 176
75 -11.2001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  16  19MKMTVVPEAGEATSGYLFEHDGFR--LLVDCGGVLAQLQKYITPSDI--DAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPVTCFAMRITAGNDVVYSADSSYIPEF--IPFTKDADLFICEC.................................... 194

FFAS is supported by the NIH grant R01-GM087218-01
1 1 8 0 3 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.