current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2ynt_B mol:protein length:233 GIM-1 PROTEIN, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst SQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEASADLast
1 -106.0002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model  100  1SQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEASAD 233
2 -102.0005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  98  18AQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEASAD 250
3 -100.0004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  51  1NDEVPELRIEKVKENIFLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQPNANASAD 233
4 -95.8004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  43  2GARLPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG---DANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKPSQPS... 228
5 -95.7004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  43  1AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNL---GDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSNW. 229
6 -93.9001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  33  5VKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKGLPVPEHGFTDSTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQYIESTSKP....... 232
7 -93.4001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  33  5VKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKGLPVPEHGFTDSTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSKP....... 232
8 -92.0001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  32  1.....DVKIEKLKDNLYVYTTYNTFNGTK-YAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNNSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKAS....... 222
9 -91.4002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  36  11KNETGTISISQLNKNVWVHTELGSFNGEA-VPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK................ 228
10 -91.3003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  27  1.QVKDFVIEPPIKNNLHIYKTFGVFGGKE-YSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKATSTEIIKTGPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNK............... 218
11 -91.2002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  35  5KNETGTISISQLNKNVWVHTELGSFNGEA-VPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK................ 222
12 -90.2003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  35  5KNETGTISISQLNKNVWVHTELGSFNGEA-VPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK................ 222
13 -90.0003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  28  17DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPAAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRKLVPRGSAAAALE 257
14 -89.2004tyf_A mol:protein length:231 NDM-4  ali model follow..  29  4DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAANGWVEP-ATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR............. 231
15 -88.8003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  29  10DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPAAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR............. 237
16 -87.4005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  29  16DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEP-ATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRLE........... 245
17 -86.5004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  29  16DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEP-ATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR............. 243
18 -85.7004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  29  19DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPAAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR............. 246
19 -85.0004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  29  43DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEP-ATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRL............ 271
20 -82.7005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  33  20EIPVGEVRLYQIADGVWSHIATQSFDG-AVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNEIPTHSLEGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVA........ 247
21 -81.9002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  34  37DIPVGEVRLYKIGDGVWSHIATQKLGDTV-YSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPAHSLKSSGDVVRFGPVEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVA........ 264
22 -80.6004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  33  38EIPVGEVRLYQIADGVWSHIATQSFDG-AVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVA........ 265
23 -79.8002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  33  38EIPVGEVRLYQIADGVWSHIATQSFDG-AVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGDAVRFGP--VELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVV........ 265
24 -77.9003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  21  2..SEKNLTLTHFKGPLYIVE------DKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWKSLPDTVFPG-DFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN----LGNMSFANRTEYPKTLEKLKGLILKVDSIIAGHDTIHDVGLIDHYLTLLEKAPK............ 233
25 -76.7004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  29  8VDLPYNLTATKIDSDVFVVT------DRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKADNVFDLKQGVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYL---GDANVKAWPDSARRLKKF--DAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMR......... 249
26 -75.3001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  21  1....AGMSLTQVSGPVYVVE------DNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWLVLPNVVHDG-DFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK----LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSLHGPELIDHYEALIKAAPQSS.......... 228
27 -34.1002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  14  5.......SSGLVPRGSHMLR-DDDLCLLGDVQVPVFLLRGEASWALVEGGISRDAELVWLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAV--RAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALFDEAEGVWRPLVFDDMEAYLESLERLQR-LPTLLQLIPGHGGLLRADGAESAYTECLRLCRRLLWRQSMGES. 271
28 -34.1002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  20  9............................GPLQENAYLVETGEGPVLIDPG---DEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGAGLAIPKPPLPVRPLEEGMRLFGFQVL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPG-ADPKALFASLKRLLSL-PPETRVHPGHGPGTTLGLEARTNPFLTGLEWEA.......... 207
29 -33.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  16  20................................ATVYVMCGEKLTVMIDAGVSNSIADFSFL------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDGLKKLNE-GNEEFDLGGYRMRLIYT-PGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIPTTVIDYKMYMESLKRQIEL--KPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAG 240
30 -33.0001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  17  18...LQPMAPLQIADHTWQI---------GTEDLTALLVQTPDGAVLLDGG-MPQMASHLLDNMKARGRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSDDLHIVMDGEVITVGGIVFTAHFM-AGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLPHLIEDYRRSFATVRAL--PCDVLLTPHPGASNWDY-LTCKAYADAAEQKFDGQLAKETAG 267
31 -32.9002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  14  1........MKALLPGLYLLP----PIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEASWRLFLDHGTPEGALQ-DGEALEVAGKRLRVLW-TPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAENPLKDFLRSLDRLADL--GARVAYAGHFGP--EELKAHHQARLEALLALLDGPKTA.... 268
32 -32.0003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  16  35...TAPFEPFQLIDNIYYV---------GTDGIAVYVIKTSQGLILMDTAM-PQSTGMIKDNIAKLGADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGPAVKVDRAVKEGDRVTLGDTTLTAHAT-PGHSPGCTSWEMTVKDVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAM--KIDVLLGPHPEVYGMQA-GELVTYATSLSEDFDKQLAKQTAA 290
33 -31.9003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  15  6...SSPQQPFTIYGNTHYV---------GTGGISAVLLSSPQGHILVDGT-TEKGAQVVAANIRAMGSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPKSDPQFDGELVKLGPLAVKAHAT-PGHTEGGITWTWQSCEVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKL--SCDIAIAAHPEVND............................ 220
34 -31.8004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  14  38...NDPAMPQKVYGNTWYV---------GTCGISALLVTSDAGHILVDAAT-PQAGPQILANIRALGEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFDDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASGLWN-TACRRYAQGARQRLEKRLAEEAA. 294
35 -31.6004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  13  38...NDPAMPLKVYGNTWYV---------GTCGISALLVTSDAGHILVDAAT-PQAGPQILANIRALGEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFDDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASGRRYAQGARQRLEKRLAEEAATSPSSGAR 302
36 -31.5001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  12  5...PNPFPPFRIAGNLYYV---------GTDDLASYLIVTPRGNILINSD-LEANVPMIKASIKKLGSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGSTVDKVLHDGERVELGGTVLTAHLT-PGHTRGCTTWTMKLKDAVIIGSIGVNPGYKLVDNITPKIAEDYKHSIKVLESM--RCDIFLGSHAGMFDLKN-TGCKNYIEQKANDFYTELKKQET. 262
37 -31.0005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  12  11...NADQAPFRLFGNTYYV---------GMKGLSSVLVTSPQGHVLIDGGL-PESAPKIIANIGALGEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVGPDDPQYDGGQFNVGPVYLTAHAT-PGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGPNALADLRHSFETLEKL--PCDVLISAHPEASQLWQ-QACRAYVAAARTLLDSRLDQEKQQ 271
38 -31.0002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  14  6...........HRPDLYSWSTFNPARN---IDFNGFAWIRPEGNILIDPVALSNHDWKHLESLG----GVVWIVLT--NSDHVRSAKEIADQYTKIAGPVAEKENFPIY----CDRWLSDGDELVPG--LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVLAALEKVEAVLVGDGWSVFRDGRDRLKELVATL.............. 200
39 -30.6005aeb_A mol:protein length:272 LRA-12  ali model follow..  12  18...SKPYRPFRIAGNLYYI---------GTYDLACYLITTKQGNIIVNTG-LAASALQIKNNIKALGTDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSIADRLLHDKDTIQLGDTKLVMLHH-PGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKPGIAKDYAYTLQAMKNL--SFDIWVASHASQFS............................ 232
40 -29.9004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  17  8.......RVERLSNRVVRVLG-CNPGPMTLQGTNTYLVGTGPRRILIDTPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKS-IKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCILGEGTTVF-----EDLYDYMNSLKELLKI--KADIIYPGHGPVNAEAKIQQYISHRNIREQQILTLFRENFEK 235
41 -27.5004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  17  40....ADGSVTLVLPQTRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPWAREALLLAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPGAALLV-----SHDFCLPGGRYLPHGLGEGQPLRLGPG-LEVWAT-PGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV---ADVVVPGHGP............................... 233
42 -27.4001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  12  9..............................LTDNYMYLVIDDEAAIVD----PVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGGDDRIGALTHK-------ITHLSTLQVGSLNVKCLAT-PCHTSGHICYFVSKPGAVFTGDTLFVAG---CGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHNNLKFARHVEPGNAAIREKLAWAKEKYSIGEP. 209
43 -27.4001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  13  29................................STVVYLEHKDRRIIIDPGNLSSMDELEFSELGISPDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRLSYY-----DIIKGYGSVQVKNFLDRVGRIDLLVFPHD................................ 206
44 -27.0002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  16  11..............................FSQNCSLIWCEQLAALVDPGGD---AEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQGQPLTPDRWLNDDRVSVGNVTLQVLHC-PGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDF-PRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD............... 210
45 -26.9001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  16  9..............................LKDNYAYILDTGTVGVVDPS----EAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAMDKDRIPGIDMALK----DGDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSLS---CGKLFEGTPKQMLASLQKITSL-PDDTSIYCGHSNSKFALSLEPNNEVLQSYAAHVAELRSKKLP. 205
46 -25.0005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  16  23.......DTFEVAPGVRWLR----PLPFSLDHINLWLL-GQAGWTIVDCGISSEAIRTHWEQIFDDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTAAAADHFARHGLTDPAAL-EGDAVKIGARTWRVVT-GYGHSPEHCALHSEADGVLISGDMVLPRISTNVSVFDLEPLALYLESLGRYETMAPD-TLVLPSHGKP--AQLRAHHDARLEEVRVACAEKPMSA... 307
47 -24.3004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  16  28.......................................ESREAVLIDPVLE--TAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSL-----LPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRAS-PGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDF-QQGCAKTLYHSVHEKIFTLPGDCLIYPAHD................................ 180
48 -23.6002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  12  41..............................IPVSAYLIQCTDATVLYDTGCHPECMGERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATEAWLATPRNWDLVGRDERERELAPG-VNLLNFGTGHASGMLGLAVRLEKFLLVSDACYNYGPPARRAGVLHDTIGYDRTVSHIRQYAESRSLVLFGHDREQFASLIKSTDGFYE................ 276
49 -23.4002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  12  31..............................LKDNFSYLITTHTLAAVDVNADYKPILTYIEENADVTYTFSTILSTHKHWDHSGGNAKLKAE-LEAMNSTVPVVVVGGANDSIPAVT-EGDRVQVGDLSVEVIDA-PCHTRGHVLYKVQHPQALFTGDTMFIAG---IGAFFEGDEKDMCRAMEKVYHIHKGNDYALDGHSEKTFPDRASDDLAFIQAQRAKYAAAVKTGDP. 261
50 -23.3003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  12  2RISMTVKKLYFIPAGRCSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVLLYTPGHSPGHQSLFIETEQVLLTIDASYKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKIIFFGHDI............................... 241
51 -23.2004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  19  22.......................................ATRQAVLIDPVLE--QVDRDLQMVAELDLTLTHVFDTHVHADHITASGALRERTQATVVGS------VNGASCANVQVRHGDEVRVGQLVFQVLAT-PGHTDDSISYLLGDR--VFTGDALLVRGNGRTDF-QNGNASQLYDSLTRVLFTLPDETLVYPGHD................................ 171
52 -23.2002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  12  35..............................LPVWCYLLETEEGPILVDTGMPESAVNNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVLLYTPGHSPGHQSLFIKTEQVLLTIDASYKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKIIFFGHDI............................... 239
53 -22.6002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  17  27........................................DKPALLIDP----KTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTK-----LPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRAT-PGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTDF-QEGSSDQLYESVHSQIFTLPKDTLIYPAHD................................ 184
54 -22.1003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  12  2....SDTKVYLLDGGSLHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMK-LGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEEAAEARGATAQLLEGTTRANSTFEGIDGDVDLLISTPGHSIGHYSLLVEFPRILFTIDAAYTQKSTLCQAAFHIDPVAGVNSMRKVKKLAEDHGALMYSHDM............................... 254
55 -21.9004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  13  3DSKPRDVQVLPIATNTKVLRAEIEYALERGTTSNSYVIEGDK-TAIIDPPVESFMKIYLEALQQTVNKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRADDNLNILPMRGKETLDLGGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFWESFKEDQRYYFNCLMAPHAIHVEAALEKILQVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLE........ 256
56 -20.0003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  10  5.....DISIHYLNGGLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGKLSE-LANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHNAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNK-IKMQHSG-GHSFGHTIITIESDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAY.............. 270
57 -19.8002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  15  2SSKPKYVQDQEMIPGVY-VRIFHGYHTDEGSSYNSYFIDDEC-PTVIDSVKYPFAEEWLSRIAACCPDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKI------LIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSK............ 251
58 -19.7004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  20  13.....DVQITALLDGTILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASCFGSHLLKASGYQPEQVDTILLTHLHPDHVCGIANFPNATVYVSNDEKIKQAIAPYQAKQRFKTYKLGDDIQGFKVINT----AGHTPGHFSYELKTESIVFIGDIVHSHTVPETAIEYDIDPKKAVETRLKQFANFAKNGQTIPGIGHTYSAD.......................... 278
59 -19.7002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  19  2.....KAAAKRISDGVY-LRNYHGYTLQG-TTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREAEFTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKFLGLLERIQMIAPSHGQIMVDERVTVIYDTMHGSTRKMAHAIAEGAMS 283
60 -19.2001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  16  1......MQATKIIDGFH-SRDFHGYTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESH-----QVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLLKAIETLVGAGVAPEFICPDHGVI.............................. 229
61 -19.0003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  22  30................................SQASYLIGCQKAMIIDPI---RDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDDTLGYKNMPNHTHFVQHDDIYVGNIKLKVLHT-PGHTPESISFLLTDEGGLFSGDFIFVGKAVKVEGSSEIGAKQMFKSIESIKDL-PDYIQIWPGHGA............................... 215
62 -18.6001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  11  2.......QPVAITDGIYIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKAH-----TIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKA...... 254
63 -18.5003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  20  15................................AHASYLVGCQEACVIDP---ARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAICVSDEGPPEWKSEYVK--RLLKDGDELHFGNVRIVVMHT-PGHTPEHVSYLLYDGKALFSGDFVFVGRVAGESGSSEALARQMFRSLRKFEAL-PDHVQVLPAHGA............................... 201
64 -18.4004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  12  3.........IVVKNNIHVRDFHGTEYKTLRGSSYNSYLIREEKNVLIDTVDHKFSREFVQNLRNEIDADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPEWNFNVVK-TGDTLDIGGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQEDRI...... 250
65 -18.0004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  18  13.....ELELFILTDGYIILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIFADERTLQKAGFSAHDITDIFLSHAHPDHIGGVLVFPNASIFISKIENNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNPGHTPGLTVTTISSEKLMYVADLIHSDVIPDWGFSGDTDLDIATASRKKFLKQLADTKARAPGLGFTKVKA.......................... 282
66 -17.5004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  18  44.....DFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLLKASGYQPEQVDTVLLTHLHPDHACGLVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEPGHTPGHTSYLFKSQSLLVWGDILLNHAVPEVVFEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV.............................. 303
67 -17.5004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  18  44.....DFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLLKASGYQPEQVDTVLLTHLHPDHACGLVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTESGHTPGHTSYLFKSQSLLVWGDILINHAVPEVVWEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV.............................. 303
68 -17.3001vme_A mol:protein length:410 Flavoprotein  ali model follow..  18  12......TERIFDDPEIYIRYFEAVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEGFYGIKDVTVVKDEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGGGYLLPEILDDSNESIGHYKNYILEGAEKLLKIKALLPGHGLI.............................. 237
69 -17.1004nur_A mol:protein length:633 PSdsA  ali model follow..  16  81SQLINISGLFEVTDGIYQVRNYD---------SNMTIVEGKDGITIFDPLISQETAKAALDLYYKHKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAETLIPPTDIIKEETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTLHNTYSLRGA-DPLAWSKYLNEALKLWGDDVQVMPVWGNKEVREQLSLQRDMYRYINDETLRLANKGYT. 363
70 -17.0002cfu_A mol:protein length:658 SDSA1  ali model follow..  13  99ALLNLKYGLFEVAEGIYQVRGFD---------ANITFIRGDSGWIVVDTLTTPATARAAYELVSREERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKESLLAPTRLIEGEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTLHNLYTLRGA-DALGWSKYINQALHRFGRQAEVMPRWGNAEIVEVLEKQRDLYGYLHDQTLHLANQGVT. 381
71 -16.9001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  17  54.....DFEITALSDGTQSALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAGLFGPTLLKAAGYQPEQVDEIYITHMHPDHVGGLLAFPNAVVRADQKEGAMASLNPYVKAGKFKPFSGNTDLVPGIKAL---ASHGHTPGHTTYVVESQKLALLGDLILVAAVPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIPGIGHI.............................. 311
72 -16.9002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  16  24....................................LTNDEGRCVIVD----PGEAAPVLKAIAEHKWMPEAIFLT----DHVGGVKELLQHQMTVYGPAETQDKGATHLVG------DGDTIRVLGEKFTLFAT-PGHTLGHVCYFSRP--YLFCGDTLFSGG---CGRLFEGTPSQMYQSLMKINSL-PDDTLICCAHANIKFALSILPHDSFINEYYRKVKELRVKKQM. 204
73 -16.9004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  15  81SQINGISGLFKVTDKMYQVRGQD---------SNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQHQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISESIIAPTKTIVREKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENATHTLHNFYTLRGA-DTSKWTEYLNETLDMWGNDAEVLPVWGNKHINDYIGKYRDTIKYIHDQTLHLANQGYT. 363
74 -16.6002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  14  109AQLNNIAGLFEVMPKLYQVRGLD---------ANMTIIEGDSGLVLIDTLTTAETARAALDLYFQHKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSETLVAPNVLIEKERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPAMHNLLTPRGA-DAKAWAGYIDASLEKYGDRTDVLPVWGGDKVRTYLADQRDMYAFLNNRALNLMNKGLT. 392
75 -15.4004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  14  28.......................................ETRQCALIDSRTCSASADRLVERVNELNASVRWVLETHVHADHLSAAAYLKEKGAHITQVQKVFGALARDGSQFDVLLEDEEGFRIGNLQARALHT-PGHTPACMSFMIEDEIAVFVGDTLFMPDYGTA--FPGADARTLYRSIRRLLAF-PDQTRLFMCHDYLPGGRDMQYVTTVAEQRASNIH--IHQGIDE 243

FFAS is supported by the NIH grant R01-GM087218-01
1 0 8 9 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.