current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2zo4_A mol:protein length:317 Metallo-beta-lactamase family protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MKALLPGLYLLPVPIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHRFWREPEAFAEASWRLFLDHGTPEGALQGIRETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALLDGPKTAWELSLHLFPQELDPAGRRFAFAETLAHLEYLREEGAVGRGGPPYRYFRRLast
1 -119.0002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model  100  1MKALLPGLYLLPVPIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHRFWREPEAFAEASWRLFLDHGTPEGALQGIRETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALLDGPKTAWELSLHLFPQELDPAGRRFAFAETLAHLEYLREEGAVGRGGPPYRYFRR 317
2 -94.1005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  30  24TFEVAPGVRWLRMPLPFSLDHINLWLLRDQAGWTIVDCGISSEAIRTHWEQIFDR-HLDGLPVLRVLVTHCHPDHFGLANWLCEWNVRLWMTLGEYMFGCLMAAGNNAGGAAAADHFARHGLTDPAADKLRSRRSYYSDLVPAPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALHSEADGVLISGDMVLPRISTNVSVFDLEPENPLALYLESLGRYETMAPDLVLPSHGKPFRGVRTRIAQLRAHHDARLEEVRVACEKPMSAAGIVPIMFRRELDIHQMTFALGEALAHLNLLWLAGELVREHGDDGVIR. 356
3 -56.0002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  21  6SGLVPRGSHMLRLSAPGQLDQVPVFLLRGEASWALVEGGISRDA--ELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKS----------------SAVRVVERLNRQLLRAEQRLPEACADALPVRAVADGEWLELGPRRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALGEFDEAEGVWRPLVF-DDMEAYLESLERLQRLPTLQLIPGHGGLLRG-RLAADGAESAYTECLRLCRRLLWSMGESLDELSEELHRAWGGQSVDFLPGE--LHLGSMRRMLEILSRQA....... 311
4 -44.4004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  24  9VERLSNRVVRV--PGPMTLQGTNTYLVGTGPRRILIDTG--EPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICK---------------------------------SINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVF--------EDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRKSFTVMELVKIIY-KNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWK. 286
5 -42.8004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  18  45..KVYGNTWYV------GTCGISALLVTSDAGHILVDAAT--PQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKTGAPVYARAPAIDTLK------------------------RGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGTACRRYAQGARQRLEKRLAEEAAA................................................. 295
6 -41.9004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  18  45..KVYGNTWYV------GTCGISALLVTSDAGHILVDAAT--PQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKTGAPVYARAPAIDTLK------------------------RGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRICRRYAQGARQRLEKRLAEEAATSPS................................................. 298
7 -41.3003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  17  3....CRGLHSIPAGPVEFPEIATVYVMCGEKLTVMIDAGVSNSIAD-----------SFLDKLDYIVLTHLHIDHIGLLPELQVYKAKVLVKSGF----KKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKL--------DQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDD--FLFTGDSAGAYFNGVVIPTTPPVID-YKMYMESLKRQIELKPKVVGFAHGGLVSPMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNL.......................................... 251
8 -40.8001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  16  25..QIADHTWQI------GTEDLTALLVQTPDGAVLLDGGM--PQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRTGAKVAANAESAVLLARGGSDDLHFGDGI--------------------------TYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADAPGYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAACKAYADAAEQKFDGQLAKETAGAR.................................................. 269
9 -40.5003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  18  13..TIYGNTHYV------GTGGISAVLLSSPQGHILVDGT--TEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNF------------------------PGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSD-VASLRGSFEAVEKLSCDIAIAAHP-EVNDMWTRQQRAAKEGNSAYGACRAIAAAGRKRLE............................................... 254
10 -40.0001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  16  12..RIAGNLYYV------GTDDLASYLIVTPRGNILINSDL--EANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQTKAKYMVMDEDVSVIL------------------------SGGKSDFHYANDSSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIGVNPGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVTGCKNYIEQKANDFYTELKKQETG................................................. 263
11 -39.9003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  17  42..QLIDNIYYV------GTDGIAVYVIKTSQGLILMDTAM--PQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKTGAQLVAGERDKPLLEGGYYPGDEKNEDL--------------------------AFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLF-TVALNRLVGQPTYAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGELVTYATSLSEDFDKQLAKQTAALEK..................................................... 293
12 -39.7005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  19  18..RLFGNTYYV------GMKGLSSVLVTSPQGHVLIDGGL--PESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRSNALVAASPSAALDLASGEVGPDDPQYHALPKY------------------------PPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDMVYADSINAVSRPGFKFSASSEYPNALADLRHSFETLEKLPCDVLISAHP-EASQLWQRLEASATGGSDAFQACRAYVAAARTLLD............................................... 262
13 -37.5005aeb_A mol:protein length:272 LRA-12  ali model follow..  17  25..RIAGNLYYI------GTYDLACYLITTKQGNIIVNTGL--AASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKTGAKLMADEGDATVMADGGSSDYAFGGHGSMF-------------------------EPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVS-AKDYAYTLQAMKNLSFDIWVASHAKSFKGYDESLDKLQKEYEKHLNE............................................................ 271
14 -35.8005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  19  28LYQIADGVWSHIATQSFDGAVYNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIG---LPVTRAVSTHFHDDRVGGVDVLRKAGVATYAS-----------------------------------PSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVA---DADLAEWPTSVERIQKHEAEVVIPGHGLP--------LDLLQHTANVVTAHKNRSVAE.................................................... 248
15 -35.7004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  13  16ATKIDSDVF---VVTDRDFYSSNVLVAKMLDGTVVISSPFENLGTQTLMDWVAKTMK---PKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDL---TKQLRLEENKKDRIKAAEFYKNEDLKRRILS----------SHPVPADNVFDLKQGKVFSFSNELVEVSFGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLG------DANVKAWPDSARRLKKFDAKIVIPGHGEW--------PEMVNKTIKVAEKAVGEMR...................................................... 249
16 -34.8001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  17  13ITQLSDKVYTYV-IEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLH---AKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKE---------------------------------------KGLPVPEHGFTDSLTVSLDGMPLQCYYGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNIS---DADVTAWPKTLDKVKAKSARYVVPGHGNY--------TELIEHTKQIVNQYIESTSKP.................................................... 232
17 -34.6004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  19  46LYQIADGVWSHIATQSFDGAVYNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIG---LPVTRAVSTHFHDDRVGGVDVLRAAGVATYAS-----------------------------------PSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVA---DADLAEWPTSVERIQKHEAEVVIPGHGLP--------LDLLQHTANVVKAHKNRSVAE.................................................... 266
18 -34.5001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  17  13ITQLSDKVYTYV-IEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLH---AKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKE---------------------------------------KGLPVPEHGFTDSLTVSLDGMPLQCYYGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNIS---DADVTAWPKTLDKVKAKSARYVVPGHGDY--------TELIEHTKQIVNQYIESTSKP.................................................... 232
19 -34.0004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  15  9IEKVKENIFLHT-VNGFGLVSSNGLVVIDKGNAFIVDTPWSDRDT----ETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQSISTYAT------------------TSTNHLLKENKKEPAKY----------------------TLKGNESTLVDGLIEVFYGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLG---YTGEAHIDQWSRSAQNALSREAQIVIPGHGKI--------IALLKHTKSLAETASNKSIQPNAN................................................. 229
20 -33.9004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  15  9IEKLDEGVYVHT-VNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDT----EKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYAS------------------ELTNELLKKDGKVQATNS-----------------------SGVNYWLVKNKIEVFYGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG------DANIEAWPKSAKLLKSKKAKLVVPSHSEVGD------ASLLKLTLEQAVKGLNESKKPSKPSNWSHPQFEK....................................... 236
21 -33.9002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  18  46LYQIADGVWSHIATQSFDGAVYNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIG---LPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGL-----------------------------------SSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVA---DADLAEWPTSIERIQQHEAQFVIPGHGLP--------LDLLKHTTNVVKAHTNRSVVE.................................................... 266
22 -33.6001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  17  4IEKLKDNLYVYTTYNTFNGTKYNAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHG---KKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAK---------------------------------------ENKPRAQYTFDNNKSFKVGKSEFQVYYGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIG---EAYVNDWTQSVHNIQQKGAQYVVAGHDDW--------QRSIQHTLDLINEYQQKQKAS.................................................... 222
23 -33.5001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  23  9LKILVTG-GNVFVPGRLNAHFSTVVYLEHKDRRIIIDPG--NLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFE--NATFYVHEVYK---------------------------TKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDE-KVKVFHTPWHAREHLSFLLDTENVLITGD-----TPNRLSYYDIIKGYGSVQVKNFLDRVGRID--LLVFPHDAPLKPEVKK.......................................................................... 215
24 -33.5003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  14  8EPPIKNNLHIYK-VFGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHN---LPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKK----------------------------------------GKATSTEIIKTGKPYRIGGEEFVVDFGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIK---EANVEQWPKTINKLKAKKATLIIPGHDEW--------GGHVEHTLELLNK............................................................ 218
25 -33.3003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  14  25FRQLAPNVWQHTSYLDMP----NGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEIN---LPVALAVVTHAHQDKMGGMDALHAAGIATYAN-------------------------------ALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---DADTEHYAASARAFGAAKASMIVMSHSAP--------RAAITHTARMADKLRKLVPRGSAA................................................. 253
26 -33.2004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  15  10IEKLEEGVYVHT-VNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKL----VNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYAS------------------ELTNELLKKDGKVQAKNS-----------------------SGVSYWLVKNKIEVFYGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG------DANLEAWPKSAKILMSKKAKLVVSSHSEI--------ASLLKRTWEQAVKGLNESKKPSQPSN............................................... 229
27 -33.2003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  14  18FRQLAPNVWQHTSYLDMP----NGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEIN---LPVALAVVTHAHQDKMGGMDALHAAGIATYAN-------------------------------ALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---DADTEHYAASARAFGAAKASMIVMSHSAP--------RAAITHTARMADKLR.......................................................... 237
28 -33.2004tyf_A mol:protein length:231 NDM-4  ali model follow..  14  12FRQLAPNVWQHTSYLDMP----NGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEIN---LPVALAVVTHAHQDKMGGMDALHAAGIATYAN-------------------------------ALSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---DADTEHYAASARAFGAAKASMIVMSHSAP--------RAAITHTARMADKLR.......................................................... 231
29 -33.1002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  18  45LYKIGDGVWSHI-KLGDTVYSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKQIG---LPVTRSISTHFHDDRVGGVDVLRAAGVATYTS-----------------------------------PLTRQLAEAAGNEVPAHSLKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVA---DANLAEWPATIKRIQQREAEVVIPGHGLP--------LELLQHTTNVVKTHKVRPVAE.................................................... 265
30 -32.9002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  14  9VIKIEDGVYLHT-IEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLL----LSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTS------------------ELTKKLLAREGKPVPTHY-----------------------KDDEFTLGNGLIELYYGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVG---DASISSWADSIKNIVSKPIQMVVPGHGKV--------SDILDHTIDLAESASNKLMQPTAE................................................. 229
31 -32.7002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  14  13ISQLNKNVWVHTELGSFNGEAVNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQ---KRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKK---------------------------------------NGYEEPLGDLQTVTNLKFGNMKVETFYGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLG---NVADAYVNEWSTSIENVLKRNINAVVPGHGEVGD------KGLLLHTLDLLK............................................................. 222
32 -32.6003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  15  8LTHFKGPLYIVE---DKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEI---RKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVAT------------------QMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFP-----GDFNLQNGSIRAMYGEAHTKDGIFVYFPAERVLYGNCILKENLGN--------SFANRTEYPKTLEKLKGLKVDSIIAGHDTPIHD-----VGLIDHYLTLLEKAPK......................................................... 233
33 -32.5005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  14  24FRQLAPNVWQHTSYLDMP----NGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEIN---LPVALAVVTHAHQDKMGGMDALHAAGIATYAN-------------------------------ALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---DADTEHYAASARAFGAAKASMIVMSHSAP--------RAAITHTARMADKLRL......................................................... 244
34 -32.4002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  13  19ISQLNKNVWVHTELGSFNGEAVNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQ---KRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKK----------------------------------------GYEEPLGDLQTVTNLKFGNMKVETFYGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVA---DAYVNEWSTSIENVLKRNINAVVPGHGEVGD------KGLLLHTLDLLK............................................................. 228
35 -32.3004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  14  24FRQLAPNVWQHTSYLDMP----NGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEIN---LPVALAVVTHAHQDKMGGMDALHAAGIATYAN-------------------------------ALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---AADTEHYAASARAFGAAKASMIVMSHSAP--------RAAITHTARMADKLR.......................................................... 243
36 -32.0004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  14  27FRQLAPNVWQHTSYLDMP----NGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEIN---LPVALAVVTHAHQDKMGGMDALHAAGIATYAN-------------------------------ALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---DADTEHYAASARAFGAAKASMIVMSHSAP--------RAAITHTARMADKLR.......................................................... 246
37 -31.7002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  25  6..............VTLGPLQENAYLVETGEGPVLIDPGDEPEKLLALFQT-------TGLIPLAILLTHAHFDHVGAVAPLEALDLPVYLHPLDLPLYEGADLAARAWG---------------------------LAIPKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDL----PGADPKALFASLKRLLSLPPETVHPGHGPGTTLGLEARTN....................................................................... 197
38 -31.7004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  14  51FRQLAPNVWQHTSYLDMP----NGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEIN---LPVALAVVTHAHQDKMGGMDALHAAGIATYAN-------------------------------ALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG---DADTEHYAASARAFGAAKASMIVMSHSAP--------RAAITHTARMADKLRLV........................................................ 272
39 -31.5003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  12  13ISQLNKNVWVHTELGSFNGEAVSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQ---KRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKK----------------------------------------GYEEPLGDLQTVTNLKFGNMKVETFYGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLG---NVADAYVNEWSTSIENVSKRNINAVVPSHGEVGD------KGLLLHTLDLLK............................................................. 222
40 -31.5005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  14  26VIKIEDGVYLHT-IEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLL----LSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTS------------------ELTKKLLAREGKPVPTHY-----------------------KDDEFTLGNGLIELYYGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVG---DASISSWADSIKNIVSYPIQMVVPGHGKV--------SDILDHTIDLAESASNKLMQPTAE................................................. 246
41 -30.9002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  23  2MKSLRPDLYSWSTFNPARNIDFNGFAWIRPEGNILIDPVALSNHDWKHLESL--------GGVVWIVLTN--SDHVRSAKEIDQTYTKIAGPVAEKENF-------------------------------------------PIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVRRLAALKVEAVLVGDGWSVFDGRDRLKELVAT................................................................... 199
42 -30.3001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  18  5LTQVSGPVYVVE---DNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKR---VSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKS---------------------DWAEIVAFTRKGLPEYPDLPLVLPNVVHDGDFTLQEGKVRA-FYAGPAHTPDGIFVYFPDEQVLYGGCILKEKLGN--------SFADVKAYPQTLERLKALPIKTVIGGHDSPLHG-----PELIDHYEALIKAAPQSS....................................................... 228
43 -29.9003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  19  30...........EVRFP-----VYSILIEHAEGRFLIDTGYDYDEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFP--HAKKICHRSEVPQAC-------NPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARG---VKLISTPGHSIGHYSLLVEFPRILFTIDAAYTQKSLETLCQAAFHIDPVAGVMRKVKKLAEDHGAELMYSHD................................................................................... 253
44 -29.6002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  20  38...........LIDIP-----VSAYLIQCTDATVLYDTGCHPEASECNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFG--KSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRNWDLVGRD-----------ERERELAPGVNL--------LNFGTGHASGMLGLAVRLEKFLLVSDACYTATNYGPPARRAGVLHDTIGYDRTVSHIRQYAESTVLFGHD................................................................................... 260
45 -28.1003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  20  39.....................VWCYLLETEEGPILVDTGMPESAVNNRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNY--------------------------------KIIEGDYEVVPG--VQLLYTPGHSPGHQSLFIETEQVLLTIDYTKENFEDEVPFAGFDPELALSS-IKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI..................................................................... 254
46 -28.0002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  20  37.....................VWCYLLETEEGPILVDTGMPESAVEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNY--------------------------------KIIEGDYEVVPG--VQLLYTPGHSPGHQSLFIKTEQVLLTIDYTKENFEDEVPFAGFDPELALSS-IKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI..................................................................... 252
47 -26.9004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  26  68.....................AEAALEEAARGPILVDTGGPWA--REALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFP--GAALLVSHDFCLPGGRYLPHG-------------------------------------------LGEGQPLRLGP-GLEVWATPGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVVADV----VVPGHGPPFR............................................................................... 236
48 -25.7001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  22  1..........MQIELVPCLKDNYAYILHDEDTVGVVDPSEAEP--------IIDSLKRSGRNLTYILNTHHHYDHTGNLELKDRYGAKVIGSAMDKDRI--------------------------------------------PGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKL-------EGTPKQMLASLQKITSLPDTSIYCGHEYTLSNLQSYAAHVAELRSKKLPTIPTTVKMEKAC................................................. 217
49 -25.4002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  23  6............IPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDA-------SGVTLMQILLTHGHLDHVGAASELQHYGVPVIGPEKE----------DEFWLQGLPAQSRMFGLDE----------------CQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLPLG--DDVTFIPGHGPLSTLGYERLHN....................................................................... 205
50 -25.1004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  17  39.AELKTILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIDERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIG--GVVDKQNASIFISKIEHD----FWINASIKDFNNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNKTLYSH---------FNFQLAPGHTPGLTVTTISSEKLMYVADLIILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSH--PWPGL............................................................................. 275
51 -24.4004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  17  37.QQVHEILKKYYADQEKGVQSINAFLVNIGKSLILIDSGAASGSHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVC-DGVANFPNATVYVSNDEASFWLDPKQAAKLPKEKQANYLGTVEKIKQAIAPYQAK-----------QRFKTYKLGDDIQ----GFKVINTAGHTPGHFSYELKTESIVFIGDIVVQFDRPETAIEYDIDPKKAVETRLKQFANFAKNGQTIAAPH--PFPGI............................................................................. 271
52 -23.6003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  17  8IHYLNGGNTKMD--VPKPL-PTHPILIQTAQYNLIIDAGIGNGKLSEHIIADLANYNLTPKDIDYVLMTHMHFDHAA--GLTDQAGHAIF--------------------ENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPG--IKMQHSGGHSFGHTIIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQWFLFYH.................................................................................... 251
53 -23.0001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  21  57ITALSDGTVALPVDKRLNQPSVTGYLVNTGSKLVLVDTGAAGGPTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVG-GEQLAFPNAVVRADQKEAD----FWLSQTNLDK----------APDDESKGFFKGAMASLNPYVKAGKFKPFSGNTDLVPG---IKALASHGHTPGHTTYVVESQGLALLGDLIVQFDDPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIAASH--SFPGI............................................................................. 308
54 -22.9004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  21  68.KDLQSLLARMFVASEKGVQAVNAYLINTGDNLVLIDTGAAQGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHAC--GLVNADGSPAYPNATVEV------------PQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVAPMNKLKPYKTEGELLPG---VSLVASPGHTPGHTSYLFKSQSLLVWGDILVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAH.................................................................................... 294
55 -22.9004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  21  68.KDLQSLLARMFVASEKGVQAVNAYLINTGDNLVLIDTGAAQGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHAC--GLVNADGSPAYPNATVEV------------PQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAPMNKLKPYKTEGELLPG---VSLVASSGHTPGHTSYLFKSQSLLVWGDILVQFAKPEVVWEFDVDSDQARQSRQRILAEAATDKLWVAGAH--PFPGL............................................................................. 300
56 -22.7002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  17  26............TVVP-TLKDNFSYLINDHTTLAAVDVNADYKPILTYIEEHLKQQGNADVTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVP----------------------VVVVGGANDSIPAVT----------------KPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQDGVALFTGDTMFIAGIGAF-------EGDEKDMCRAMEKVYHIKVTFIFPGHEYTSGFMTFSEKTFPDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQ-AFVAKMNQGNAHALMMYLYNACD....... 305
57 -22.5001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  16  4............EVLP-ALTDNYMYLVIDDETAAIVDPVQPQK--------VVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKV---------------------------------------------YGGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFGSEPPAVFTGDTLFVA-----KFYEGTADEMCKALLEVLGRLP--PDTRVYCGHEYTINNLKEKLAWAKEKYSIGEPTVPSTLAEEF-TYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD......... 260
58 -22.5004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  22  15.................PVSCTFTYLLGDRES-VLIDPVLETAPRDAQL---IKELGLR---LLYAVNTHCHADHITGSGLLRS---------------------------------------------LLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALL---IRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDLIYPAH-----DYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFA.................................. 224
59 -21.7004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  23  9.................SESSTYTYLIGDEAT-VLIDPVLEQVDRDLQM---VAELDLT---LTHVFDTHVHADHITASGALRETQATVVGSVNGASCANVQ-----------------------------------------------VRHGDEVRVGQLVFQVLATPGHTDDSISYLLGDR--VFTGDALL---VRGNGRTDFQNGNASQLYDSLTRVLFTLPDELVYPGH-----DYKGRTVTSIAEEKRHNPRVAGKSREE.................................................... 197
60 -21.0004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  13  11VLPIATNTKVLRYALERGTTS-NSYVIEG-DKTAIIDP---VESFMKIYLEALQQT-VNLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRAAFPDDNL-------------------------------------NILPMRGKETLDLGGHVLKFLPIP-RWPAGLCTYDVQTQILYTDKIFWESFKEDQRYYFNCLMAPHAIHVEALEKISDLQVRLYAVGHGPLVR---TSLIALTQAYAD................................................................ 248
61 -20.2002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  19  11.................NESSTFTYLLADDKPALLIDPVDKTVDRDLKL---IDELGLK---LIYAMNTHVHADHVTGTGLLKT---------------------------------------------KLPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGRMAFTGDAVL---IRGCGRTDFQEGSSDQLYESVHSQIFTLPKDLIYPAH-----DYKGFEVSTVGEEMQHNPRLTKDKET..................................................... 209
62 -19.8003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  21  18.......................SYLVQETGEACVIDP-------ARDVEPYLLTAKREGLRIVAALETHIHADFVGAREMADRAGAAICVSD--------------------------------------EGPPEWKSEYVKAYPHRLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKALFSGDFVFPDLLERVAGESGSSEALARQMFRSLRKFEALPDHVVLPAHG................................................................................... 200
63 -19.8002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  17  5AKRISDGVYWTGV-TLQGTTY-NAYLVCGDEGVALIDN---YPGTFDELMARVEDAQVGMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREA------------------------------------EFMTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDVLKKFDEVKELRIQMIAPSHGQIWTDPMKIIEAYTGWATGMVDERVTVISTRKMAHAIAEGAMSEGVDVRVYCLHEDDRSEIVKDILESGAI............ 311
64 -19.7002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  17  11............NSIP-AFQDNYIWVLTNDEGCVIVDPGEAAP--------VLKAIAEHKWMPEAIFLT----DHVGGVKELLQHFPQMTV----------------------------YGPAETQDKGAT----------------HLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSR--PYLFCGDTLFSGGCGRL-------EGTPSQMYQSLMKINSLPDTLICCAHEYTLANIKRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEARFAWLRSKKDT............... 253
65 -19.1001vme_A mol:protein length:410 Flavoprotein  ali model follow..  15  16..FDDPEIYVLRIEIPEGISY-NAYLVKLNGANVLIDG---KGNYAKEFIDALSKI-VDPKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEGFYGIKD---------------------------------------VTVVKDGEEREIGGKKFKFVMTP-HWPDTMVTYLD--GILFSCDVGGGYLLPEILDDSNESVTVIGHYLEGAEKLSSLKIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPKKGKVTVIYDSMYGFVENV.......................................... 276
66 -18.9002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  11  10DQEMIPGVYWVGYHTDEGSSY-NSYFIDD-ECPTVIDS---KYPFAEEWLSRIAAC-CPLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKILYGMEKA-------------------------------------TWLIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCPEDKILFSNDGFVSHVMHLFKEYTANILGLFSAQMRKLEVASTVEIKYILSAHGVSWRG--DAMGLAIAEYQKKVTVVLDSMTTHRMALALLDGARSTGCETVLLEMTSSDITKVALHTYDSGAV............ 311
67 -18.9003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  21  33.......................SYLIQKTGEAMIIDP-------IRDLSSYIRVADEEGLTITHAAETHIHADFAGIRDVAIKLNANIYVSGES---------------------------------------DDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGGLFSGDFIFPDLLEKAVKVEGSSEIGAKQMFKSIESIKDLPDYIIWPGHG................................................................................... 214
68 -17.8001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  15  3PVAITDGIYWVGASTHRGTTY-NAYLIVD-DKTALVDT---YEPFKEELIAKLKQI-KDPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKAHYSHID--------------------------------------NYTIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVPEEALLLPNDLIMDEAAKYYANILMPFSNLITKKLDEIQKI-NLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVISTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAV............ 306
69 -17.4001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  11  3ATKIIDGFHLVGALSPMGTTY-NAYLVED-EKTTLFDT---KAEYKGELLCGIASV-IDPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESHFHYKD--------------------------------------PVQVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFADEKVLISNDTLERAMREYYANIVNPYAPQTLKAIETLVGA-GVAPEFICPDHGVIFRG-ADQCTFAVQKYTNKVVIFYDSMSTEKMARVLAESFRDEGCTVKLMWCKACHHSQIMSEISDAGAV............ 307
70 -17.0004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  16  19.......................SYLLFDSGS-ALIDSVLDYDPRTASADQLIARVAALGARVRWLLETHVHADHLSAAPYLKRVGGEIAIGRHVTRVQDVFGKLFNAGPA-----FAHDGSQFDRL----------------------LDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAFVGDTLMPDYGTARCDFPGGDARSL---YRSIRKVLSLPPATLYMCHDYQPNGRAIQYASTVADELRENVHIREGVTEDD---------FVAMRTARDATLDMPVLMLPVQVNMRAGRLPEPEDNGVRYLK 292
71 -16.8004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  17  21.......................SYLVMDRET-ALIDSVLDYDPCSASADRLVERVNELNASVRWVLETHVHADHLSAAAYLKKLGGHTAIGAHITQVQKVFGALFNAEPG-----FARDGSQFDVL----------------------LEDEEGFRIGNLQARALHTPGHTPACMSFMIEDAGAVFVGDTLMPDYGTARCDFPGADARTL---YRSIRRLLAFPDQTLFMCHDYLPGGRDMQYVTTVAEQRASNIHIHQGIDEDS---------FVAMREARDKTLEMPVLILPVQVNMRSGQLPPPEANGVSYLK 288
72 -16.7004nur_A mol:protein length:633 PSdsA  ali model follow..  19  89LFEVTDGIYQVR-----NYDLSNMTIVEGKDGITIFDPLISQETAKAALD--LYYKHRPKKPVVAVIYTHSHVDHYG--------GVRGVVDEADVKAGKVKIYAPLGFLEHAVAENVMAG-AKGQLGAGLGTTTSAGTVTLIPPTDIIKETGETHVIDGLTYEFMYAPGEAPAEMLYYIKEKKALNAAEDSTHTLHNTYSLRGAKIRDPLSKYLNEALKLWGDDVQVMYAMHHWPVWG-NKEVREQLSLQRDMYDETLRLANKGYTMTEIAEQVLPKKIATKFSNRGYYGSLNH...................... 392
73 -16.3004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  16  89LFKVTDKMYQVR-----GQDISNITFVEGEKGIIVIDPLVTPPAAKAALD--LYFQHRPQKPIVAVIYTHSHTDHYG--------GVKGIISEADVKSGKVQVIAPAGFMDEAISENVLAG-AQGNVGNGLGVTLATGDPSIIAPTKTIVRTGEKMIIDGLEFDFLMTPGEAPAEMHFYIPALKALCTAENATHTLHNFYTLRGAKTRDTSTEYLNETLDMWGNDAEVLFMPHTWPVWG-NKHINDYIGKYRDTIDQTLHLANQGYTMNEIGDMILPPALANNWASRGYYGSVSH...................... 392
74 -16.2002cfu_A mol:protein length:658 SDSA1  ali model follow..  19  107LFEVAEGIYQVR-----GFDLANITFIRGDSGWIVVDTLTTPATARAAYE--LVSRELGERPIRTVIYSHAHADHFG--------GVRGLVEPQQVASGAVQIIAPAGFMEAAIKENVLAG-PQGQVDMAIGKGLARGPLSLLAPTRLIEGEGEDLVLDGVPFTFQNTPGESPAEMNIWLPRQKALLMAENVVGTLHNLYTLRGAEVRDALSKYINQALHRFGRQAEVMFAVHNWPRWG-NAEIVEVLEKQRDLYDQTLHLANQGVTIGQVHNRLLPPSLDQEWYDRGYHGSVSH...................... 410
75 -15.9004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  11  4..VVKNNIHWVEYKTLRGSSY-NSYLIRE-EKNVLIDT---DHKFSREFVQNLRNE-IDLADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPEWN-----------------------------------------FNVVKTGDTLDIGGKQLIFVETP-HWPDSMMTYLTGDAVLFSNDELFEQCQRYYANILTPFSRLVTPKITEILGF-NLPVDMIATSHGVVWRDNPTQIVELYLKWAANTRMMADAIAQGIAETDPRVAVKIFNVARSDKNEILTNVFRSKGVLVGTSTMNNV......... 314

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 5 7 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.