current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MRVFPVTLGPLQENAYLVETGEGPVLIDPGDEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLPVRPLEEGMRLFGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPGADPKALFASLKRLLSLPPETRVHPGHGPGTTLGLEARTNPFLTGLEWEALast
1 -110.0002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model  100  1MRVFPVTLGPLQENAYLVETGEGPVLIDPGDEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLPVRPLEEGMRLFGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPGADPKALFASLKRLLSLPPETRVHPGHGPGTTLGLEARTNPFLTGLEWEA 207
2 -89.5002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  38  1MNYRIIPVTAFSQNCSLIWCTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD..... 210
3 -55.6005aeb_A mol:protein length:272 LRA-12  ali model follow..  16  26IAGNLYYIGTYDLACYLITTKQGNIIVNLAASALQIKNNIKALGFKTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFG-SMFEPIIADRLLHDKDTITKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMFSEVSSYPGIAKDYAYTLQAMKNLSFDI-WVASHASQFSMHSKHKPKSFMDRKGYDE 256
4 -54.2003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  22  5.GLHSIPAGPVEATVYVMCGEKLTVMIDAGVSNSIADFSFLD---KLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLGGLEKKLDQDKVIEVEGNEEFYRMRLIYTPGHARHHMSVLV--DDFLFTGDSAFNGVVIPTTPPVIDYKMYMESLKRQIELKPKV-VGFAHGGLVSPKIMEEHLKQM....... 223
5 -52.1002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  22  18......PARNIDFNGFAWIRPEGNILIDPVALSNHDWKHLESLG-GVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENF----------------PIYCDRWLSDGDELVGLKVMELQGKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDNKQKVVASVRRLAALEKVEAVLVGDGWSVFRDGRDRLKELVATLA... 201
6 -51.8001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  22  29...HTWQIGTEDLTALLVQTPDGAVLLDGGQMASHLLDNMKARGVTLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHFGDGITPPANADRIVMDGEVIIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLHLIEDYRRSFATVRALPCDV-LLTPHPGASNWDYAAGARAGAKALTCKA 248
7 -51.7005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  21  22...NTYYVGMKGLSSVLVTSPQGHVLIDGGESAPKIIANIGALGFRVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGPDDPQYHALPKYPPVKDMRLARDGGQFVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGFKFADLRHSFETLEKLPCDV-LISAHPEASQLWQRLEADAFVDPQACRA 252
8 -50.1003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  17  17...NTHYVGTGGISAVLLSSPQGHILVDGTKGAQVVAANIRAMGFKVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTPKSDPQFGSLSNFPGSAKVRAVADGELVLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLSADSYRFSDHPEVVASFEAVEKLSCDI-AIAAHPEVNDMWTRQQNSAYVDNGACRA 244
9 -50.1001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  18  20.......VGTDDLASYLIVTPRGNILINSDANVPMIKASIKKLGFKTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYA-TYFTQSTVDKVLHDGERVTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKKIAEDYKHSIKVLESMRCDI-FLGSHAGMFDLKNKYVNNPFVDPTGCKN 244
10 -49.6003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  21  46...NIYYVGTDGIAVYVIKTSQGLILMDTAQSTGMIKDNIAKLGFKIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGYYPGDEKNEDLAFPAVKVDRAVKEGDRVTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSVGQPTYA-GIVDDYRATFAKAKAMKIDV-LLGPHPEVYGMQADGAPNPFIKPGELVT 271
11 -49.6004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  24  7ILLRQMFEPVSCTFTYLLGDSREAVLIDP-ETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISR-------------------LSGAQADLHIEDGDSIFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVEKIFTLPGDCLIYPAHD-VSTVEEERTLNPRLT...... 200
12 -49.0004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  26  1MIFRQLFDSESSTYTYLIGDTRQAVLIDP-EQVDRDLQMVAELDLTLTHVFDTHVHADHITASGALRERTQATVVGSVNGASCANVQVRHGDEVRVGQ----------------LVFQVLATPGHTDDSISYLLGDR--VFTGDALLVRGNGRTDFQNGNASQLYDSLRVLFTLPDETLVYPGHD-VTSIAEEKRHNPRVAGKSREE 197
13 -47.0002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  23  3LLFRQLFENESSTFTYLLADDKPALLIDP-KTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISK-------------------ASGSKADLFLEPGDKVIYLEVRATPGHTAGCVTYVTGEGRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVSQIFTLPKDTLIYPAHD-VSTVGEEMQHNPRLTKDKET. 209
14 -46.9001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  27  1..MQIELVPCLKDNYAYIEDTGTVGVVDPS-EAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPGI-----------------DMALKDGDKWHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGK--LFEGTPKQMLASLQKITSLPDDTSIYCGH--PTTVKMEKACNPFLR...... 222
15 -44.0001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  26  1..MKVEVLPALTDNMYLVIDTKEAAIVDPV-QPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLEGLKVYGGDDRIGALTHKITHLSTLQVGS----------------LNVKCLATPCHTSGHICYFVSEPPAVFTGDTLFVAGCGK--FYEGTADEMCKALEVLGRLPPDTRVYCGH--PSTLAEEFTYNPFMR...... 226
16 -42.3002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  29  24LDDDLCLLGDVQVPVFLLRLGEASALVEGGRDAELVWADLCRWVAQVHYWLITHKHYDHCGLLPYLCPRLNVQVLASERTCQAWKSESRAEQRLPEACAWDALPVRAVADGEWLHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALDEAEGVWRPLVFDDMEAYLESLERLQRLPTLLQLIPGHGGLLR.................. 240
17 -41.8004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  20  53.......VGTCGISALLVTSDAGHILVDAAQAGPQILANIRALGFRVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPIVTLADDGVVLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTDDAAHPGYLAAFRNTLARVAALDCDI-LVTPHPSASGLWNRIGPAPLMDTTACRR 276
18 -41.7003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  29  4MYLRRFYDEGLAHASYLVGCTGEACVIDPARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEWKSEYVKA------------PHRLLKDGDELVRIVVMHTPGHTPEHVSYLLYDGKALFSGDFVFVGDVGRPDLLERVARQMFRSLRKFEALPDHVQVLPAHGPSSTVGYEKLVNWALQHKDEDA 234
19 -41.4003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  24  19MFFKQFYDKHLSQASYLIGCQKEAMIIDPIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKLNANIYVSGESDD------------TLGYKNMPNHTHFVQHNDDIIKLKVLHTPGHTPESISFLLTDEGGLFSGDFIFVGDIGRPDLLEKA-KQMFKSIESIKDLPDYIQIWPGHGPTSTLGYEKQTNWAFSENNEAT 248
20 -41.4002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  23  21SAFSVTVVPTLKDNSYLINDTHTLAAVDVNADYKPILTYIEEHTYTFSTILSTHKHWDHSGGNAKLKAELEA------------MNSTVPVVVVGGANDSIPAVTKPVREGDRVLSVEVIDAPCHTRGHVLYKVQHPQALFTGDTMFIAGIGA--FFEGDEKDMCRAMEKVYALDKVTFIFPGH--PSSLAEEKRQNLFLR...... 278
21 -41.1004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  20  53.......VGTCGISALLVTSDAGHILVDAAQAGPQILANIRALGFRVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPIVTLADDGVVLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTDDAAHPGYLAAFRNTLARVAALDCDI-LVTPHPSASGLWNRIGAAPLMDTTACRR 276
22 -41.0002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  25  6GSMNLNSIPAFQDN-VLTNDEGRCVIVDPG-EAAPVLKAIAEHKWMPEAIFLT----DHVGGVKELLQHFQMTVYGPAET-------------------QDKGATHLVGDGDTIEKFTLFATPGHTLGHVCYFSRP--YLFCGDTLFSGGCGR--LFEGTPSQMYQSLMKINSLPDDTLICCAH--PVILKNERKINLFLR...... 221
23 -37.7004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  28  21..............SYLVMDTRQCALIDS-ASADRLVERVNELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHITQVQKVFGALFNAEPGFARDGSQFDVLLEDEEGFLQARALHTPGHTPACMSFMIEDAGAVFVGDTLFMPDYGRCDFPGADARTLYRSIRRLLAFPDQTRLFMCHD-VTTVAEQRASNIHIHQ..... 239
24 -37.4004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  27  19..............SYLLFDSGECALIDS-ASADQLIARVAALGARVRWLLETHVHADHLSAAPYLKTRVGGEIAIGRHVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLLSIRAMHTPGHTPACMTYVVTEAHAAFVGDTLFMPDYGRCDFPGGDARSLYRSIRKVLSLPPATRLYMCHD-ASTVADELRENVHIRE..... 243
25 -37.1005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  22  49..........YPSNGLIVRDGDELLLIDTAWGTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEAEGNE--------IPTHSLEGLSSSGDAV-PVELFYPAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGVADADLAEWPTSVERIQKHPEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRS 245
26 -36.7004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  22  29........GVVPKHGLVVLVNAEAYLIDTPKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKN---------KIEVFYPPGHTPDNVVVWLPERKILFGGGFIKPYGLG---LGDANIEAWPKSAKLLKSKGKAKLVVPSHSEVGDASLLKLTLEQAVKG.... 216
27 -36.7004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  22  67..........YPSNGLIVRDGDELLLIDTAWGTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEAEGNE--------IPTHSLEGLSSSGDAV-PVELFYPAAHSTDNLVVYVPSANVLYGGCAVLELSSSAGNVADADLAEWPTSVERIQKHPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRS 263
28 -36.4004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  17  31..........VSSNGLVVIDKGNAFIVDTPRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQ-SISTYATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIE---------FYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYGEAHIDQWSRSAQNALSRSEAQIVIPGHGKIGDIALLKHTKSLAETASNKS 223
29 -36.1002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  24  66..........YSSNGLIVRDADELLLIDTAWGTVALLAEIEKIGLPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVVRFGP------VEVFYPAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGVADANLAEWPATIKRIQQRPEAEVVIPGHGLPGGLELLQHTTNVVKTHKVRP 262
30 -35.9002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  22  67..........YPSNGLIVRDGDELLLIDTAWGTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEVEGNE--------IPTHSLEGLSSSGDAV-PVELFYPAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGVADADLAEWPTSIERIQQHPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRS 263
31 -35.9004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  22  32..........VSKHGLVVLVNTDAYLIDTPFTTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQ-SIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKN---------KIEVFYPPGHTQDNVVVWLPEKKILFGGCFVKPDGLG---LGDANLEAWPKSAKILMSKVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNES 221
32 -34.6004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  18  44........GAVASNGLIVRDGGRVLVVDTAWTTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAA----QHSLTFAANGWVEPATAP-PLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGAADTEHYAASARAFGAAPKASMIVMSHSAPDSRAAITHTARMADKLR... 243
33 -34.1004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  18  47........GAVASNGLIVRDGGRVLVVDTAWTTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVA----AQHSLTFAANGWVEPATAP-PLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGDADTEHYAASARAFGAAPKASMIVMSHSAPDSRAAITHTARMADKLR... 246
34 -34.1005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  18  44........GAVASNGLIVRDGGRVLVVDTAWTTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAA----QHSLTFAANGWVEPATAP-PLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGDADTEHYAASARAFGAAPKASMIVMSHSAPDSRAAITHTARMADKLRLE. 245
35 -34.1002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  20  29........GLVDSNGLVVLDNNQAYIIDTPEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLARE-------GKPVPTHYFKDDEFTLGNGLIELYYP--AGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGASISSWADSIKNIVSKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKL 223
36 -33.9003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  18  38........GAVASNGLIVRDGGRVLVVDTAWTTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVA----AQHSLTFAANGWVEPATAP-PLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGDADTEHYAASARAFGAAPKASMIVMSHSAPDSRAAITHTARMADKLR... 237
37 -33.8001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  17  30.............TVVYLEHKDRRIIIDPGSSMDELEEKFSELGISPDDVLFTHVHLDHIFNSVLFE---NATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLKVKVFHTPWHAREHLSFLLDAGRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVGRID---LLVFPHDAPLKPEVKK............. 215
38 -33.7004tyf_A mol:protein length:231 NDM-4  ali model follow..  18  32........GAVASNGLIVRDGGRVLVVDTAWTTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGLVAA----QHSLTFAANGWVEPATAP-PLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGLGDADTEHYAASARAFGAAPKASMIVMSHSAPDSRAAITHTARMADKLR... 231
39 -33.6005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  20  48..........VDSNGLVVLDNNQAYIIDTPWSTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLARE-------GKPVPTHYFKDDEFTLGNGLIELYYP--AGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYGDASISSWADSIKNIVSKYPIQMVVPGHGKVGSSDILDHTIDLAESAS... 237
40 -33.5004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  18  71........GAVASNGLIVRDGGRVLVVDTAWTTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAA----QHSLTFAANGWVEPATAP-PLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGDADTEHYAASARAFGAAPKASMIVMSHSAPDSRAAITHTARMADKLR... 270
41 -33.4004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  24  26......PMTLQGTNTYLVGTGPRRILIDTGEPISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIG-------NGEQQYVYLKDGDVIATLRVLYTPGHTDDHMALLLEEENAIFSGDCI----LGEGTTVFEDLYDYMNSLKELLKIKADI-IYPGHGPVIHNAEAK............. 210
42 -33.4003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  18  45........GAVASNGLIVRDGGRVLVVDTAWTTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAA----QHSLTFAANGWVEPATAP-PLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLNLGDADTEHYAASARAFGAAPKASMIVMSHSAPDSRAAITHTARMADKLR... 244
43 -33.0003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  19  27........KEYSANSMYLVTKKGVVLFDVPWEYQSLMDTIKKHNLPVVAVFATHSHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKDGKA------------TSTEIIKTGKPYEEFVVDFLEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGIKEANVEQWPKTINKLKAKSKATLIIPGHDEWKGGGHVEHTLELLN...... 217
44 -32.8002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  20  34..........VPSNGLVLNTSKGLVLVDSSWDTKELIEMVEKKQKRVTDVIITHAHADHIGGIKTLKER-GIKAHSTALTAELAKKNGYEEPLGDLQTVTN------LKFGNM--KVETFYPKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGVADAYVNEWSTSIENVLKRRNINAVVPGHGEVGDKGLLLHTLDLLK...... 222
45 -32.8001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  18  33........GMVPSNGMIVINNHQAALLDTPINTETLVNWVADLHAKVTTFIPNHWHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEKGL------------PVPEHGFTDSLTVMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQATSIGISDADVTAWPKTLDKVKAKPSARYVVPGHGDYGGTELIEHTKQIVNQYIEST 229
46 -32.8001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  18  33........GMVPSNGMIVINNHQAALLDTPINTEMLVNWVTDSHAKVTTFIPNHWHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKGL------------PVPEHGFTDSLTVMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGISDADVTAWPKTLDKVKAKPSARYVVPGHGNYGGTELIEHTKQIVNQYIEST 229
47 -32.1002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  19  40..........VPSNGLVLNTSKGLVLVDSSWDTKELIEMVEKKQKRVTDVIITHAHASRIGGIKTLKER-GIKAHSTALTAELAKKNGYE------------EPLGDLQTVTNLMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGVADAYVNEWSTSIENVLKYRNINAVVPGHGEVGDKGLLLHTLDLLK...... 228
48 -31.9003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  18  34..........VPSSGLVLNTSKGLVLVDSSWDTKELIEMVEKFQKRVTDAIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKNGYE------------EPLGDLQTVTNLMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGVADAYVNEWSTSIENVSKRRNINAVVPSHGEVGDKGLLLHTLDLLK...... 222
49 -31.7002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  25  15.....IPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELCFQDVKTILLTHHHPDHYGLSGFF-EGLGARVFLHEEEFARGHRFWREPEAFARERVHPPQNPLPLRDGEALKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLRENPLKDFLRSLDRLADLGARV-AYAGHFGPIADVRQRAEE.......... 246
50 -31.7001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  18  19........YYVQENSMVYFGAKGVTVVGATWTARELHKLIKRSRKPVLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDWAEIVAFEYPDLPLVLPNVVHDGDFTL-KVRAFYAPAHTPDGIFVYFPDEQVLYGGCILKE---KLGNLSFADVKAYPQTLERLKAMLPIKTVIGGHDSPLHGPE-DHYEALIKAAPQSS 228
51 -31.6004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  20  34...........SNVLVAKMLDGTVVIVSSPFETQTLMDWVAKMKPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRLEENKKKRRILSSHPVPADNVFDLKQGKVFELVEVSFPPAHSPDNVVVYFPKKKLLFGGCMIKPKELG---LGDANVKAWPDSARRLKKFDAKI-VIPGHGEWGGPEMVNKTIKVAEKAVGEM 248
52 -31.5003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  14  22........EYVQENSMVYIGTDGITIIGATWTAETLYKEIRKSPLPINEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSIVNFKYPNLEKSLPDTVFPGDFNL-SIRAMYLEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGKVDSIIAGHDTPIH.................. 216
53 -31.5001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  14  25..........YAANAVYLVTDKGVVVIDCPWGFKSFTDEIYKHGKKVIMNIATHSHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKENK------------PRAQYTFDNNKSFSEFQVYYPKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGIGEAYVNDWTQSVHNIQQKSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQ 219
54 -29.3003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  24  36.........NLPVWCYLLETEEGPILVDTGTEEDRIVNILKRVGYELLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIE---GDYEVVPGVQLLYTPGHSPGHQSLFIETEQVLLTIDASYTKENFEDEVPF-DPELALSSIKRLKEVVKKPIIFFGHDIEQ................... 243
55 -29.2005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  22  38.....LPFSLDHINLWLLRDEIDGTIVDCGISSEAIRTHWEQDGLPVLRVLVTHCHPDHFGLANWLCERWNVRLWMTLGEPAALDKLRSRRSYYSDLVPAVPPRYRRLREGDAVRTWRVVTGYGHSPEHCALHSEADGVLISGDMVLPRSVFDLEPEANPLALYLESLGRYETMAPDTLVLPSHGKPFRGVRTRIAQ.......... 284
56 -29.1002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  24  34.........NLPVWCYLLETEEGPILVDTGTEEDRIVNILKRVGYELLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIE---GDYEVVPGVQLLYTPGHSPGHQSLFIKTEQVLLTIDASYTKENFEDEVPF-DPELALSSIKRLKEVVKKPIIFFGHDIEQ................... 241
57 -28.9002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  18  40.........DIPVSAYLIQCTDATVLYDTGASECNLPERLRQLGLSPDTVVLSHLHNDHAGCVEYFGK---SRLIAHEDEFATAVRYFATGDHSSWDLVGRDERERELAPGVNL----LNFGTGHASGMLGLAVRLEKFLLVSDACYATNYGPPARRAGDTIGYDRTVSHIRQYAESLTVLFGHDREQFASLIKSTDGFYE...... 276
58 -28.8004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  25  66..........GGAEAALEEAARGPILVDTGWAREALLGALAGQGVAPGDVVGTHGHSDHIGNLGLFP---GAALLVSHDFCLPGGRYLPHGLGEG-------------QPLRLGPGLEVWATPGHGGQRDVSVTALGTVVVAGDVFERDGDEDSWQA--DPAAQERSRKRVLVVAD--VVVPGHGPPFRVLREASQ........... 243
59 -28.5003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  19  33..........FPVYSILIEHAEGRFLIDTGEKHQTIPGALGLLGLEPRVVVNSHFHFDHCGGNKYFP---HAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLGVKLISTPGHSIGHYSLLVEFPRILFTIDAAYTQKSLETLCQAADPVAGVNSMRKVKKLAEDAELMYSHDMDNFKTYRTGTQFY........ 267
60 -24.9004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  25  55.........QTSINAFLVNIGKSLILIDSGAHLGSVLSNLKASGYQPEQVLLTHLHPDHVCGISKDGVANNATVYVSNDEASFWLDPKQAAKL-AIAPYQAKQRFKTYKLGDDIQGFKVINTAGHTPGHFSYELKTESIVFIGDIVHSHTV-QFDRPE-DPKKAVETRLKQFAAKNGQTIAAPHLPFPGIGHTYSAD.......... 278
61 -24.7003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  18  45.........NLPTHPILIQTAQYNLIIDAGDEESHIIADLANYNLTPKDILMTHMHFDHAAGLTDQAGHAIFEHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKL-KHFEPVPGIKMQHSGGHSFGHTIITSQGDKAVHMGDIFPTTAHKNPLWVTAYPMQSIREKERMIPIQQQYWFLFYHDENYFAVKYSDDG.......... 264
62 -23.3004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  24  56.........DMAINILLVKTKEKLILMDTGERTGFLLKSLQKAGFSAHDIFLSHAHPDHIGGVVDKQNKLVFPIFISKIEDFWINASIKDFNNSALKAHPERLNQKFYDLNKTLYHFNFQLAPGHTPGLTVTTISSEKLMYVADLIHSDVILHPDWGFSDLDIATASRKKFLKADTKARAFTSHLPWPGLGFTKVKA---PGFEW.. 287
63 -22.5004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  25  86.........QTAVNAYLINTGDNLVLIDTGATLGVVQTNLKASGYQPEQVLLTHLHPDHACGLVNADGSPAYPVEVPQAEAEFWLDEATMAKA---PYAKMNKLKPYKTEGELLPGVSLVASSGHTPGHTSYLFKSQSLLVWGDILINHAV-QFAKPE-DSDQARQSRQRILAATDKLWVAGAHLPFPGLGHVREEA---QGYAW.. 312
64 -22.5004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  26  86.........QTAVNAYLINTGDNLVLIDTGATLGVVQTNLKASGYQPEQVLLTHLHPDHACGLVNADGSPAYPVEVPQAEAEFWLDEATMAKA---PYAKMNKLKPYKTEGELLPGVSLVASPGHTPGHTSYLFKSQSLLVWGDILLNHAV-QFAKPE-DSDQARQSRQRILAATDKLWVAGAHLPFPGLGHVRKEA---QGYAW.. 312
65 -22.2001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  22  94.........ETSVTGYLVNTGSKLVLVDTGATLGRLAANLKAAGYQPEQVYITHMHPDHVGGLMVGEQLANAVVRADQKEADFWLSQTNLDKA-SLNPYVKAGKFKPFSGNTDLVGIKALASHGHTPGHTTYVVESQKLALLGDLILVAAV-QFDDPS-DSKSVAVERKKAFAAKGGYLIAASHLSFPGIGHIRAEG---KGYRF.. 320
66 -16.5003x2x_A mol:protein length:227 UPF0173 metal-dependent hydrolase TM_1162  ali model follow..  15  6..........FLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTAGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLF-------DFGRVKMTPAVHGSGGNPSGFLITIEGKKIYHAGDT-----------------GLTREMELLAEENVDVAFLP--GGNFVMDVE.............. 173
67 -16.4004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  18  41..........TTSNSYVI-EGDKTAIIDPPVESEALQQTVNLKKLD--YVILGHFSPNRIPTFKALLELAQITFVCSLPAAGDLRAA----------FPDDNLNILPMRGKETLHVLKFLPIP-RWPAGLCTYDVQTQILYTDKIVFDDNWESNCLMAPHAIHVEAALEKISDLQVRL-YAVGHGPLVRTSLIALTQAYADWSKAQK 254
68 -16.0003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  11  22...KELTITFIKHGSLMLTYDNHSIQVDPVSEYADYTTF------KADIILITHEHGDHLDPKAIQAVEKSDTEIIANENSQKKLGKGKVLKNGDTDTSISYMKIEAVPAYNTTPGRDKYHPRHRDNGYI-LTFDGLRVYIAGDT--MKDLKDIDIANQPYTMTVSQAAKAARMFSPKILYPYHYGDTKIGELKD............ 214
69 -15.2002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  13  15.......ILTIGGTVIEVAYKDAHIFFDFGPRLGYEYHGAEDKDYQHTAVFLSHAHLDHSRMINYLDP--AVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTR-LNKNDVIISVEIVPVDHDAYGASALLIRDHFITYTGDLRLHGH------NREETLAFCEKAKHT-----ELLMMEG----VSISFPEREP.......... 227
70 -15.1002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  23  36.............NAYLVCGDEGVALIDNSYPGARVEDALQQVGMRVDYIIQNHVEKDHSGVLVELHRRFEAPIYCTEVAVKGLLKHYPSLREAEFMT---------VKTGDVLKTLTFLETP-HWPDSMFTLLDEDGILFSNDARLDREIPEYIL-SKLVLKKFDEVKELGLLERIQMIAPSHGQ..................... 235
71 -14.2005aho_A mol:protein length:336 5` EXONUCLEASE APOLLO  ali model follow..  22  24.............................................TARLFFLSHMHSDHTVG---LSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEFGTILYTGDFRYTPSMLKEVLP--SRQEAAHQIVQLIRKHPQHNIKIG---LYSLGKES............. 189
72 -14.1003g1p_A mol:protein length:258 Protein phnP  ali model follow..  14  38...........QPCSGVVKFNDAITLIDAGLHDLADRWSPGS----FQQFLLTHYHMDHVQGLFPLRWGVGIPVYGPPDEQGCDDLFKHPGLLDFSHTVEPFVVFDL--QGLQVTPLPLNH--SKLTFGYLLETAHSRVAWLSDTVMDCSHPPRADAPRNHCDLNTVLALNQVIRSPRVILTHISHQFDAWLMENALPSGFEVGFDG 246
73 -14.0002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  18  3.GSGSVEVQVLIENSLLLKKGNKEIVVDTGQS-ENFIKNCGLMGIRIKKVVLTHGHYDHIGGLKGLLER-EVKIYTHKENTDITYDNEFTTKNFFVEKEGKRIPDKFLDEVFVVVKINVVTGCSHA-GILNILETARNRF--GVSYIKSLIGGFHLRGMEEEKVKDIARKIEEYGVK-KVLTGH....................... 249
74 -13.9004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  20  36.............NSYLI-REEKNVLIDTVDHKQNLRNEIDLADID--YIVINHAEEDHAGALTELMAQIDTPIYCTANAIDSINGPEWNFNV--------------VKTGDTL-QLIFVETP-HWPDSMMTYLTGDAVLFSNDALFNDEVDQANILTPFSRLVTPKITEILGFNLPVDMITSHGVVWRDNPTQIVELY........ 238
75 -13.5003zq4_A mol:protein length:555 RIBONUCLEASE J 1  ali model follow..  19  17.......LGEIGKNTYAVQFQDEIVLIDAGIKFPE-YTYLVKNEDKIKGLFITHGHEDHIGGIPYLLRQVNIPVYGGKLAIGLLRNKLEEHGLLRQTKLNIIGEDDIVKFRKTAVSFFRTTHSIPDSYGIVVKTPPGNIVHTGDFKFDFT------PVGEPANLTKMAE-LCLLSDSTNS-PEFTMSERRVGESIHDIF........ 219

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 3 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]