current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3adr_A mol:protein length:261 Putative uncharacterized protein ST1585, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MPCRGLHSIPAGPVEFPEIATVYVMCGEKLTVMIDAGVSNSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDDFLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKSILast
1 -107.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model  100  1MPCRGLHSIPAGPVEFPEIATVYVMCGEKLTVMIDAGVSNSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDDFLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKSI 261
2 -57.5002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  18  18LSAPGQLDDDLCLLGDVQVPVFLLRLGEASWALVEGGISRDAELVADPSQVHYWLITHKHYDHCGLLPYLCPRPNVQVLASERTCQAWKSESAVRVVERLNRQLL--RAEQRLPEACAWDALPVRAVADGEWLELGPHRLQVIEAHGHSDDHVVFYDRRRLFCGDALGEFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLLLIPGHGGLLRGRLAADGAESAYTECLRLCRRLLWRQSMGESLDELSEELHRAWGGQS.. 287
3 -54.2002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  22  2....RVFPVTLGPLQ----ENAYLVETGEGPVLIDPGDEPEKLLALFQTIPLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEGADLAARA---------------WGLAIPKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDGAQVFSGDLL---FRGSVGRYDLPGADPKALFASLKRLLSLPPETVHPGHGPGTTLGLEARTNPFL...................................... 200
4 -51.9005aeb_A mol:protein length:272 LRA-12  ali model follow..  13  38...................LACYLITTKQGNIIVNTGLAASALQIKNLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGHGSMFE-------------PIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDRILIANMP-TIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDG--YNPKSFMDRKGYDESLDKLQKEYEKHLNE........ 271
5 -48.3005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  15  31...................LSSVLVTSPQGHVLIDGGLPESAPKIIAIEDVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGEVGPD-------------PQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSC--GPRCLNMVYADSINAVSRPGFKFADLRHSFETLEKLPCDVLISAHPEASQ------LWQRLEASATGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQ. 270
6 -48.1003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  15  55...................IAVYVIKTSQGLILMDTAMPQSTGMIKDVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKNEDLAF---------------AVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTEVLFFCSG-TVALNRLVGQPTYAG-IVDDYRATFAKAKAMKIDVLLGPHPEVYG--MQAKRAEMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQTAALEK. 293
7 -48.0001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  13  25...................LASYLIVTPRGNILINSDLEANVPMIKAFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYANDSSTYFT------------QSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKQAVIIGSIGVNPGYKLVDNITYPK-IAEDYKHSIKVLESMRCDIFLGSHAGMFD------LKNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQET. 262
8 -47.9001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  14  38...................LTALLVQTPDGAVLLDGGMPQMASHLLDPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHFGDGITY---------------PANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTRIAYADSLSAPGYQLQGNPRYP--HLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGARAGA------------KALTCKAYADAAEQKFDGQLAKETA. 266
9 -47.4004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  13  49....NTWYVGT------CGISALLVTSDAGHILVDAATPQAGPQILAPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLP------------DRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRRQMVYADSLTAISDDVYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRA---------AAPLMDTTACRRYAQGARQRLEKRLAEEAA. 294
10 -47.4003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  15  26...................ISAVLLSSPQGHILVDGTTEKGAQVVAALSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVS------------PKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQDVVFADSLTAVSADSYRFSDHPE---VASLRGSFEAVEKLSCDIAIAAHPEVND------MWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEKR. 262
11 -47.2004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  13  49....NTWYVGT------CGISALLVTSDAGHILVDAATPQAGPQILAPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLP------------DRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRRQMVYADSLTAISDDVFRYSDDAAHPLAAFRNTLARVAALDCDILVTPHPSASGLWNRIG-----PRAAAPLMDTTACRRYAQGARQRLEKRLAEEAATSPS. 298
12 -41.5002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  14  5LHRPDLYSWSTFNPARNIDFNGFAWIRPEGNILIDPVSNHDWKHLESLGGVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENF-------------------------------PIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLEETLITGDLV---RAYRAGGLEILPMNKQKVVASVRRLAALEKEAVLVGDGWSVFRDGRDRLKELVAT.................................... 199
13 -41.3002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  17  5..LPGLYLLPVPIPYPLKTVNLYLLQGAGEVALVDTALGTRAAR-LCFQDVKTILLTHHHPDHYGLSGFF-EGLGARVFLHEEEHRFWREPEAFAEASWRLFLDHGTPEGALQGIRETVPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEVLLAGDALLEKVSPNVGLWAYTRENLKDFLRSLDRLADLGARVAYAGHFGPIAD--VRQRAEELKAHHQARLEALLALLDGPKTAWELSLHL.......... 275
14 -41.3002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  19  2....NYRIIPVTAFSQ----NCSLIWCEQLAALVDPGGDAEKIKQEVDATLMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQG---------------PAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDSQLLISGD---VIFKGGVGRSDFPRGDHTQLIDAIRKLLPLGDDVFIPGHGPLSTLGYERLHNPFLQD.................................... 210
15 -39.0001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  20  29...................STVVYLEHKDRRIIIDPGNLSSMDELISPDDITDVLFTHVHLDHIFNSVLF---ENATFYVHEVYKTKNYLSF-------------GTIVGRIYSKVISSWKNVVLLKGEESLFDEK---VKVFHTPWHAREHLSFLLDRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVGRI-----DLLVFPHDAPLKPEVKK............................................ 215
16 -37.6004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  20  1.......MIFRQLFDSESSTYTYLIGDTRQAVLIDPVLEQVDRDLQMVAELTHVFDTHVHADHITASGALRERTQATVVGSVNGASCAN-----------------------------------VQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLGDRVFTGDAL---LVRGNGRTDFQNGNASQLYDSLRVLFTLPDETVYPGH--VTSIAEEKRHNPRVAGKSR................................. 195
17 -37.0004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  15  36....................VLVAKMLDGTVVIVSSPFENLGTQTLMDPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRLE-ENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFKKLLFGGCMIKPKELGYLG-----DANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEM............................... 248
18 -37.0003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  19  1MSDTKVYLLDGGSLVLDGYVYSILIEHAEGRFLIDTGYDYDHVM-LEPRDIDVVVNSHFHFDHCGGNKYF---PHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTFEGIDGDVDLARG---VKLISTPGHSIGHYSLLVE-ILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDELMYSH...................................................... 252
19 -36.6004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  17  32...................TNTYLVGTGPRRILIDTGEPAIPEYISCLKQIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQRE----------------------EIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLENAIFSGDCI-------LGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKII.......... 246
20 -36.5004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  17  13.............FEPVSCTFTYLLGDSREAVLIDPVLETAPRDAQLIKELLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQAD----------------------------------LHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDMAFTGDAL---LIRGCGRTDFQQGCAKTLYHSVEKIFTLPGDCIYPAH--VSTVEEERTLNPRLTLSCEEFVKIMGN......................... 212
21 -36.4002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  16  1.....MKLLFRQLFENESSTFTYLLADDKPALLIDPVDKTVDRDLKLIDELIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKASGSKAD----------------------------------LFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGAFTGDAV---LIRGCGRTDFQEGSSDQLYESVSQIFTLPKDTIYPAH--VSTVGEEMQHNPRLTKDKETFKTIMSN......................... 216
22 -34.2001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  21  1........MQIELVPCLKDNYAYILHDTGTVGVVDPSEAEPIIDSLKRSNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRI--------------------------------PGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFSRAIFTGDTMFSLSCGKLFEGTP-----KQMLASLQKITSLPDDTIYCGH--------------------EYTLSNSKFALSLEPNNEVLQSYAAHVAELRSK. 202
23 -34.0004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  13  33...................SNGLVVIDKGNAFIVDTPWSDRDTETLVHYELLGSVSTHWHEDRTAGIKWLNDQ-SISTYATTSTNHLLKENK----------------------------KEPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLSKILFGGCFVRSLDSEGLGYTG--EAHIDQWSRSAQNALSREAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQPNANASAD..................... 233
24 -33.9004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  14  33...................KHGLVVLVNAEAYLIDTPFTAKDTEKLVTYKIKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKKDGKVQATNS-----------------------------SGVNYWLVKNKIEVFYPPGHTPDNVVVWLRKILFGGGFIKPYGLGNLG-----DANIEAWPKSAKLLKSKKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSNWSHPQFEK............... 236
25 -33.8003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  22  5MTVKKLYFIPAGRCMLDHSVWCYLLETEEGPILVDTGMPESAVN-YEPDDLLYIISSHLHFDHAGGNGAF---TNTPIIVQRTEYEAALHREEYMKECIL-------------------PHLNYKIIEGDYEVVPG---VQLLYTPGHSPGHQSLFIESVLLTIDAS--TKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGH...................................................... 239
26 -33.7002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  22  3MTVKKLYFIPAGRCMLDHSVWCYLLETEEGPILVDTGMPESAVN-YEPDDLLYIISSHLHFDHAGGNGAF---TNTPIIVQRTEYEAALHREEYMK----------------------LPHLNYKIIEGDYEVVPG---VQLLYTPGHSPGHQSLFIKSVLLTIDAS--TKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGH...................................................... 237
27 -33.6005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  12  51...................SNGLIVRDGDELLLIDTAWGAKNTAALLAEPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEAEGNEIPTHSLEG-----------------------LSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVANVLYGGCAVLALSRTSAGNVA--DADLAEWPTSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVA............................. 247
28 -33.2002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  16  1.MGNKLFVLDLGEIRVDENVSAYLIQCTDATVLYDTGCHPECMG-LSPDDISTVVLSHLHNDHAGCVEYF---GKSRLIAHEDEFATAVRY-------FATGDHSSPYIVKDIEAWLATPRNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVR-FLLVSDAC--YTATNYGPPARRAGDTIGYDRTVSHIRQYAESTVLFGH...................................................... 259
29 -33.0002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  16  33...................SNGLVVLDNNQAYIIDTPWSEEDTKLLLSYQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGKPVPTHY-----------------------------KDDEFTLGNGLIELYYPAGHTEDNIVAWLSKILFGGCLVRSHEWEALGYVG--DASISSWADSIKNIVSKPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEASAD..................... 233
30 -32.7002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  13  36...................SNGLVLNTSKGLVLVDSSWDDKLTKELIEKRVTDVIITHAHADHIGGIKTLKER-GIKAHSTALTAELAKKNGYEEP---------------------------LGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLYNILVGGSLVKSTSAKDLGNVA--DAYVNEWSTSIENVLKRNINAVVPGHGEVGDKGLLLHTLDLLK..................................... 222
31 -32.6004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  11  69...................SNGLIVRDGDELLLIDTAWGAKNTAALLAEPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEAEGNEIPTHSLEG-----------------------LSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVANVLYGGCA--VLELSSTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVA............................. 265
32 -32.6005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  15  28..APGVRWLRMPLPFSLDHINLWLLRDEIDGTIVDCGISSEFDRHLDGLPVLRVLVTHCHPDHFGLANWLCERWNVRLWMTLGEGCLMAAGNGSNAGGAAAADHF-RSRRSYYSDLVPAVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALHSEAVLISGDMVLPRISTNVSDLEPEANPLALYLESLGRYETMAPDTVLPSHGKPFR-GVRTRIAQLRAHHDARLEEVRVACAEKPMSAAGIVPIM.......... 314
33 -32.5003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  12  31...................ANSMYLVTKKGVVLFDVPWEKVQYQSLMDLPVVAVFATHSHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKDGKATS---------------------------TEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFYNVLDGGCLVKSNSATDLGYI--KEANVEQWPKTINKLKAKKATLIIPGHDEWKGGGHVEHTLELLNKK................................... 219
34 -32.4001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  13  37...................SNGMIVINNHQAALLDTPINDAQTETLVNAKVTTFIPNHWHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEKGLPVP---------------------------EHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLENILFGGCMLKDNQATSIGNIS--DADVTAWPKTLDKVKAKSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSK............................. 231
35 -32.3001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  13  37...................SNGMIVINNHQAALLDTPINDAQTEMLVNAKVTTFIPNHWHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKGLPVP---------------------------EHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLENILFGGCMLKDNQTTSIGNIS--DADVTAWPKTLDKVKAKFPSYVVPGHGNYGGTELIEHTKQIVNQYIESTSK............................. 231
36 -32.2004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  14  34...................KHGLVVLVNTDAYLIDTPFTATDTEKLVNYKIKGTISSHFHSDSTGGIEWLNSQ-SIPTYASELTNELLKKDGKVQAKNS-----------------------------SGVSYWLVKNKIEVFYPPGHTQDNVVVWLKKILFGGCFVKPDGLGNLG-----DANLEAWPKSAKILMSKKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKPSQPS........................ 228
37 -32.0003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  12  36...................SSGLVLNTSKGLVLVDSSWDDKLTKELIEKRVTDAIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKNGY---------------------------EEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLYNILVGGCLVKSTSAKDLGNVA--DAYVNEWSTSIENVSKRNINAVVPSHGEVGDKGLLLHTLDLLK..................................... 222
38 -32.0005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  16  50...................SNGLVVLDNNQAYIIDTPWSEEDTKLLLSYQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGKPVPTHY-----------------------------KDDEFTLGNGLIELYYPAGHTEDNIVAWLSKILFGGCL--VRSHEREGLGYVGDASISSWADSIKNIVSYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEASAD..................... 250
39 -31.9002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  12  42...................SNGLVLNTSKGLVLVDSSWDDKLTKELIEKRVTDVIITHAHASRIGGIKTLKER-GIKAHSTALTAELAKKNGY---------------------------EEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLYNILVGGCLVKSTSAKDLGNVA--DAYVNEWSTSIENVLKRNINAVVPGHGEVGDKGLLLHTLDLLK..................................... 228
40 -31.9002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  11  69...................SNGLIVRDGDELLLIDTAWGAKNTAALLAEPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEVEGNEIPTHSLEG-----------------------LSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVASVLYGGCAIYELSRTSAGNVA--DADLAEWPTSIERIQQHYPEFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVV............................. 265
41 -31.9001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  21  14.....................MYLVIDDKEAAIVDPVQPQKVVDAARKHKLTTVLTTHHHWDHAGGNEKLVKLSGLKVYGGDDRIGALTHK-----------------------------------ITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKAVFTGDTLFVAGCGKFYEGTA-----DEMCKALEVLGRLPPDTVYCGH...................................................... 173
42 -31.4001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  15  27...................ANAVYLVTDKGVVVIDCPWGEDKFKSFTDKKVIMNIATHSHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKENKPRA---------------------------QYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFEKVLVGGCIIKSADSKDLGYIG--EAYVNDWTQSVHNIQQKGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKA............................. 221
43 -31.3002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  10  68...................SNGLIVRDADELLLIDTAWGAKNTVALLAEPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAEAAGNEVPAHSLKA-----------------------LSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVVRVLFGGCAVHEASRESAGNVA--DANLAEWPATIKRIQQREAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVA............................. 264
44 -30.8003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  12  49...................SNGLIVRDGGRVLVVDTAWTDDQTAQILNLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAA--------------------HSLTFAANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGITDIAFGGCLIKDSKAKSLGNL--GDADTEHYAASARAFGAAFPSMIVMSHSAPDSRAAITHTARMADKLRKLVPRGSAAAALE..................... 257
45 -30.7004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  20  68...................AEAALEEAARGPILVDTGGPWAREALVAPGDVTLVVGTHGHSDHIGNLGLF---PGAALLVSHDFCLP--------------------------------GRYLPHGLGEGQPLRLGP-GLEVWATPGHGGQRDVSVVVAVVVAGDVF--ERDGDEDSWQALSEDPAAQERSRKRVLVV-ADVVVPGHGPPFR................................................. 236
46 -30.7003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  14  26...................ENSMVYIGTDGITIIGATWTPETAETLYKLPINEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSIV-----------NFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLEAHTKDGIFVYFERVLYGNCIL--------NLGNMSFANRTEYPKTLEKLKGLKVDSIIAGHDTPIHDVGLIDHYLTLLEKAP................................. 232
47 -30.7002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  19  1.AMADIGSMNLNSIPAFQDNYIWVLTNDGRCVIVDPGEAAPVLKAIAEHMPEAIFLT----DHVGGVKELLQHFPQMTVYGPAETQD---------------------------------KGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSRPYLFCGDTLFSGGCGRLFEGTP-----SQMYQSLMKINSLPDDTICCAH------EYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKI 216
48 -30.3004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  16  58...................INAFLVNIGKSLILIDSGAASCF---YQPEQVDTILLTHLHPDHVCGISK-ANFPNATVYVSNDEASFWLDPKQAAKLPKEKQANYLGTVEKIKQAIAPYQAKQRFKTYKLGDDIQG---FKVINTAGHTPGHFSYELKTIVFIGDIVHSHTVQFDRPETAIEYDIDPKKAVETRLKQFANFAIAAPHLPFPGIGHTYSADGKSYQWIPI................................ 287
49 -30.2004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  13  48...................SNGLIVRDGGRVLVVDTAWTDDQTAQILNLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVA-------------------AQHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGITDIAFGGCLIKDSKAKSLGNL--GAADTEHYAASARAFGAAFPSMIVMSHSAPDSRAAITHTARMADK.................................... 241
50 -30.0003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  13  42...................SNGLIVRDGGRVLVVDTAWTDDQTAQILNLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVA-------------------AQHSLTFAANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGITDIAFGGCLIKDSKAKSLGNLG--DADTEHYAASARAFGAAFPSMIVMSHSAPDSRAAITHTARMADK.................................... 235
51 -29.9005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  13  48...................SNGLIVRDGGRVLVVDTAWTDDQTAQILNLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVA-------------------AQHSLTFAANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGITDIAFGGCLIKDSKAKSLGNL--GDADTEHYAASARAFGAAFPSMIVMSHSAPDSRAAITHTARMADKLRL................................. 244
52 -29.8004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  13  51...................SNGLIVRDGGRVLVVDTAWTDDQTAQILNLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVA-------------------AQHSLTFAANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGITDIAFGGCLIKDSKAKSLGNL--GDADTEHYAASARAFGAAFPSMIVMSHSAPDSRAAITHTARMADK.................................... 244
53 -29.7002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  16  22.......AFSVTVVPTLKDNFSYLINDHHTLAAVDNADYKPILTYIEEHTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVP--------------------VVVGGANDSIPAVTKP--------VREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHALFTGDTMGAFFEG----------DEKDMCRAMEKVYHIKVTFIFPGH--KTFPDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADP. 282
54 -29.7004tyf_A mol:protein length:231 NDM-4  ali model follow..  13  36...................SNGLIVRDGGRVLVVDTAWTDDQTAQILNLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGLVA-------------------AQHSLTFAANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGITDIAFGGCLIKDSKAKSLGNL--GDADTEHYAASARAFGAAFPSMIVMSHSAPDSRAAITHTARMADK.................................... 229
55 -29.4001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  16  23...................ENSMVYFGAKGVTVVGATWTPDTARELHKKPVLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDW------AEIVAFTRKGLPEYPDLPLVLPN---VVHDGDFTLQEGKVRA-FYAGPAHTPDGIFVYFEQVLYGGCIL------KEKLGNLSFADVKAYPQTLERLKALPIKTVIGGHDSPLHGPELIDHYEALIKAAP................................. 225
56 -29.2004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  13  75...................SNGLIVRDGGRVLVVDTAWTDDQTAQILNLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVA-------------------AQHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGITDIAFGGCLIKDSKAKSLGNL--GDADTEHYAASARAFGAAFPSMIVMSHSAPDSRAAITHTARMADKLRLV................................ 272
57 -28.0003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  15  48...................THPILIQTAQYNLIIDAGIGNGKLS-LTPKDIDYVLMTHMHFDHAAGLTD-AIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGD--------------SNKLILFEKHFEPVPG---IKMQHSGGHSFGHTIITIDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQFLFYHDENYFAVKYSDDGENID..................................... 268
58 -28.0004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  14  59...................INILLVKTKEKLILMDTGMGIFADE-FSAHDITDIFLSHAHPDHIGGVVD-LVFPNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQNILKQPKLKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTIEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLAAFTSHLPWPGLGFTKV........................................... 280
59 -27.9003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  15  17....................ASYLVGCQEEACVIDPARDVEPYLLTAKRRIVAALETHIHADFVSGAREMADRAGAAICVSDEGPP----------------------------KSEYVKAYPHRLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDALFSGDFVFVLLERVAGESGSSEALARQMFRSLRKFEALPDHVVLPAHGAGSACGKALGAVPSSTVGYEKLVNWALQHKDEDAFVQALLAGQPE........ 245
60 -27.6003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  16  32....................ASYLIGCQKEAMIIDPIRDLSSYIRVADEEITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLG---------------------------YKNMPNHTHFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDGLFSGDFIFVLLEKAVKVEGSSEIGAKQMFKSIESIKDLPDYIIWPGHGAGSPCGKSLGAIPTSTLGYEKQTNWAFSENNEATFIDKLISDQPA........ 259
61 -27.5004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  18  11...........AFYDEATSTISYLVMDTRQCALIDSGRTCSASADRLVESVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAH--------------ITQVQKVFGALFN-AEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIEDAVFVGDTLFMPDYGT-ARCDFPGADARTLYRSIRRLLAFPDQTLFMCH...................................................... 212
62 -27.3004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  20  89...................VNAYLINTGDNLVLIDTGAAQCF---YQPEQVDTVLLTHLHPDHACGLVN-PAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVAP----AKMNKLKPYKTEGELLPG---VSLVASPGHTPGHTSYLFKSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAAVAGAHLPFPGLGHVRK........................................... 305
63 -27.2004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  20  89...................VNAYLINTGDNLVLIDTGAAQCF---YQPEQVDTVLLTHLHPDHACGLVN-PAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAP----AKMNKLKPYKTEGELLPG---VSLVASSGHTPGHTSYLFKSLLVWGDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAAVAGAHLPFPGLGHVRE........................................... 305
64 -27.2004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  17  9...........GFFDPATCTISYLLFDSGECALIDSGRTRTASADQLIARVRWLLETHVHADHLSAAPYLKTRVGGEIAIGRH--------------VTRVQDVFGKLFN-AGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAAFVGDTLFMPDYGT-ARCDFPGGDARSLYRSIRKVLSLPPATLYMCH...................................................... 216
65 -27.1001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  18  97...................VTGYLVNTGSKLVLVDTGAAGLF---YQPEQVDEIYITHMHPDHVGGLGEQLAFPNAVVRADQKEADFWLSQTNLDKAPDDESKGFFKGAMASLNPY--VKAGKFKPFSGNTDLVPG---IKALASHGHTPGHTTYVVESLALLGDLILVAAVQFDDPSVTTQLDSDSKSVAVERKKAFADAAIAASHLSFPGIGHIRA........................................... 313
66 -27.0001vme_A mol:protein length:410 Flavoprotein  ali model follow..  18  47....................NAYLVKLNGANVLIDG---DALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTHDVEIIASNFGKRLLEG----------------------------YGIKDVTVVKDGEEREIGGKKFKFVMTP-HWPDTMVTYLDGILFSCDVGGGYIVTVIGHYKN------YILEGAEKLSSLKIKALLPGH-GLIWKKDPQRLLNHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKE. 286
67 -26.8004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  21  44....................NSYVIEGDK-TAIIDPPVESALQQTVNLKKLDYVILGHFSPNRIPTFKALLELPQITFVCSLPAAGDLRA-------------------------AFPDDNLNILPMRGKETLDLGGHVLKFLPIP-RWPAGLCTYDTQILYTDKIFGAYFNCLMAPHA------IHVEAALEKISDLQVRLYAVGHGPLVRTS............................................... 238
68 -25.2002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  14  26....MVRIFHGYHTDEGSSYNSYFIDDEC-PTVIDS---SRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKTNATFVCTKKCQEHLKI-------------------------LYGMEKATWLIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCDKILFSNDGFGQYTANILGLFSA------QMRKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARS. 283
69 -22.6002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  20  36....................NAYLVCGDEGVALIDN---EDALQQVGMERVDYIIQNHVEKDHSGVLVELHRRPEAPIYCTEVAVKGLL------------------------KHYPSLREAEFMTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLDGILFSNDAFGQFYANLITPLSK------LVLKKFDEVKELG-QMIAPSHG..................................................... 234
70 -21.8001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  21  36....................NAYLVEDEK-TTLFDT---CGIASVIDPKKIDYLVIQHLELDHAGALPALIEAQPEKIFTSSLGQKAMES-------------------------HFHYKDWPVQVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFEKVLISNDIFGQYYANIVNPYAP------QTLKAIETLAGVAPEFICPDHG..................................................... 227
71 -21.7001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  18  37....................NAYLIVDDK-TALVDT---AKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELPDAHVLCTQRAFDSLKA-------------------------HYSHIDFNYTIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVEALLLPNDAFGQYYANILMPFSN------LITKKLDEIINLAIKTIAPSH-GIIWRKDPGRIIEAYARWAEAVIAYDTMWLSTEKMAHALMDGLVA........ 278
72 -21.2004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  18  36....................NSYLIREEK-NVLIDT---QNLRNEIDLADIDYIVINHAEEDHAGALTELMAQPDTPIYCTANAIDSINGPE------------------------------NFNVVKTGDTLDIGGKQLIFVETP-HWPDSMMTYLDAVLFSNDAFGQYYANILTPFSR------LVTPKITEIFNLPVDMIATSH-GVVWRDNPTQIVELYLKWAAITIFYDTMSNNTRMMADAIAQGIAE........ 274
73 -20.0003g1p_A mol:protein length:258 Protein phnP  ali model follow..  15  34..............QYRRQPCSGVVKFNDAITLIDAGLHDLADRW-SPGSFQQFLLTHYHMDHVQGLFPLRWGVGDPIPVYGPPDEQGCD-------------------------KHPGLLDFSHTVEPFVVFDLQGLQVTPLPL--HSKLTFGYLLERVAWLSDTAGLVMDCSHPPRADAPRNHCDLNTVLALNQVIRSPRVILTH...................................................... 222
74 -19.8001ww1_A mol:protein length:280 tRNase Z  ali model follow..  13  1..........MNIIGFSKALFSTWIYYSPERILFDAGEGVSTTLGSKVYAFKYVFLTHGHVDHIAGLWGVVNIRNNGM-GDREKPLDVFYPEGNRAVEEYTEFIRANPDLRFSFNVHPLKEGERVFLRNAGGFKRYVQPFRTKHVSSEVSFGYHIFEVRLTISGDSL-IHECTFLDARDRRYKNHAAIDEVMESVKAAGVKKVILYHISTRYIRQLKSVIKKYRE.................................... 262
75 -19.6003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  12  32....................GSLMLTYDNHSIQVDP---SEYADYTTFPKADIILITHEHGDHLDPKAQAVEKSDTEIIANENSQKKLGKGKVLKNG--------DTDTSISYMKIEAVPAYNTTPGRDK------------YHPRHRDNGYILTFDGLRVYAGDTEDIPEMKDLKDIDIAFLPVNTVSQAAKAARMFSPKILYPYHYGDTKIGELKDALKD....................................... 218

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 5 7 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.