current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3aj3_A mol:protein length:274 4-pyridoxolactonase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYGLast
1 -108.0003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model  100  1MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYG 268
2 -88.8003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  29  5MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHRE------------------------EYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDE-VPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI. 254
3 -88.6002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  29  3MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHRE------------------------EYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDE-VPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI. 252
4 -81.1002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  24  1MG-NKLFVLDLGEIRVDENFIIANSTSSRLIDIPVSAYLIQCTDATVLYDTGCHPECMGTNGRWAPYIGASECNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRNWDL----------VGRDERERELAPGVNLLFGTGHASGMLGLAVRLEKQPGFLLVSDACYTATNYGPPARRAVLHDTIGYDRTVSHIRQYAESRSLTVLFGHDREQFASLIKSTDGF. 274
5 -61.4003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  20  3IGDISIHYLNGGNTKMDGGAMFYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGKLSEKQLRN---VDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSN------------------KLILFEKHFEPVPGIKMQHSGGHSFGHTIITIE-SQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDE.............. 253
6 -59.6001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  19  4DKIMELKILVTGGNVFV---------PGRLNAHFSTVVYLEHKDRRIIIDPGNLSSM---------------DELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWK-------------------NVVLLKGEESFDEKVKVFHTPWHAREHLSFLLDTENAGRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVGRID--------LLVFPHDAPLKPEVKK...... 215
7 -50.6004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  20  16GDPYSVVVLLQGYAEPEGVGDAVRADESPRGSGGAEAALEEAARGPILVDTGGPWA---------------REALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGE----------------------------------GQPLRLGPGLEVWATPGHGGQRDVSVVVATALGTVVVAGDVFERDGDED--SWQALSEDPAAQERSRKRVLVVAD----VVVPGHGP.............. 233
8 -46.8004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  17  11LGELELFILTDGYIHEENLISFAPRGNVAELDMAINILLVKTKEKLILMDTGMGIF-----------ADERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVLVFPNASIFISKIEHDFWINASIKDFN---NSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNKTLYSHFNFQLAPGHTPGLTVTTIS-SGNEKLMYVADLIHSDV--HPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLP--LGFTKVKAPGFE 286
9 -45.4004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  17  11AGDVQITALLDGTNFMSPNLFKDIPDQEKGVQTSINAFLVNIGKSLILIDSGAAS------------FGSHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGIANFPNATVYVSNDEASFWLDPKQAAKLPKEKQANYLGTVEKIKQAIAPYQAKQ----RFKTYKLG-DDIQGFKVINTAGHTPGHFSYELK-TKGESIVFIGDIVHSHT--RPETAIEYDIDPKKAVETRLKQFANFAKNGQTIAAPHYSADGKSYQWIPIHFK 290
10 -43.7004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  18  42LGDFEVTALYDGYVDLPASLLKGIDDKDKGVQTAVNAYLINTGDNLVLIDTGAAQ------------FGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVAP---------AKMNKLKPYKTEGELLPGVSLVASPGHTPGHTSYLFK-SGGQSLLVWGDILLNHA--KPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLP--LGHVRKEAQGYA 311
11 -43.6004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  18  42LGDFEVTALYDGYVDLPASLLKGIDDKDKGVQTAVNAYLINTGDNLVLIDTGAAQ------------FGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAP---------AKMNKLKPYKTEGELLPGVSLVASSGHTPGHTSYLFK-SGGQSLLVWGDILINHA--KPEVVWEFDVDSDQARQSRQRILAEAATDKLWVAGAHLP--LGHVREEAQGYA 311
12 -43.1001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  17  52LGDFEITALSDGTVALKTQSALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAG------------FGPTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLLAFPNAVVRADQKEADFWLSQTNLDKA-------PDDESKGFFKGAMASLNPYVKAGKFKPFSGNTDLVPGIKALASHGHTPGHTTYVVE-SQGQKLALLGDLILVAA--DPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIAASHLS--IGHIRAEGKGYR 319
13 -38.4004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  19  58..................................ISALLVTSDAGHILVDAATP---------------QAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQGAPVYARAPAIDTLKRGLPDRT-----------------------DPQFEVAEPVAPVANIVTLADDLTAVASPGHTPGGTSWTWRSCEGDDQMVYADSLTADDVYRYSDDAAHPGYLAAFRNTLARVAALDCD---ILVTPH................ 250
14 -38.2004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  19  58..................................ISALLVTSDAGHILVDAATP---------------QAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQGAPVYARAPAIDTLKRGLPDRT-----------------------DPQFEVAEPVAPVANIVTLADDLTAVASPGHTPGGTSWTWRSCEGDDQMVYADSLTADDVFRYSDDAAHPGYLAAFRNTLARVAALDCD---ILVTPH................ 250
15 -37.8002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  18  36..................................VPVFLLRLGESWALVEGGISRDA---------------ELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPRLPNVQVLASERTCQAWKSESAVRVV-------ERLNRQLLRAEQRLPEACAWDALPVRAVADGEWLELGLQVIEAHGHSDDHVVFYDVRRR---RLFCGDALGEFDEAEGVWRPLVFDDMEAYLESLERLQRLPTL--LQLIPGH................ 235
16 -37.6001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  17  38..................................LTALLVQTPDGAVLLDGGMP---------------QMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADR------------------IVMDGEVITVGGFTAHFMAGHTPGSTAWTWTDTRNGRIAYADSL--SAPGYQLQGNPRYPHLIEDYRRSFATVRALPCD---VLLTPH................ 225
17 -37.2003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  21  55..................................IAVYVIKTSQGLILMDTAMP---------------QSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKGAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKVDR------------------AVKEGDRVTLGDLTAHATPGHSPGCTSWEMTVKDGKEVLFFCSGTVALNRLVGQ--PTYAGIVDDYRATFAKAKAMKID---VLLGPH................ 242
18 -37.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  19  1MPCRGLHSIPAGPVEFPEI---------------ATVYVMCGEKLTVMIDAGVSNSIAD------------------------SFLDKLDYIVLTHLHIDHIGLLPELYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKLDQD-----KVIEVEGNEEFDLGMRLIYTPGHARHHMSVLVD------FLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPK---VVGFAH................ 207
19 -36.8001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  17  25..................................LASYLIVTPRGNILINSDLEANV---------------PMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKKAKYMVMDEDVSVILSGGKSD-----------------------FHYANDSSTYFTQSTVDKVLHDGLTAHLTPGHTRGCTTWTMKLKDHGKQAVIIGSIGVNPGYKLVDNITYPKIAEDYKHSIKVLESMRCD---IFLGSH................ 215
20 -35.7005aeb_A mol:protein length:272 LRA-12  ali model follow..  17  38..................................LACYLITTKQGNIIVNTGLA---------------ASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKGAKLMADEGDATVMADGGSSDYAFG------------------------GHGSMFEPIIADRLLHDKLVMLHHPGHTKGSCSFLFDTKDEQRILIANMPTIVIEK-KFSEVSSYPGIAKDYAYTLQAMKNLSFD---IWVASHASQF............ 231
21 -35.6005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  19  31..................................LSSVLVTSPQGHVLIDGGLPESA---------------PKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQNALVAASPSAALDLASGEVGPD-----------------------DPQYHALPKYPPVKDMRLARDGLTAHATPGHTPGGLSWTWQSCDGPMVYADSINAVSRPGFKFSASSEYPNALADLRHSFETLEKLPCD---VLISAH................ 223
22 -34.9003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  16  26..................................ISAVLLSSPQGHILVDGTTEKGA---------------QVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQGATVLAGAANVDTLRTGV----------------SPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPVKAHATPGHTEGGITWTWQSCEQG---KCKDVVFADSLTAVSADSYRFSDHPEVVASLRGFEAVEKLSCDIAIAAHPEVN............ 219
23 -29.9002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  19  12.............................PVPIPVNLYLLQGAGEVALVDTALGTR-------------AARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGARVFLHEEEFARGHAFAEASWRLFLDHGTPEGALQGIRETVEKTRERVHPPQNPLPLRDGEALEVALRVLWTPGHADGHAAFYLEEEG---VLLAGDALLEKVSPNVGLWAYTRENPLKDF--LRSLDRLADLGARVAYAGHF............... 234
24 -28.5002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  17  1...........GMKSLHRPDLYSWSTFNPARNIDFNGFAWIRPEGNILIDPV-----------------ALSNHDWKHLESLG----GVVWIVLTN---DHVRSAKEIAYTKIAGPVAEKENFPIYCD------------------------------------RWLSDGDELVPGLKVMELQGKTPGELALLLE----ETTLITGDLVRAYRAGGLEILPDEKLNKQKVVASVRRLAALEKVE--AVLVGD................ 181
25 -28.5002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  19  11................................LQENAYLVETGEGPVLIDPG-----------------DEPEKLLALFQTTGLIPL---AILLTHAHFDHVGAVAPLVDLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLPVRPLEEGMRLF---------------------GFQVLHLPGHSPGHVAFYDPEGA---QVFSGDLLFRGSVGRYDLPGA---DPKALFASLKRLLSLPPE--TRVHPGHGPGTTLGLEARTNPF. 199
26 -25.5005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  15  24.GEVRLYQIADGVW------SHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA--------------KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGVDVLRGVATYASPSTRRLAEAEGNEIPTHSLEGLSS---------------------------SGDAVRFGPVELFYPAAHSTDNLVVYVPSAN---VLYGGCAVLALSR--TSAGNVADADLAEWPTSVERIQKHYPEAEV-VIPGHGLPGGLDLLQHTANV. 237
27 -24.7004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  16  42.GEVRLYQIADGVW------SHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA--------------KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGVDVLRGVATYASPSTRRLAEAEGNEIPTHSLEGLSS---------------------------SGDAVRFGPVELFYPAAHSTDNLVVYVPSAN---VLYGGCAVLELSS--TSAGNVADADLAEWPTSVERIQKHYPEAEV-VIPGHGL.............. 242
28 -24.3002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  13  41.GEVRLYKIGDGVW------SHIATQKLGDTVYSSNGLIVRDADELLLIDTAWGA--------------KNTVALLAEIEKQ--IGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAA--------------------------NEVPAHSLKALSSSGDVVRFGPVEVFYPAAHSGDNLVVYVPAVR---VLFGGCAVHEASR--ESAGNVADANLAEWPATIKRIQQRYPEAEV-VIPGHGL.............. 241
29 -23.9002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  15  42.GEVRLYQIADGVW------SHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA--------------KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSS-------------------------SGDAVRFGPVELFYPAAHSTDNLVVYVPSAS---VLYGGCAIYELSRTSAGNVA--DADLAEWPTSIERIQQHYPEAQF-VIPGHGLPGGLDLLKHTTNV. 255
30 -23.8002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  14  9.GTISISQLNKNVW------VHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDD--------------KLTKELIEMVEKKFQKR--VTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKK---------------------------NGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN---ILVGGSLVKSTSA--KDLGNVADAYVNEWSTSIENVLKRYRNINA-VVPGHGE.............. 207
31 -23.2003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  15  30......................................VYIGTDGITIIGATWTP--------------ETAETLYKEIRKVSPLP--INEVINTNYHTDRAGGNAYWKGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPD--------------TVFPGDFNLQNGIRAMYLEAHTKDGIFVYFPAER---VLYGNCILKENL---GNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDT.............. 213
32 -23.2003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  13  9.GTISISQLNKNVW------VHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDD--------------KLTKELIEMVEKK--FQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKK---------------------------NGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN---ILVGGCLVKSTSA--KDLGNVADAYVNEWSTSIENVSKRYRNINA-VVPSHGE.............. 207
33 -23.0004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  18  5.PDLKIEKLDEGVY-----VHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEK------------------VTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKK---------------------------DGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERK---ILFGGGFIKPYG----------DANIEAWPKSAKLLKSKYGKAKL-VVPSHSE.............. 199
34 -23.0002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  13  15.GTISISQLNKNVW------VHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDD--------------KLTKELIEMVEKK--FQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKK---------------------------NGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN---ILVGGCLVKSTSA--KDLGNVADAYVNEWSTSIENVLKRYRNINA-VVPGHGE.............. 213
35 -22.9004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  15  20.GDLVFRQLAPNVWQHTSYLDMPGFG-----AVASNGLIVRDGGRVLVVDTAWTD--------------DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNF---------------------GPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKA--KSLGNLGAADTEHYAASARAFGAAFPKASM-IVMSHSAPDSRAAITHTARM. 238
36 -22.8001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  14  1.AGMSLTQVSGPVYVVEDNY------------VQENSMVYFGAKGVTVVGATWTP--------------DTARELHKLIKRVSRKP--VLEVINTNYHTDRAGGNAYWKGAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPLVLPN--------------VVHDGDFTLEGKVRAFYAPAHTPDGIFVYFPDEQ---VLYGGCILK------EKLGNLSFADVKAYPQTLERLKAMKLPIKT-VIGGHDS.............. 206
37 -22.7004tyf_A mol:protein length:231 NDM-4  ali model follow..  13  3.GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTD--------------DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANA---------------------LSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKA--KSLGNLGDADTEHYAASARAFGAAFPKASM-IVMSHSAPDSRAAITHTARM. 226
38 -22.6005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  13  20.GDLVFRQLAPNVWQHTSYLDMPGFG-----AVASNGLIVRDGGRVLVVDTAWTD--------------DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANA---------------------LSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKA--KSLGNLGDADTEHYAASARAFGAAFPKASM-IVMSHSAPDSRAAITHTARM. 238
39 -22.6004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  15  23.GDLVFRQLAPNVWQHTSYLDMPGFG-----AVASNGLIVRDGGRVLVVDTAWTD--------------DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNF---------------------GPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKA--KSLGNLGDADTEHYAASARAFGAAFPKASM-IVMSHSAPDSRAAITHTARM. 241
40 -22.5004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  12  5.PELRIEKVKENIF-----LHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSD--------------RDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIKWLNDQSISTYATT----------------------STNHLLKENKKEPAKYTLKGNESTLVDGLIEV-----FYPGGGHTIDNVVVWLPKSK---ILFGGCFVRSLDS--EGLGYTGEAHIDQWSRSAQNALSRYSEAQI-VIPGHGK.............. 202
41 -22.4004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  13  38.....................................VAKMLDGTVVIVSSPFEN--------------LGTQTLMDWVAKT--MKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKR----RILSSHPVPADNVFDLKQGKVFSFSNELVEVPAHSPDNVVVYFPKKK---LLFGGCMIKPKE----------DANVKAWPDSARRLKKFDAK---IVIPGHGEWGGPEMVNKTIKV. 240
42 -22.4003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  13  14.GDLVFRQLAPNVW-----QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTD--------------DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANA---------------------LSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKA--KSLGNLGDADTEHYAASARAFGAAFPKASM-IVMSHSAPDSRAAITHTARM. 232
43 -22.1002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  12  5.KPLEVIKIEDGVY-----LHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKL------------------LSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSE----------------------LTKKLLAREGKPVPTHYFKDDEFTLGNGLIEL-----YYPGAGHTEDNIVAWLPKSK---ILFGGCLVRSHEW--EALGYVGDASISSWADSIKNIVSKKYPIQM-VVPGHGK.............. 202
44 -22.0003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  15  21.GDLVFRQLAPNVWQHTSYLDMPGFG-----AVASNGLIVRDGGRVLVVDTAWTD--------------DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNF---------------------GPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKA--KSLGNLGDADTEHYAASARAFGAAFPKASM-IVMSHSAPDSRAAITHTARM. 239
45 -22.0004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  13  47.GDLVFRQLAPNVWQHTSYLDMPGFG-----AVASNGLIVRDGGRVLVVDTAWTD--------------DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMDALHAAGIATYANA---------------------LSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTD---IAFGGCLIKDSKA--KSLGNLGDADTEHYAASARAFGAAFPKASM-IVMSHSAPDSRAAITHTARM. 265
46 -21.8004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  17  6.PDLKIEKLEEGVY-----VHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTA--------------TDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKK---------------------------DGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKK---ILFGGCFVKPDG----------DANLEAWPKSAKILMSKYVKAKL-VVSSHSE.............. 200
47 -21.7003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  13  17....................IYKTFGVFGGKEYSANSMYLVTKKGVVLFDVPWEK--------------VQYQSLMDTIKKRHNLP--VVAVFATHSHDDRAGDLSFFKGIKTYATAKTNEFLKKDGKATST--------------------------------EIIKTGKPYRIGGEEFVVEGHTADNVVVWFPKYN---VLDGGCLVKSNSA--TDLGYIKEANVEQWPKTINKLKAKYSKATL-IIPGHDE.............. 202
48 -21.6001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  13  1..DVKIEKLKDNLY------VYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGE--------------DKFKSFTDEIYKKHGKK--VIMNIATHSHDDRAGGLEYFGGAKTYSTKMTDSILAKENKPRAQ--------------------------------YTFDNNKSFKVGKSEFQVKGHTADNVVVWFPKEK---VLVGGCIIKSADS--KDLGYIGEAYVNDWTQSVHNIQQKFSGAQY-VVAGHDD.............. 198
49 -21.6002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  15  4SGSVEVQVLIENVVFARNFVAEHG------------SLLLKKGNKEIVVDTG------------------QSENFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLPEVKIYTHKEILNKKYAMRKGGQFEEIGFD---------------LSFYEKYKNNFVLIDKDAEIEEGFYVITIPDKFLDEVFVVVKEED-GINVVTGCSHAGILNI-KSLIGGFHLRGMEEEKVKDIARKIEEYGVKKVLTGH................ 249
50 -21.3001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  14  9.DDISITQLSDKVY-----TYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPIND--------------AQTETLVNWVADSLHAK--VTTFIPNHWHGDCIGGLGYLKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMP-----------------------------LQCYYLGGHATDNIVVWLPTEN---ILFGGCMLKDNQA--TSIGNISDADVTAWPKTLDKVKAKFPSARY-VVPGHGD.............. 208
51 -21.1005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  12  22.KPLEVIKIEDGVY-----LHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKL------------------LSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSE----------------------LTKKLLAREGKPVPTHYFKDDEFTLGNGLIEL-----YYPGAGHTEDNIVAWLPKSK---ILFGGCLVRSHER--EGLGYVGDASISSWADSIKNIVSKKYPIQM-VVPGHGK.............. 219
52 -21.1001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  14  9.DDISITQLSDKVY-----TYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPIND--------------AQTEMLVNWVTDS--LHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQ---------------------MTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQC-----YYLGGGHATDNIVVWLPTEN---ILFGGCMLKDNQT--TSIGNISDADVTAWPKTLDKVKAKFPSARY-VVPGHGN.............. 208
53 -21.0005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  13  35.............................RMPLPINLWLLRDQAGWTIVDCGISS--------------EAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCNVRLWMTLGEYMFGCLMAAGNGSNAGGAAAADHFARHGLTDPAALDKLRSRRSYYSDLEGDAVKIGA-RVVTGYGHSPEHCALH---SEADGVLISGDMVRISTNVSVFDLEPEANPLALYLESLGRYETM--APDTLVLPSHG............... 272
54 -19.6002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  18  30......................................TLKDNFSYLINDHTTHTLAAVDVNADYKPILTEEHLKQQGNADVTYT---FSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVVGG----------------------------ANDSIPAVTKPVREGDRVQVGDVEVIDAPCHTRGHVLYKVQHPNDGVALFTGDTMFIAG---------FEGDEKDMCRAMEKVYHIALDKVTFIFPGHE............... 221
55 -19.4004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  22  19..................................TFTYLLGDRESRVLID----------------PVLETAPRDAQLIKELGLR---LLYAVNTHCHADHITGSGLLRSLL-----------------------------------PGCQSVISRLSGAQADLHIEDGDSIRFGRFALRASPGHTPGCVTFVL---NDHSMAFTGDALLIRGCGRTDFQQG---CAKTLYHSVHE-KIFTLPGDCLIYPAHD............... 180
56 -19.3004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  21  19.....................VLGCNPGPMTLQGTNTYLVGTGPRRILIDTG-----------------AIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEII-----------------------GNGEQQYVYLKDGDVIKTEGLRVLYTPGHTDDHMALLLEEEN---AIFSGDCILGEGT-------TVFEDLYDYMNSLKELLKIKAD---IIYPGHGPVIHNAEAKIQQYIS 216
57 -18.8001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  24  13...................................YAYILHDEDTVGVVDPS------------------EAEPIIDSLKRSGRN---LTYILNTHHHYDHTGGNLELKGAKVIGSAMDKDRI------------------------------------PGIDMALKDGDKWMFAGVHVMDTPGHTKGHISLYFP---GSRAIFTGDTMFSLS---------FEGTPKQMLASLQKITSLPDD--TSIYCGHE............... 170
58 -18.7002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  18  15..................................TFTYLLHPDKPALLID----------------PVDKTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGTGLLKTKL-----------------------------------PGVKSVISKASGSKADLFLEPGDKVSIGDIYLRATPGHTAGCVTYVTG-QPQPRMAFTGDAVLIRGCGRTDFQEG---SSDQLYESVHS-QIFTLPKDTLIYPAHD............... 184
59 -18.7002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  15  11................................FSQNCSLIEQTRLAALVDPG-----------------GDAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVT----------------LQVLHCPGHTPGH---VVFFDEQSQLLISGDVIFKGGVGRSDFPRG---DHTQLIDAIKR-KLLPLGDDVTFIPGHGPLSTLGYERLHNPF. 207
60 -18.4001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  17  8......................................ALTDNYMYLVIDDETKEAAIVDP--------VQPQKVVDAARKHGVK---LTTVLTTHHHWDHAGGNKLESGLKVYGGDDRIGALTHK---------------------------------------ITHLSTLQVGSVKCLATPCHTSGHICYFVSKPGGSPAVFTGDTLFVAG---------YEGTADEMCKALLEVLG-RLPPDTRVYCGHE............... 174
61 -18.4004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  22  13..................................TYTYLIGDEATRVLID----------------PVLEQVDRDLQMVAELDLT---LTHVFDTHVHADHITASGALREATVVGSVNGASCA---------------------------------------NVQVRHGDEVRVGQLVFLATPGHTDDSISYLL-----GDRVFTGDALLVRGNGRTDFQNG---NASQLYDSLTR-VLFTLPDETLVYPGHD............... 171
62 -17.4003h3e_A mol:protein length:267 uncharacterized protein Tm1679  ali model follow..  16  28....................................SVLVDS----VLFDTG------------------KSDVFLKNARKLGIDL--PKDVLISHGHYDHAGGLLYLSGKRVWLRKEALDQKYSGERYAGADWNEVL--------------------YYNTGKFVIERITEIGKNMFLLGRKDLFEDEQTLVVRTKEGLVVIILLDIAETFNERIKMVVGGFHLLKSSDDEIEKIVKAFNELGVETVVPCH................ 230
63 -17.4002ycb_A mol:protein length:636 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  15  186...........................GGFREVGRSCLYLQTPNSRVLLDCGVNVAG------------GDDKNSYPYLNVPEFTLDSLDAVIITHAHLDHSGFLPYLYHYGY---DGPVYCTAPTRDLMTLLQLDHIDIAHREDEPLPFNVKHVKKSVKHTITLDYGEVTDIAPDIRLLHNAGHILGSAMAHLHIGDGQNMVYTGDFKYEQSRLLEAAANRFPRIETLVMESVKTIYSTLRRGGKILIPVFAVGRAQEL........ 424
64 -17.4001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  17  17.NAMKMTVVGFGGFPEAGE--------------ATSGYLFEHDGFRLLVDCGSG--------------------VLAQLQKY-ITPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTV--------------HPVTCFAMRIT-AGNDIVVYSADSSYIPEFIPFTKDADLFICECNMYANSTEVASIAKDANVELLLTH................ 229
65 -17.3003af5_A mol:protein length:651 Putative uncharacterized protein PH1404  ali model follow..  13  195...........................GGFREVGRSALLVQTDESFVLVDFGVNVAMLNDPYKAFPHFDAPEFQYV-------LREGLLDAIIITHAHLDHCGMLPYL-DGPIYTTPPTRDLM---------VLLQKDFIEIQQSNGQDPLYRPRDIKEVIKHTITLDEVRDISPDIRLLHNAGHILGSAIVHLHIGNGLNIAITGDFKFIPTRLLEPANAKFPRLETLVMESIEVIHNTIKRGGKVLIPAMAVGRAQEV........ 439
66 -17.2003g1p_A mol:protein length:258 Protein phnP  ali model follow..  12  2..SLTLTLTGTGGAQGVPAAACARARRSPQYRRQPCSGVVKFNDAITLIDAGL------------------------HDLADRWSPGSFQQFLLTHYHMDHVQGLFPL-----------------------RWGVGDPIPVYGPPDEQGCDDLFKHPGLLDFSHTVEPFVVFDLQGLQVTPLP-HSKLTFGYLLE-TAHSRVAWLSDTAGLPEKLRNNQPQVMVMDCSHPPTVLALNQVIRSPRVILTHISHQFDAWLMENALPSGF. 240
67 -16.3002xr1_A mol:protein length:640 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  17  190...........................GGCKEVGRSCFLLSTPESRILIDCGVNVGSDENMTPYLY-------------VPEVFPLNQIDAVIVTHAHLDHQGLVPLLFKYGY---EGPVYCTPPTRDLMVLLQLDYIDVAAKEGKKIPYESGMVAKTLKHTIPLDYEEVTDIAPDIKLFHNAGHILGSAISHFHIGDGLNVVFTGDYKYEKTRLFDPAVNKFPRVETVISEAQMVVKNTIERGGIAVIPAFAVGRSQEV........ 427
68 -15.5002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  14  10.DQLLIRPLGAGQ------------------EVGRSCIILEFKGRKIMLDCGIHPGL---------------EGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWF-KGRTFMTHATKAIY---------RWLLSDYVKVSNISADDMLYTETDLEESMDKIETINHEVKEVAGIKFCYHAGHVLGAAMFMIEIAGVK-LLYTGDILIIESTYGTHIHEKREEREARFCNTVHDI-ALGRAQELLLILDEYWQNHPELHDIPIYYA 271
69 -15.0002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  24  23.....................................VLTNDEGRCVIVDPG------------------EAAPVLKAIAEHKWMPEAI-------FLTDHVGGVQHFPQMTVYGPAET--------------------------------------QDKGATHLVGDGDTIRVLGFTLFATPGHTLGHVCYF-----SRPYLFCGDTLFSGG---------FEGTPSQMYQSLMKINSLPDD--TLICCAHE............... 169
70 -14.9003rpc_A mol:protein length:264 possible metal-dependent hydrolase  ali model follow..  12  1.......................SNAMTQYTHIRNATGKLTIKNTTFLIDPFLAPKDTYPGFEGTFNYQQRMPMVDLPLSMDDL--SNVTAVVVTHTHLDHTAINSIPKSLPIFVQNTADKELITSQGFIDVRIIFESLE---------------------------------FNGITLRKTGGHGTVEMGVIFEAADEPTVYLVGDTVWTSEKALLRFDPNVIIEDSIIMGTKDIGRMVVRKPEAKIIAVH................ 226
71 -14.9004ojv_A mol:protein length:369 3`,5`-cyclic-nucleotide phosphodiesterase 1  ali model follow..  10  1MVVFEITILGAN---------------GGPTEYGTQCFILKEDPELIAVDGGAGMYQLREMLVQGRNENEGDDELVNTMKKTYEVFQGITDYYITHPHLDHISGLVVNSPSIYEQENSKKKTIWGLPHTIDV---------QKHVFNDLIWPDLTAERSRKLKLKCLNVQKCTIFPWDVIPFKHHGIYSTFYIFRDRKSKCIIVCGDGILVECSCPLSSKPEQLYGHLSPIYLINELSNLNTLSGLNVIVTH................ 326
72 -14.8002dkf_A mol:protein length:431 metallo-beta-lactamase superfamily protein  ali model follow..  15  7...........................GAAREVTGSAHLLLAGGRRVLLDCGM-----------------QGKEEARNHAPFGFDPKEVDAVLLTHAHLDHVGRLPKL-RGPVYATRATVLLMEIVLEDALKVMDEPFFGPEDVEEALGHLRPLE-----------YGEWLRLGALSLAFGQAGHLPGSAFVVAQGEGRT-LVYSGDLGNREK-AEGTYGDRPHRPYRETVREFLEILEKTLSQGGKVLI.................. 220
73 -14.6002i7x_A mol:protein length:717 Protein CFT2  ali model follow..  11  17....................................GSVVRFDNVTLLIDPGWNPSK---------------VSYEQCIKYWEKVIPEIDVIILSQPTIECLGAHSLLYYTSHFISRIQVYATLPVINLGRVSTIDSYASAGVIGPYDTNKLDLEDIEISFDHIVPLKYSQLVDDGLTLLAYNGVCPGGSIWCISTYSEK-LVYAKRWNHTRDNI---------LNAASILDATGKPLSTLMRPSAIITTLDRFGSSQPFKKRSKIF. 230
74 -14.3002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  13  17...............................TIGGTVIEVAYKDAHIFFDFGTEFRPELDLPDDHIETLINNRLVPEEYHGAEDKDYQHTAVFLSHAHLDHSRMINYLDPAVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVD--------------HDYGASALLIRTPD-HFITYTGDLCEKAKHTELLMMEGVSISFPEREPDPAQIAVVSEEDNRQITFNGYPANVERFAK...... 270
75 -14.1004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  21  19..................................TISYLVMDRETRALIDSVLDYDPKSGRTC-----SASADRLVERVNELNAS---VRWVLETHVHADH------LSAAAYLKEKLGGHTAIGAHITQVQKVFGALFNAE------------PGFARDGSQFDVLDEEGFRIGNLRALHTPGHTPACMSFMIE-DAGEIAVFVGDTLFMPDYGTARC-PG---DARTLYRSIRRLLAFPDQ--TRLFMCHD............... 213

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 5 7 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.