current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPGIKMQHSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAYILRETLVDNNLast
1 -116.0003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model  100  1MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPGIKMQHSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAYILRETLVDNN 280
2 -77.1004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  16  9IKLGELELFILTDGYIHEENLISFRGNVAELKTILKDNFADHYIDMAINILLVKTKEKLILMDTGMGI----------FADERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLVFPNASIFISKIEHDFWINASIKDFNNALQNILKAIQPKLKFYDLNKTLYSHFNFQLAPGHTPGLTVTTISSGNEKLMYVADLIDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKVKAPGFEWIP......... 289
3 -74.6004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  18  9YQAGDVQITALLDGTNFMSPNLFKDIPQQQVHEILKKYDQEKGVQTSINAFLVNIGKSLILIDSGAAS----------CFGSHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISK-DGVANFPNATVYVSNDEASFWLDPKQAAKLPKIKQAIAPYKQRFKTYKLG-DDIQGFKVINTAGHTPGHFSYELKTKGESIVFIGDIVHTVQFDRPETAIEYDIDPKKAVETRLKQFANFAKNGQTIAAPHLPFPGIGHTYSDGKSYQWIP......... 286
4 -73.5004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  21  40MALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMASEKGVQTAVNAYLINTGDNLVLIDTGAAQ----------CFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPMAQQAVAPYMNKLKPYKTEGELLPGVSLVASPGHTPGHTSYLFKSGGQSLLVWGDILHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVPVEFSPIRSD 323
5 -73.3004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  22  40MALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMASEKGVQTAVNAYLINTGDNLVLIDTGAAQ----------CFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPMARQAVAPYMNKLKPYKTEGELLPGVSLVASSGHTPGHTSYLFKSGGQSLLVWGDILHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVREEAQGYAWVP......... 314
6 -72.0001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  21  50MLLGDFEITALSDGTVALPVDKRLNQPAPKTQSALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAG----------LFGPTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMV-GEQLAFPNAVVRADQKEADFWLSQTNLDKAPGAMASLNPYAGKFKPFSGNTDLVPGIKALASHGHTPGHTTYVVESQGQKLALLGDLIAAVQFDDPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIAASHLSFPGIGHIRAEGKGYRFVP......... 322
7 -61.4003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  20  1..MSDTKVYLLDGGSLVLDGYHVF-----------WNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFE--QEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGN------KYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAATFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDM........................... 254
8 -51.2002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  20  1MDMTVKKLYFIPAGRCMLDHSSVNS-----------ALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGN------GAFTNTPIIVQRTEYEAALHREEYMKECILPHL------NYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKEQSGSVLLTIDASYTKENFEDE-VPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDI........................... 239
9 -51.1003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  20  3ISMTVKKLYFIPAGRCMLDHSSVNS-----------ALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGN------GAFTNTPIIVQRTEYEAALHREEYMKECILPHL------NYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIEEQSGSVLLTIDASYTKENFEDE-VPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDI........................... 241
10 -51.0001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  17  21.......................................PGRLNAHFSTVVYLEHKDRRIIIDPGNLS--------------SMDELEEKFSELGISPDDITDVLFTHVHLDHIFNS------VLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHTPWHAREHLSFLLDTENARVLITGDITPNRL-------SYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPLKPEVK..................... 214
11 -48.2004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  16  14VPGDPYSVVVLLQGYAEPEADGSVTLVLPQTRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPWAR--------------EALLGALAGQGVAPGDVTLVVGTHGHSDHIGNL------GLFPGAALLVSHDFCLPGGRYLPHGLGE----------------GQPLRLGPGLEVWATPGHGGQRDVSVVVAGTALVVVAGDVFERDG--DEDSWQALSEDPAAQERSRKRVLVVAD----VVVPGHGPPFRVLR..................... 239
12 -46.7002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  18  3.....NKLFVLDLGEIRVDENFIIA--NSTFVTPQKPTVSSRLIDIPVSAYLIQCTDATVLYDTGCHPECMGTQLNAPYIGASECNLPERLRQLGLSPDDISTVVLSHLHNDHAGCV------EYFGKSRLIAHEDEFATAVRYTGDHSSPYIVKDIEAWLDLVGRDERERELAPGVNLLNGTGHASGMLGLAVREKQPGFLLVSDACYTATNYGPPARRAG-HDTIGYDRTVSHIRQYAESRSLTVLFGHDR........................... 261
13 -31.7002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  14  1..MGSSSSGLVPRGSHML-------SAPGQLDDDLCLLGDVQ-----VPVFLLRLGESWALVEGGISR--------------DAELVWADLCRWVADPSQVHYWLITHKHYDHCGLL--PYLCPRLPNVQVLASERTCQAWKSESAVRVVERLNRQLLRAEQPVRAVADGEWLELGLQVIEAHGHSDDHVV--FYDVRRRRLFCGDALGEFDEAEGVWRPLVFDDMEAYLESLERL--QRLPTLLQLIPGH............................. 235
14 -30.8004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  12  58...............................................ISALLVTSDAGHILVDAATPQ--------------AGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKAT---GAPVYARAPAIDTLKRGLPDRTDPQFEVAEPAPVANIVTLADDGVVSVGLTAVASPGHTPGGTSWTWEGDDCRQMVYADSLTAISDDVYRYS-DDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRA............... 264
15 -30.8005aeb_A mol:protein length:272 LRA-12  ali model follow..  12  35............................................TYDLACYLITTKQGNIIVNTGLAA--------------SALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKIT---GAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIADRLLHDKDTIQLGLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDG.............. 242
16 -30.5004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  12  58...............................................ISALLVTSDAGHILVDAATPQ--------------AGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKAT---GAPVYARAPAIDTLKRGLPDRTDPQFEVAEPAPVANIVTLADDGVVSVGLTAVASPGHTPGGTSWTWEGDDCRQMVYADSLTAISDDVFRYS-DDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRA............... 264
17 -30.0001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  14  38...............................................LTALLVQTPDGAVLLDGGMPQ--------------MASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRT---GAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGFTAHFMAGHTPGSTAWTWTDTRNRIAYADSLSAPGY------LQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGARA............... 239
18 -30.0003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  14  55...............................................IAVYVIKTSQGLILMDTAMPQ--------------STGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKET---GAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKVDRAVKEGDRVTLGDLTAHATPGHSPGCTSWEMTVKDGEVLFFCSGTVALN------LVGQPTYAGIVDDYRATFAKAKAMKIDVLLGPH............................. 242
19 -29.9001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  16  24..............................................DLASYLIVTPRGNILINSDLEA--------------NVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQT---KAKYMVMDEDVSVILSKSDFHYANDSSTYFTQSTVDKVLHDGERVELGGLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKN..................... 223
20 -29.5005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  17  30..............................................GLSSVLVTSPQGHVLIDGGLPE--------------SAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRS---NALVAASPSAALDLASEVGPDDPQYHALPKYPPVKDMRLARDGGQFNVGLTAHATPGHTPGGLSWTWQSCDGNMVYADSI--NAVSRPGFKFSASSEYPNALADLRHSFETLEKLPCDVLISAHPEASQLWQ..................... 231
21 -29.3003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  15  25..............................................GISAVLLSSPQGHILVDGTTEK--------------GAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLT---GATVLAGAANVDTLRTGVPKSDPQFGSLSNFPGSAKVRAVADGELVKLGVKAHATPGHTEGGITWTWQSCEQDVVFADSLTAVSA------SYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWT..................... 223
22 -28.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  15  20...............................................ATVYVMCGEKLTVMIDAGVSNSIAD-----------------------SFLDKLDYIVLTHLHIDHIGLLPE----LQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLG-QDKVIEVEGNEEFDLGMRLIYTPGHARHHMSVLV----DDFLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKV---VGFAHGGLVSPKIMEEHLKQML............ 224
23 -24.7002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  18  10............................................PLQENAYLVETGEGPVLIDPG----------------DEPEKLLALFQTTGLIPLAI---LLTHAHFDHVGAVAPLVEALDLP---VYLHPLDLPLYEGADLAARAWGLAIPKPPLPVRP----EEGMRLFGFQVLHLPGHSPGHVAFY--DPEGAQVFSGDLLFRGSVGRYDLPGA---DPKALFASLKRLLS--LPPETRVHPGHGPGTTLGLEARTN................ 197
24 -23.6002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  17  1.......MKALLPGLYLLP-------IPYPL---------------TVNLYLLQGAGEVALVDTALGTRAARG------------ALELHLAELGLCFQDVKTILLTHHHPDHYGGFFEGLGARVFEASWRLFLDHGTPEGALQGIRETVEKTRERVHPPQNPLPLRDGEALEVAGLRVLWTPGHADGHAA--FYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGAR--VAYAGH............................. 233
25 -21.9005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  12  25....EVRLYQIADGVW-----------------SHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAK-------------NTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVD-------------VLRKAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAHSTDNLVVYVPS--ANVLYGGCAVLALSRTSAGNVADADLAEWPTSVER---IQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTAH.......... 241
26 -21.5004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  2DEVPELRIEKVKEN----------------IFLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDR-------------DTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIKWLNDQ----SISTYATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIEV-----------FYPGGGHTIDNVVVWLPK--SKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQN---ALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETA.......... 219
27 -21.2005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  16  20..................AAGDTFEVAPGVRWLRMPLPFSLDHINLWLLRDEIDGQAGWTIVDCGISS-------------EAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGNWLCEGGDQGRWNVRLWMTLGEYDPAALDKLRSRRSYYSDLVPAVPPRYRRLREGDAVKIGWRVVTGYGHSPEHCA--LHSEADGVLISGDVLPRISTNVSVFDLEPEANPLALYLESLGRYETMAPDTLVLPSHGKPFRGV....................... 278
28 -21.2002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  11  42....EVRLYKIGDGVWSHIA-----------------TQKLGDTVYSSNGLIVRDADELLLIDTAWGAK-------------NTVALLAEIEK--QIGLPVTRSISTHFHDDRVGGVD-------------VLRAAGVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVVRFGPVEVFYPGAHSGDNLVVYVP--AVRVLFGGCAVHEASRESAGNVADANLAEWPATIKR---IQQRYPEAEVVIPGHGLPGGLELLQHTTNVVKTH.......... 258
29 -21.0004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  12  43....EVRLYQIADGVW-----------------SHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAK-------------NTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVD-------------VLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAHSTDNLVVYVPS--ANVLYGGCAVLELSSTSAGNVADADLAEWPTSVER---IQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAH.......... 259
30 -20.7002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  12  42...GEVRLYQIADGVW-----------------SHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAK-------------NTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVD-------------VLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAHSTDNLVVYVPS--ASVLYGGCAIYELSRTSAGNVADADLAEWPTSIER---IQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAH.......... 259
31 -20.6004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  27..........................LAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQ-------------TAQILNWIKQ--EINLPVALAVVTHAHQDKMGGMDALHAA----GIATYANALSNQLAPQEGMVAQHSLTFAANGWVEPATAPNFGPLKV-----FYPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARA---FGAAFPKASMIVMSHSAPDSRAAITHTARMADKL.......... 242
32 -20.3005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  1MGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQ-------------TAQILNWIKQ--EINLPVALAVVTHAHQDKMGGMDALHAA----GIATYANALSNQLAPQEGMVAQHSLTFAANGWVEPATAPNFGPLKV-----FYPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARA---FGAAFPKASMIVMSHSAPDSRAAITHTARMADKL.......... 242
33 -20.3004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  30..........................LAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQ-------------TAQILNWIKQ--EINLPVALAVVTHAHQDKMGGMDALHAA----GIATYANALSNQLAPQEGMVAQHSLTFAANGWVEPATAPNFGPLKV-----FYPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARA---FGAAFPKASMIVMSHSAPDSRAAITHTARMADKL.......... 245
34 -20.2003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  21..........................LAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQ-------------TAQILNWIKQ--EINLPVALAVVTHAHQDKMGGMDALHAA----GIATYANALSNQLAPQEGMVAQHSLTFAANGWVEPATAPNFGPLKV-----FYPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARA---FGAAFPKASMIVMSHSAPDSRAAITHTARMADKL.......... 236
35 -20.1004tyf_A mol:protein length:231 NDM-4  ali model follow..  15..........................LAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQ-------------TAQILNWIKQ--EINLPVALAVVTHAHQDKMGGMDALHAA----GIATYANALSNQLAPQEGLVAQHSLTFAANGWVEPATAPNFGPLKV-----FYPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARA---FGAAFPKASMIVMSHSAPDSRAAITHTARMADKL.......... 230
36 -20.0002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  10  6....PLEVIKIEDG----------------VYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKL-----------------LSWATDRGYQVMASISTHSHEDRTAGIKLLNSK----SIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNG-------------IELYYPGGHTEDNIVAWLPK--SKILFGGCLVRSHEWEALGYVGDASISSWADSIKN---IVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESA.......... 219
37 -19.9002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  14  10....TISISQLNKNVWVHTE-----------------LGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKL-------------TKELIEMVEK--KFQKRVTDVIITHAHADHIGGI------KTLKERGIKAHSTA-----LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVE----FYPGKGHTEDNIVVWLPQ--YNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIEN---VLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK............ 222
38 -19.8003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  28..........................LAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQ-------------TAQILNWIKQ--EINLPVALAVVTHAHQDKMGGMDALHAA----GIATYANALSNQLAPQEGMVAQHSLTFAANGWVEPATAPNFGPLKV-----FYPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARA---FGAAFPKASMIVMSHSAPDSRAAITHTARMADKL.......... 243
39 -19.8004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  11  6....DLKIEKLDEG----------------VYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAK-------------DTEKLVTWFVERG---YKIKGSISSHFHSDSTGGIEWLNSR----SIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKN-------------IEVFYPGGHTPDNVVVWLPE--RKILFGGGFIKPYG------LGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAV............ 214
40 -19.8001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16..........................LSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQ-------------TETLVNWVAD--SLHAKVTTFIPNHWHGDCIGGLGYLQKK----GVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMP-----------LQCYYLGGHATDNIVVWLPT--ENILFGGCMLKDNQATSIGNISDADVTAWPKTLDK---VKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQY.......... 225
41 -19.6004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  54..........................LAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQ-------------TAQILNWIKQ--EINLPVALAVVTHAHQDKMGGMDALHAA----GIATYANALSNQLAPQEGMVAQHSLTFAANGWVEPATAPNFGPLKV-----FYPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARA---FGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRLV....... 272
42 -19.6002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  15  21............................................NIDFNGFAWIRPEGNILIDPV----------------ALSNHDWKHLESLG----GVVWIVLTN---DHVRSAKEIADQ----YTKIAGPVAEKENFPIYCDR------------------WLSDGDELVPGLKVMELQGKTPGELALLLE---ETTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVRRLAALEKVEAVL................................. 178
43 -19.6001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16..........................LSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQ-------------TEMLVNWVTD--SLHAKVTTFIPNHWHGDCIGGLGYLQRK----GVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMP-----------LQCYYLGGHATDNIVVWLPT--ENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDK---VKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQY.......... 225
44 -19.6002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  13  16....TISISQLNKNVWVHTE-----------------LGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKL-------------TKELIEMVEK--KFQKRVTDVIITHAHASRIGGI------KTLKERGIKAHSTA-----LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVE----FYPGKGHTEDNIVVWLPQ--YNILVGGCLVKSTSA--KDLGNVADAYVNEWSTSIENVLKRYRNINAVV---HGEVGDKGLLLHTLDLLK............ 228
45 -19.5003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  13  10....TISISQLNKNVWVHTE-----------------LGSFNGEAVPSSGLVLNTSKGLVLVDSSWDDKL-------------TKELIEMVEK--KFQKRVTDAIITHAHADRIGGI------KTLKERGIKAHSTA-----LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVE----FYPGKGHTEDNIVVWLPQ--YNILVGGCLVKSTSA--KDLGNVADAYVNEWSTSIENVSKRYRNINAVV---HGEVGDKGLLLHTLDLLK............ 222
46 -19.4002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  13  10............................................AFSQNCSLIEQTRLAALVDPG-----------------DAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHYGVP---VIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPD-RWLNDGDRVSVGLQVLHCPGHTPGHVVFF--DEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLPLG----DDVTFIPGHGPLSTLGYERLHN................ 205
47 -19.2004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  11  7....DLKIEKLEEG----------------VYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTAT-------------DTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIEWLNSQ----SIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKN-------------IEVFYPGGHTQDNVVVWLPE--KKILFGGCFVKPDGLGNLG-----DANLEAWPKSAKILMSKYVKAKLVV---HSEIGDASLLKRTWEQAVKG.......... 217
48 -19.2005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  8.....LILLVALPALAQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKL-----------------LSWATDRGYQVMASISTHSHEDRTAGIKLLNSK----SIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNG-------------IELYYPGGHTEDNIVAWLPK--SKILFGGCLVRSHEREGLGYVGDASISSWADSIKN---IVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESA.......... 236
49 -19.1001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  15  1....DVKIEKLKDNLYVYTT-----------------YNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDK-------------FKSFTDEIYK--KHGKKVIMNIATHSHDDRAGGLEYFGKI----GAKTYSTKMTDSILAKENKPRAQ--------------YTFDNNKSFKVGFQVYYPGGHTADNVVVWFPK--EKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHN---IQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEY.......... 215
50 -18.9003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  10  32................................................NSMYLVTKKGVVLFDVPWEKVQ-------------YQSLMDTIKK--RHNLPVVAVFATHSHDDRAGDLSFFNNK----GIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEE-----------FVVDFLGGHTADNVVVWFPK--YNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINK---LKAKYSKATLIIPGHDEWKGGGHVEHTLELLNK........... 218
51 -18.8003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  11  1MSEKNLTLTHFKGPLYIVEDKE-----------------------VQENSMVYIGTDGITIIGATWTPET-------------AETLYKEIRK--VSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGIRAMYLGAHTKDGIFVYFPA--ERVLYGNCILKENL---GNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGH............................. 211
52 -18.1001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  1...AGMSLTQVSGPVYVVEDNY-----------------------VQENSMVYFGAKGVTVVGATWTPDT-------------ARELHKLIKR--VSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPLVLPNVVHDGDFTLQEGVRAFYAGAHTPDGIFVYFPD--EQVLYGGCILKE--------LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPLHGPELIDHYEAL............. 220
53 -17.9002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  15  29.................................................SLLLKKGNKEIVVDTGQSEN-----------------FIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPEVKIYTHKEILNKKYAMRKGGQFEEGFDLSFYEKYKNNFVLIDKDAEIEEGFYVIITYDNEFTTKNFFVEKEGKRI-FLDEVVVVKEEDGINVVTGCSHAGILNILETARNRFGVSYIKSLIGGFHLRGMEEEKVKDIARKIEEY.......... 240
54 -17.4002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  18  22............................................EVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYI----------------IDPAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATK----VSNISADDMLYTETDLEESMDKIETINFHEVKVAGIKFWCYHGHVLGAAMFMIEIAGVKLLYTGDFIPNIKPDILIIESTYGTHIHEKREEREARFCNTVHD..................................... 228
55 -17.4004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  38..................................................VAKMLDGTVVIVSSPFENL-------------GTQTLMDWVAKT--MKPKKVVAINTHFHLDGTGGNEIYKKM----GAETWSSDLTKQLRLEENKKDRIKAAEFYKNEPADNVFDLKQGKVFSFSVEVSFPGAHSPDNVVVYFPK--KKLLFGGCMIKPKELGYLG-----DANVKAWPDSARRLKKFDAK---IVIPGHGEWGGPEMVNKTIKVAEKA.......... 244
56 -16.7004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  13  18.................................RVLGCNPGPMTLQGTNTYLVGTGPRRILIDTG--------------EPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGI-----------GDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGLRVLYTPGHTDDHMALLLE--EENAIFSGDCI-----------LGEGTTVFEDLYDYMNSLKELLKIKADIIYPHGP........................... 202
57 -16.7001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  17  36..............................................ATSGYLFEHDGFRLLVDCGSG-------------------VLAQLQKY-ITPSDIDAVVLSHYHHDHVADI------GVLQYARLITSATKGQLPELPGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGISFLKTV-HPVTCFAMRITAGNDIVVYSADSSYIPEFIECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLP........................... 231
58 -16.4001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  14  17..................................................VIDDETKEAAIVDPV-----------------QPQKVVDAARKHGV---KLTTVLTTHHHWDHAGGNEK---VKLESGLKVYGGDDR----------------------IGALTHKITHLSTLQVGVKCLATPCHTSGHICYFVGGSEPPAVFTGDTLFVAG---------YEGTADEMCKALLEVLG-RLPPDTRVYCGHE............................ 174
59 -16.0003af5_A mol:protein length:651 Putative uncharacterized protein PH1404  ali model follow..  18  199............................................EVGRSALLVQTDESFVLVDFGVNVAMLNDPYKAF------PHFDAPEFQYVLREGLLDAIIITHAHLDHCGMLPYLFRYNLFDGPIYTTPPTR----IQQSNGQDPLYRPRDIKEVIKHTITYGEVRDISPDIRLTLHNGHILGSAIVHLGNGLHNIAITGDF......................................................................... 368
60 -15.9002ycb_A mol:protein length:636 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  17  190............................................EVGRSCLYLQTPNSRVLLDCGV-----------NVAGGDDKNSYPYLNVPEFTLDSLDAVIITHAHLDHSGFLYDGPVYCTAPTRDLMTLLQLDHIDIAHREDEPLPFNVKHVKKSVKHTITYGEVTDIAPDIRLTLHNGHILGSAMAHLGDGQHNMVYTGDF......................................................................... 353
61 -15.6003g1p_A mol:protein length:258 Protein phnP  ali model follow..  16  2....SLTLTLTGTGGAQ---------VPA--CAACARARRSPQYRRQPCSGVVKFNDAITLIDAGL-----------------------HDLADRWSPGSFQQFLLTHYHMDHVQGL----------PLRWGVGDPIPVYGPPDEQGCDDLFKHPGLLDFSHTVEPFVV----LQGLQVTPLP-HSKLTFGYLLETAHSRVAWLSDT......................................................................... 165
62 -15.5001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  17  20.....................................................EDTGTVGVVDPS-----------------EAEPIIDSLKRSGRN---LTYILNTHHHYDHTGGNLELKDR----GAKVIGSAMD----------------KDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFP--GSRAIFTGDTMFSLSCGKL-----FEGTPKQMLASLQKI--TSLPDDTSIYCGHEYTLSNSKFALS................. 181
63 -15.1002dkf_A mol:protein length:431 metallo-beta-lactamase superfamily protein  ali model follow..  17  11............................................EVTGSAHLLLAGGRRVLLDCGMFQGKEEAR---------------NHAPFGFDPKEVDAVLLTHAHLDHVGRLPKLFRE----RGPVYATRATVLLMEALKVMDEPFFGPEDVEEALGHLRPLEYGEWLLGALSLAFGQGHLPGSAFVVAQGEGRTLVYSGDL......................................................................... 163
64 -15.1002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  17............................................TIGGTVIEVAYKDAHIFFDFGTEFRPELDLPDDHIETLINNRLVPELKDL--KDYQHTAVFLSHAHLDHSRMI-----NYLDPAVPLYTLKETKMILNSLNRKGDFLIPSPEEKNFTREMIGLNKNDVIKVGVEIVPVDHDAYGASALLIRTPDHFITYTGDL-----------LHGHNREETLAFCEKAKHTELLMMEGVSISFPE............................. 224
65 -14.7002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  13  30...................................................TLKDNFSYLINDHTTHTLAAVDDYKPILTYIEEHLKQQGNADVTYT---FSTILSTHKHWDHSGGNAK---------------KAELEAMNSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHNDGVALFTGDTMFIAG---------FEGDEKDMCRAMEKVYHYALDKVTFIFPGHE............................ 221
66 -14.6002xr1_A mol:protein length:640 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  16  194............................................EVGRSCFLLSTPESRILIDCGVNVGSDENMTPYLY------------VPEVFPLNQIDAVIVTHAHLDHQGLVYEGPVYCTPPTRDLMVLLQLDYIDVAAKEGKKIPYESGMVAKTLKHTIPYEEVTDIAPDIKLTFHNGHILGSAISHFGDGLHNVVFTGDYFPRVETVISEATYGNANAFQPALKDAEKHLQMVVKN..................................... 406
67 -14.1002i7x_A mol:protein length:717 Protein CFT2  ali model follow..  10  12............................................SGTTVGSVVRFDNVTLLIDPGWNPSK--------------VSYEQCIKYWEKVIPEIDVIILSQPTIECLGALYYNFTSHFISRIQVYATIDSYASAGVIGPYDTNKLDLEDIEISFDHIVPLKYSQLVYDGLTLLYNAGVCPGGSIWCISTYSEKLVYAKRWNHTRNILNAASILDATGKPLSTLMRPSAIITTLDRFG.................................... 218
68 -13.4004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  16  16............................................VSCTFTYLLRESREAVLIDP----------------LETAPRDAQLIKELGLR---LLYAVNTHCHADHITGS-----------------------LLRSLLPGCQSVISRLSGAQADLH--IEDGDSIRFGLETRASPGHTPGCVTFVL--NDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLP----GDCLIYPAHDYHGFTVSTVEEERTLN............ 196
69 -13.2002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  13  23..................................................VLTNDEGRCVIVDPG-----------------EAAPVLKAIAEHKWM---PEAIFLT----DHVGGVKE---LQHFPQMTVYGPAET------------------QDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGH----VCYFSRPYLFCGDTLFSGGCGRL-----FEGTPSQMYQSLMKI--NSLPDDTLICCAHE............................ 169
70 -13.0003rpc_A mol:protein length:264 possible metal-dependent hydrolase  ali model follow..  12  14.................................................TGKLTIKNTTFLIDPFLAPKDTYPGFEGTFNYQQRMPMVDLPLSMDDLLSNVTAVVVTHTHLDH---WDDTAINSIPKSLPIFVQNTADKELITSQGFIDVRIIFESLEFNGITLRKTGGSHEMYANPVLAPLAGDAMGVIF---AADEPTVYLVGDTVWTSDVEKALLRFDPNVEDSIIMGTKDIGRMVVRKPEAKIIAVHMDTVNHTATSRKD................ 239
71 -13.0002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  15  25.....................................................HPDKPALLIDP----------------DKTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGT-----------------------LLKTKLPGVKSVISKASGSKADLF--LEPGDKVSIGLEVRATPGHTAGCVTYVTGEGADRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLP----KDTLIYPAHDYKGFEVSTVGEEMQHN............ 200
72 -12.8004ojv_A mol:protein length:369 3`,5`-cyclic-nucleotide phosphodiesterase 1  ali model follow..  13  7TILGGTQCFILKPELIAVDGGAGMYQLREMLVQGRNENEGDDELVPSFSKLNIQKGLSKSLLQSLKRQGEHFES-------------ANTMKKTYEVFQGITDYYITHPHLDHISGLVNSKKKTIWPHTIDVLQKHVFNDLIWPDLTAERS------KLKLKCLNPKEVQKCTIFPWDVIPFKHHGSTFYIFRDRKSKDCIIVCGDVEQDRRESEESLLEEFYVAENIPLVHLKGILVECSSSKPEQLYGH............................. 294
73 -12.8003bv6_A mol:protein length:379 Metal-dependent hydrolase  ali model follow..  13  42..........................LNEEIEQTVVEPNTFSMWWLGCTGIWLKSAGNTNLSIDFWCGTGKKTQKNRLMNTQHQMMRMGGVEALQ-AIKEIDAVLASHDHADHIDNVAAAVLQNCGEHVKFIGPQACVDLWLGWGVPQERCIVAKVGDVLEGDVKIRVLDSFDRTALVTLPKGVSSYDKAIYLIETSGGSVYHSGDSHYSNYYAKHGNDYQIDMTSSDVLRAAESL------DCQVVVPFH............................. 300
74 -12.6004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  14  10............................................ESSTYTYLIEATRQAVLIDP----------------LEQVDRDLQMVAELDLT---LTHVFDTHVHADHITASGALRERTQATVVGSVNGASCANVQVRHGDEVRVGQLV----------------------FQVLATPGHTDDSISYLLGDR----VFTGDALLVRGNGRTDFQNGNASQLYDSLTRVLFTLP----DETLVYPGHDYKGRTVTSIAEEKRHN............ 187
75 -12.5002wyl_A mol:protein length:360 L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG  ali model follow..  10  24..........................LNEEIEQEQVAPGTFAMWWLGCTGIWLKSEGGTNVCVDFWCGTGKQSHGNPLMKQGHQMQRMAGVKKLQFAIRQIDAVLATHDHNDHIDNVAAAVMQNCADDVPFIGPKTCVDLWIGPKERCIVVKPGDVVKVKDIEIHALDA----FDRTALITLPGMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEHQIDV-ITDKMTSADMLRMGEALNAKVVIPFH............................. 281

FFAS is supported by the NIH grant R01-GM087218-01
1 0 9 9 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.