current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3fcz_A mol:protein length:222 Beta-lactamase 2, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst KTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLKLast
1 -103.0003fcz_A mol:protein length:222 Beta-lactamase 2  ali model  100  1KTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK 222
2 -102.0002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  97  1KTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK 222
3 -101.0002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  97  7KTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK 228
4 -97.6003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  33  1.....QVKDFVIEPPIKNNLHIYKTFGVFGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLN 217
5 -96.5001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  35  1.........DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLIN 213
6 -95.5001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  32  2.QKSVKISDDISITQLSDKVYTYVSLAEIEGWGVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVN 223
7 -95.5001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  32  2.QKSVKISDDISITQLSDKVYTYVSLAEIEGWGVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVN 223
8 -91.7003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  31  6METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 234
9 -90.8004tyf_A mol:protein length:231 NDM-4  ali model follow..  31  1.GPGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 228
10 -90.7005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  31  12METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 240
11 -90.3004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  30  12METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 240
12 -90.2002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  35  1....SQGHKPLEVIKIEDGVYLHTSFKNIEGYGVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAE 217
13 -89.7004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  31  15METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 243
14 -89.6005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  37  16PTVNEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGTHSLEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVT 239
15 -89.4004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  35  1....NDEVPELRIEKVKENIFLHTSYSRVNGFGVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRK-NGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKE-PAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAE 217
16 -89.0003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  31  13METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 241
17 -88.8004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  33  1...AGARLPDLKIEKLEEGVYVHTSFEEVNGWGVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVE-RGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSG-VSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG---DANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAV 215
18 -88.6005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  35  15.PALAQGHKPLEVIKIEDGVYLHTSFKNIEGYGVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAE 234
19 -87.9004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  31  39METGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMAD 267
20 -87.6002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  35  33PTVDDIPVGEVRLYKIGDGVWSHIATQKLGDTVYSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPKALSSSGDVVRFGP--VEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVK 256
21 -87.6004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  35  1....AESLPDLKIEKLDEGVYVHTSFEEVNGWGVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVE-RGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSG-VNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG---DANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAV 214
22 -87.5004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  38  34PTVNEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVK 257
23 -86.8002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  36  34PTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGTHSLEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVK 257
24 -80.9004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  28  5.SDHVDLPYNLTATKIDSDVFVVT-----DRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLG---DANVKAWPDSARRLKK--FDAKIVIPGHGEWGGPEMVNKTIKVAE 242
25 -80.2003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  22  1.....MSEKNLTLTHFKGPLYIVED-----KEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWKSLPDTVFPG--DFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN----LGNMSFANRTEYPKTLEKLKGLILKVDSIIAGHDTIHDVGLIDHYLTLLE 229
26 -79.7001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  28  1........AGMSLTQVSGPVYVVE-----DNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWLVLPNVVHDGDFTLQEGK--VRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK----LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPHGPELIDHYEALIK 222
27 -35.0002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  14  5...........SSGLVPRGSHMLRLSAPGQGDVQVPVFLLRLGEASWALVEGGISRD-AELVWADLCRADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALFDEAEGVWRPLVFDDMEAYLESLERLQR-LPTLLQLIPGHGGLLRGRLAADGAE... 249
28 -34.3001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  15  18.......LQPMAPLQIADHTWQIGTED--------LTALLVQTPDGAVLLDGGM-PQMASHLLDNMKARTPRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSDNADRIVMDGEVITVGGIVFTAHFM-AGHTPGSTAWTWTDTRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRAL--PCDVLLTPHPGASNWDYAAGARAGAK 242
29 -33.2003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  18  6.......SSPQQPFTIYGNTHYVGTGG--------ISAVLLSSPQGHILVDGT-TEKGAQVVAANIRAMKLSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPAKVRAVADGELVKLGPLAVKAHAT-PGHTEGGITWTWQSCEVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKL--SCDIAIAAHPEVND............ 220
30 -33.0003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  16  35.......TAPFEPFQLIDNIYYVGTDG--------IAVYVIKTSQGLILMDTAM-PQSTGMIKDNIAKLKVADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYPKVDRAVKEGDRVTLGDTTLTAHAT-PGHSPGCTSWEMTVKDVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAM--KIDVLLGPHPEVYG............ 247
31 -32.5002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  15  6...............HRPDLYSWSTFNPARN--IDFNGFAWIRPEGNILIDPV---ALSNHDWKHLESLGG--VVWIVLTN--SDHVRSAKEIADQYTKIAGPVAEKENFPIY----CDRWLSDGDELVPG---LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVLAALEKVEAVLVGDGWSVFRDGRDRLKELVA 198
32 -32.5001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  13  1...AYPMPNPFPPFRIAGNLYYVGTDD--------LASYLIVTPRGNILINSDLEAN-VPMIKASIKKLKFSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKSTVDKVLHDGERVELGGTVLTAHLT-PGHTRGCTTWTMKLKDAVIIGSIGVNPGYKLVDNITPKIAEDYKHSIKVLESM--RCDIFLGSHAGMFD............ 220
33 -32.0004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  14  38.......NDPAMPQKVYGNTWYVGTCG---------SALLVTSDAGHILVDAAT-PQAGPQILANIRALRPEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASG............ 255
34 -32.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  12  20...................................ATVYVMCGEKLTVMIDAGVSNSIADFSFL-------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDGQDKVIEVEGNEEFDLGGYRMRLIYT-PGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIPTTVIDYKMYMESLKRQIEL--KPKVVGFAHGGLVSPKIMEEHLKQML 224
35 -31.9002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  18  11.................................LQENAYLVETGEGPVLIDPGDE---PEKLLALFQT-TGLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLALPVRPLEEGMRL----FGFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYD-LPGADPKALFASLKRLLSL-PPETRVHPGHGPGTTLGLEARTNPFLT 201
36 -31.8004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  14  38.......NDPAMPLKVYGNTWYVGTCG---------SALLVTSDAGHILVDAAT-PQAGPQILANIRALRPEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPVANIVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASG............ 255
37 -31.7005aeb_A mol:protein length:272 LRA-12  ali model follow..  11  18.......SKPYRPFRIAGNLYYIGTYD--------LACYLITTKQGNIIVNTGLAAS-ALQIKNNIKALKLTDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSSIADRLLHDKDTIQLGDTKLVMLHH-PGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKPGIAKDYAYTLQAMKNL--SFDIWVASHASQFS............ 232
38 -31.7005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  14  11.......NADQAPFRLFGNTYYVGMKG--------LSSVLVTSPQGHVLIDGGLPES-APKIIANIGALRIEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVVKDMRLARDGGQFNVGPVYLTAHAT-PGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGPNALADLRHSFETLEKL--PCDVLISAHPEASQ............ 228
39 -31.5002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  12  1............MKALLPGLYLLPVPIPYPLKTV--NLYLLQGAGEVALVDTALGTRAARGALELHLAELGQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHR-HPPQNPLPLRDGEALEVAGKRLRVLW-TPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGYTRENPLKDFLRSLDRLADL--GARVAYAGHFGPIAEELKAHHQARLE 256
40 -28.9004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  15  8...........RVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGAIPEYISCLKQALTE-FNTAIQEIVVTHWHRDHSGGIGDICKSYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCILGEGTTVF-----EDLYDYMNSLKELLKI--KADIIYPGHGPV.............. 203
41 -27.7001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  16  29...................................STVVYLEHKDRRIIIDPGNLSS-MDELEEKFSELGISPITDVLFTHVHLDHIFNSVLFENATFYVHEVYTIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRL-----SYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHD................ 206
42 -27.5004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  16  68...................................AEAALEEAARGPILVDTGGPWAR-EALLGALAGVAPGDVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPGLEV--------WATPGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV---ADVVVPGHGPP.............. 234
43 -27.0002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  15  11.................................FSQNCSLIWCEQTAALVDPGGD---AEKIKQEVDAS-GVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQGQPLTPDRWLNDGDRVSVGNVTLQVLHC-PGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSD-FPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQ 209
44 -25.6001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  15  9.................................LTDNYMYLVIDDEAAIVD----PVQPQKVVDAARKH-GVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGG--------DDRIGALTHKITHLSTLQVGSLNVKCLAT-PCHTSGHICYFVSKPGAVFTGDTLFVAG---CGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVE... 187
45 -25.3002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  11  41.................................IPVSAYLIQCTDATVLYDTGCHPECMCNLPERLRQLGLSPISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRVNLLNFGTGHASGMLGLAVRLEKFLLVSDACYTATNYGPPARRAGDTIGYDRTVSHIRQYAESRSLVLFGHDREQFASLIKSTDGFYE 276
46 -24.7001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  17  9.................................LKDNYAYILHDEDVGVVDPS----EAEPIIDSLKRS-GRNLTYILNTHHHYDHTGGNLELKDR----YGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSLS---CGKLFEGTPKQMLASLQKITSL-PDDTSIYCGHEYTLSNSKFALSLE... 183
47 -24.5005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  15  23...........DTFEVAPGVRWLRMPLPFSLDHI--NLWLL-GQAGWTIVDCGISSEAIRTHWEQIRHLDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTLGEYMFGCLPAVPPRYRRLREGDAVKIGARTWRVVT-GYGHSPEHCALHSEADGVLISGDMVLPRISTNVSVFDLE-LALYLESLGRYETMAPD-TLVLPSHGKP.............. 274
48 -23.8002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  14  31.................................LKDNFSYLINDHTLAAVDV---NADYKPILTYIEEHLKQTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVV-ANDSIPAVTKPVREGDRVQVGDLSVEVIDA-PCHTRGHVLYKVQHPQALFTGDTMFIAG---IGAFFEGDEKDMCRAMEKVYHIHKGNDYALDGH---------EYTSGFMT 228
49 -23.8004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  16  28..........................................ESREAVLIDPVLE--TAPRDAQLIKEL-GLRLLYAVNTHCHADHITGSGLLRSL------LPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRAS-PGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTD-FQQGCAKTLYHSVHEKIFTLPGDCLIYPAHD................ 180
50 -23.5004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  13  1..MSDSKPRDVQVLPIATNTKVLRARS---ERGTTSNSYVIEGDK-TAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRAPDDNLNILPMRGKETLDLGGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFKEDQRYYFNCLMAPHAIHVEAALEKISD--LQVRLYAVGHGPLVRTSLIALTQAYAD 248
51 -23.3003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  13  1...GRISMTVKKLYFIPDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKLNYKIIEGDYEVVPGVQLLYT----PGHSPGHQSLFIETEQVLLTIDASYKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIFFGH-DIEQEKSCRVFPEYI. 254
52 -23.2003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  13  2........SDTKVYLLDGGSLVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYEKHQTIPGALGLLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQEGTTRANSTFEGIDGDVDLARGVKLIST-PGHSIGHYSLLVEFPRILFTIDAAYTQKSTLCQAAFHIDPVAGVNSMRKVKKLAEDHGALMYSHDM............... 254
53 -23.1002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  13  19.................DHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFTNTPIIVQRTE-YEAALHREEYMKECILPHLNYKIIEGDYEV-QLLYTPGHSPGHQSLFIKTEQVLLTIDASYKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKIIFFGH-DIEQEKSCRVFPEYI. 252
54 -21.8004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  20  22..........................................ATRQAVLIDPVLE--QVDRDLQMVAEL-DLTLTHVFDTHVHADHITASGALRER-------TQATVVGSVNGASCANVQVRHGDEVRVGQLVFQVLAT-PGHTDDSISYLLGDR--VFTGDALLVRGNGRTD-FQNGNASQLYDSLTRVLFTLPDETLVYPGHD................ 171
55 -21.7002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  17  27...........................................DKPALLIDP----KTVDRDLKLIDEL-GLKLIYAMNTHVHADHVTGTGLLKTK------LPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRAT-PGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTD-FQEGSSDQLYESVHSQIFTLPKDTLIYPAHD................ 184
56 -21.4002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  16  2.........KAAAKRISDGVY-LRNYHGYTLQGTTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDALMDAARKFYANLITPLSKLVLKKFDEVLGLLERIQMIAPSHGQI.............. 236
57 -20.1002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  11  1...MSSKPKYVQDQEMIPGVYIFHGYHTDEGSSYNS---YFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKIGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANIVEIKYILSAHGVSWRGDAMGLAIAEYD 247
58 -20.0001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  13  2...........QPVAITDGIYYFHGPAFSTHRGTTYNAYLIV-DDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKASHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYAR 244
59 -19.9001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  15  1..........MQATKIIDGFHSRDFHGYTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDILERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVI.............. 229
60 -19.8004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  15  4AGYYQYQAGDVQITALLDGILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASSHLGSVLSNLKASGYQPVDTILLTHLHPDHVCGIANFPNATVYVSNDEASFWLDPKQAAKLPKEKIKQAIAPYQAKQRFKTYKLGAGHTPGHFSYELKTESIVFIGDIVHSHTVPETAIEYDIDPKKAVETRLKQFANFAKNGQTIPGIGHTYSAD.......... 278
61 -19.7004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  13  3.............IVVKNNIHDFHGTEYKTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSIN--GPEWNFNVVKTGDTLDIGGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDALFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLK 240
62 -19.6003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  13  5.........DISIHYLNGGNTKMDGANERNQINLPTHPILIQTAQYNLIIDAGIGNGKESHIIADLANLTPKDIDYVLMTHMHFDHAAGLAIFENAIHVVQQDEAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPV-MQHSGGHSFGHTIITIESDKAVHMGDIFPTTAHPLWVTAYDDYPMQSIREKERMIPYFIQQQYWF--HDENYFAVKYSDDGENID 268
63 -19.4004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  18  4SGFKKIKLGELELFILTDGYILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGFSAITDIFLSHAHPDHIGGVLVFPNASIFISKIEFNNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNPGHTPGLTVTTISSEKLMYVADLIHSDVIPDWGFSGDTDLDIATASRKKFLKQLADTKARAPGLGFTKVKA.......... 282
64 -19.3004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  15  35PGYYRMALGDFEVTALYDGLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGYQPVDTVLLTHLHPDHACGLPAYPNATVEVPQAEMAQQAVAPYAKMNKLKPYKTEGELLPGVSLVAS----PGHTPGHTSYLFKSQSLLVWGDILLNHAVPEVVFEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV.............. 303
65 -19.2004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  15  35PGYYRMALGDFEVTALYDGLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGYQPVDTVLLTHLHPDHACGLPAYPNATVEVPQAEMARQAVAPYAKMNKLKPYKTEGELLPGVSLVAS----SGHTPGHTSYLFKSQSLLVWGDILINHAVPEVVWEFDVDSDQARQSRQRILAEAATDKLWVPGLGHVREEA.......... 307
66 -19.1001vme_A mol:protein length:410 Flavoprotein  ali model follow..  17  12..........TERIFDDPEIY-VLRIDDDR-EGISYNAYLVKLNGANVLIDG-WKGNYAKEFIDALSKIVDKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEGFYGIKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGLPHVTKYIVTVIGHYKNYILEGAEKLSS--LKIKALLPGHGLI.............. 237
67 -18.8001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  15  45PGYYRMLLGDFEITALSDGTVALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAGPTLGRLAANLKAAGYQPVDEIYITHMHPDHVGGLLAFPNAVVRADQKEGAMASLNPYVKAGKFKPFSGNTDLVPGIKALAS----HGHTPGHTTYVVESQKLALLGDLILVAAVPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIPGIGHI.............. 311
68 -18.2003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  18  30...................................SQASYLIGCQKAMIID----PIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHT-PGHTPESISFLLTDEGGLFSGDFIFVGKAVKVEGSSEIGAKQMFKSIESIKD-LPDYIQIWPGHGA............... 215
69 -17.7003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  19  15...................................AHASYLVGCQEACVID----PARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRAAICVSDEGPPEWKSEYVKAYPHRLLKDGDELHFGNVRIVVMHT-PGHTPEHVSYLLYDGKALFSGDFVFVGRVAGESGSSEALARQMFRSLRKFEA-LPDHVQVLPAHGA............... 201
70 -16.6004nur_A mol:protein length:633 PSdsA  ali model follow..  14  89............LFEVTDGIYQVRNYD-------LSNMTIVEGKDGITIFDPLISQETAKAALDLYYKRPKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAENLIPPTDIIKETETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDS-THTLHNTYSLRGAKIRDWSKYLNEALKLWGDDVQVMPVWGNKEVREQLSLQRDMYR 348
71 -16.5002cfu_A mol:protein length:658 SDSA1  ali model follow..  18  107............LFEVAEGIYQVRGFD-------LANITFIRGDSGWIVVDTLTTPATARAAYELVSRLGERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKENLLAPTRLIEGEEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENV-VGTLHNLYTLRGAEVRDWSKYINQALHRFGRQAEVMPRWGNAEIVEVLEKQRDLYG 366
72 -16.4004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  13  89............LFKVTDKMYQVRGQD-------ISNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQRPQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISENIIAPTKTIVRTEKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENA-THTLHNFYTLRGAKTRDWTEYLNETLDMWGNDAEVLPVWGNKHINDYIGKYRDTIK 348
73 -16.2002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  15  117............LFEVMPKLYQVRGLD-------PANMTIIEGDSGLVLIDTLTTAETARAALDLYFQRPKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSENLVAPNVLIEKPERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNA-PPAMHNLLTPRGAEVRDWAGYIDASLEKYGDRTDVLPVWGGDKVRTYLADQRDMYA 377
74 -15.9002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  12  1.AMADIGSMNLNSIPAFQDNYIW---------------VLTNDEGRCVIVD----PGEAAPVLKAIAEH-KWMPEAIFLT----DHVGGVKELLQHQMTVYG--------AETQDKGATHLVGDGDTIRVLGEKFTLFAT-PGHTLGHVCYFSRP--YLFCGDTLFSGG---CGRLFEGTPSQMYQSLMKINSL-PDDTLICCAH................. 168
75 -15.4003x2x_A mol:protein length:227 UPF0173 metal-dependent hydrolase TM_1162  ali model follow..  14  8...................................GHAVVLIEGKKNIIID----PFISGNPVCPVKLEGLPKIDYILVTAGHGDHLGDAVEIAKKDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYIEGKKIYHAGDTGLTREMELLAEIGGNFVMDVEDAV--RAAVMIKPKKVVPMH................. 191

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 5 7 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.