current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3l6n_A mol:protein length:219 metallo-beta-lactamase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst QVKDFVIEPPIKNNLHIYKTFGVFGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNKKLast
1 -103.0003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model  100  1QVKDFVIEPPIKNNLHIYKTFGVFGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNKK 219
2 -99.1002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  34  12NETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK.. 228
3 -99.0002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  33  6NETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK.. 222
4 -98.5001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  45  1....DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINE. 214
5 -97.6003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  33  6NETGTISISQLNKNVWVHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK.. 222
6 -95.3001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  28  6KISDDISITQLSDKVYTYVSLAEIEGWGVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQ. 224
7 -94.9001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  29  6KISDDISITQLSDKVYTYVSLAEIEGWGVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQ. 224
8 -92.5004tyf_A mol:protein length:231 NDM-4  ali model follow..  24  5QRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADK. 229
9 -92.1003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  24  11QRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADK. 235
10 -91.3002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  27  2QGHKPLEVIKIEDGVYLHTSFKNIEGYGVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAES. 218
11 -90.3005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  24  17QRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADK. 241
12 -90.0004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  30  3.EVPELRIEKVKENIFLHTSYSRVNGFGVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRK-NGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKE-PAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAET. 218
13 -89.9004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  24  17QRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADK. 241
14 -89.3004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  24  20QRFGDLVFRQLAPNVWQHTSYLDMPGFGVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADK. 244
15 -89.3005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  27  19QGHKPLEVIKIEDGVYLHTSFKNIEGYGVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAES. 235
16 -88.6003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  24  18QRFGDLVFRQLAPNVWQHTSYLDPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADK. 242
17 -88.3005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  27  21IPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNEILEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTA. 240
18 -88.1004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  24  44QRFGDLVFRQLAPNVWQHTSYLDMGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADK. 268
19 -88.0004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  29  3ARLPDLKIEKLEEGVYVHTSFEEVNGWGVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVE-RGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSF-SGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG---DANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVK. 216
20 -87.2004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  29  2ESLPDLKIEKLDEGVYVHTSFEEVNGWGVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVE-RGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSG-VNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG---DANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVK. 215
21 -86.3002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  27  38IPVGEVRLYKIGDGVWSHIATQKLGDTVYSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPKALSSSGDVVRFGP--VEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVKT. 257
22 -86.1004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  27  40.PVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKA. 258
23 -85.8002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  27  39IPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEILEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKA. 258
24 -81.3004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  30  9DLPYNLTATKIDSDVFVVT-----DRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLG---DANVKAWPDSARRLKKF--DAKIVIPGHGEWGGPEMVNKTIKVAEK. 243
25 -81.1003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  29  2.SEKNLTLTHFKGPLYIVED-----KEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSLPDTVFPGD--FNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN----LGNMSFANRTEYPKTLEKLKGLIEKVDSIIAGHDTIHDVGLIDHYLTLLEK. 230
26 -79.8001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  25  1...AGMSLTQVSGPVYVVE-----DNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWAVLPNVVHDGDFTLQEGK--VRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK----LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPHGPELIDHYEALIK.. 222
27 -35.4002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  15  41..................................LRLGEASWALVEGGISRD-AELVWADLCRADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALFDEAEGVWRPLVFDDMEAYLESLERLQRL-PTLLQLIPGHGGLLRGRLAADGAESAYTE 254
28 -35.3001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  17  18..LQPMAPLQIADHTWQI--------GTEDLTALLVQTPDGAVLLDGG-MPQMASHLLDNMKARTPRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSANADRIVMDGEVITVGGIVFTAHFM-AGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLPHLIEDYRRSFATVRAL--PCDVLLTPHPGASNWDYAAGARAGAKAL 244
29 -33.6002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  14  6..........HRPDLYSWSTFN--PARNIDFNGFAWIRPEGNILIDPV---ALSNHDWKHLESLGG--VVWIVLTN--SDHVRSAKEIADQYTKIAGPVAEKENFPIY----CDRWLSDGDELVPG---LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVRRLLEKVEAVLVGDGWSVFRDGRDRLKELVAT. 199
30 -33.5003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  15  35..TAPFEPFQLIDNIYYV--------GTDGIAVYVIKTSQGLILMDTAMPQS-TGMIKDNIAKLKVADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYPKVDRAVKEGDRVTLGDTTLTAHAT-PGHSPGCTSWEMTVKDVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAM--KIDVLLGPHPEVYG.............. 247
31 -33.5002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  14  1.......MKALLPGLYLLP---PIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHLAELGQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHR-HPPQNPLPLRDGEALEVAGKRLRVLW-TPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAENPLKDFLRSLDRLADL--GARVAYAGHFGP--EELKAHHQARLEA. 257
32 -33.4003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  17  6..SSPQQPFTIYGNTHYV--------GTGGISAVLLSSPQGHILVDGTTEKG-AQVVAANIRAMKLSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPAKVRAVADGELVKLGPLAVKAHAT-PGHTEGGITWTWQSCEVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKL--SCDIAIAAHPEVND.............. 220
33 -33.3001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  16  5..PNPFPPFRIAGNLYYV--------GTDDLASYLIVTPRGNILINSDLEAN-VPMIKASIKKLKFSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKSTVDKVLHDGERVELGGTVLTAHLT-PGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKPKIAEDYKHSIKVLESM--RCDIFLGSHAGMFD.............. 220
34 -33.0002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  19  9..........................GPLQENAYLVETGEGPVLIDPGDE---PEKLLALFQT-TGLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLALPVRPLEEGMRL----FGFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYD-LPGADPKALFASLKRLLSL-PPETRVHPGHGPGTTLGLEARTNPFLT.. 201
35 -32.7005aeb_A mol:protein length:272 LRA-12  ali model follow..  14  18..SKPYRPFRIAGNLYYI--------GTYDLACYLITTKQGNIIVNTGLAAS-ALQIKNNIKALKLTDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSIIADRLLHDKDTIQLGDTKLVMLHH-PGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKPGIAKDYAYTLQAMKNL--SFDIWVASHASQFS.............. 232
36 -32.5003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  12  20..............................ATVYVMCGEKLTVMIDAGVSNSIADFSFL-------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDGLKKVIEVEGNEEFDLGGYRMRLIYT-PGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIPTPVIDYKMYMESLKRQIEL--KPKVVGFAHGGLVSPKIMEEHLKQMLSK 226
37 -32.5004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  14  38..NDPAMPQKVYGNTWYV--------GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALRPEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASG.............. 255
38 -32.4005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  13  11..NADQAPFRLFGNTYYV--------GMKGLSSVLVTSPQGHVLIDGGLPES-APKIIANIGALRIEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVVKDMRLARDGGQFNVGPVYLTAHAT-PGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGPNALADLRHSFETLEKL--PCDVLISAHPEASQ.............. 228
39 -32.3004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  14  38..NDPAMPLKVYGNTWYV--------GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALRPEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPVANIVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASG.............. 255
40 -28.2004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  14  8......RVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGAIPEYISCLKQALTE-FNTAIQEIVVTHWHRDHSGGIGDICKSYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCILGEGTTVF-----EDLYDYMNSLKELLKI--KADIIYPGHGPV--HNAEAKIQQYISHR 218
41 -28.0002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  17  11............................FSQNCSLIWCEQTAALVDPGGD---AEKIKQEVDA-SGVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQGQPLTPDRWLNDGDRVSVGNVTLQVLHC-PGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDF-PRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD. 210
42 -26.8005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  15  17TLPAAGDTFEVAPGVRWLR---PLPFSLDHINLWLL-GQAGWTIVDCGISSEAIRTHWEQIRHLDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTLGEYMFGCLPAVPPRYRRLREGDAVKIGARTWRVV-TGYGHSPEHCALHSEADGVLISGDMVLPRISTNVSVFDLEPLALYLESLGRYETMAPD-TLVLPSHGKP--AQLRAHHDARLEE. 295
43 -26.8001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  14  29..............................STVVYLEHKDRRIIIDPGNLSS-MDELEEKFSELGISPITDVLFTHVHLDHIFNSVLF--ENATFYVHEVYKTKNYLSFGTIVGRIYSKVIS-SLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRL-----SYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHD.................. 206
44 -26.5004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  14  68..............................AEAALEEAARGPILVDTGGPWAR-EALLGALAGVAPGDVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPGLEV--------WATPGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV---ADVVVPGHGPP................ 234
45 -25.7001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  22  9............................LKDNYAYILHDEDVGVVDPSEAEPIIDSL-----KRSGRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAMDKDRIPG------DMALKDGDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSLS---CGKLFEGTPKQMLASLQKITSL-PDDTSIYCGHEYTLSNSKFALSLE..... 183
46 -25.6001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  21  9............................LTDNYMYLVIDDEAAIVD----PVQPQKVVDAARK-HGVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGGDDRIGAL--------THKITHLSTLQVGSLNVKCLAT-PCHTSGHICYFVSKPGAVFTGDTLFVAGC---GKFYEGTADEMCKALLEVLGRLPPDTRVYCGHNNLKFARHVEPGNAAIREK 196
47 -24.4002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  13  47..................................LIQCTDATVLYDTGCHPECMCNLPERLRQLGLSPISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRVNLLNFGTGHASGMLGLAVRLEKFLLVSDACYTATNYGPPARRAGDTIGYDRTVSHIRQYAESRSLVLFGHDREQFASLIKSTDGFYE.. 276
48 -24.4004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  10  4SKPRDVQVLPIATNTKVLRAEIEYALERGTTSNSYVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRAPDDNLNILPMRGKETLDLGGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFKEDQRYYFNCLMAPHAIHVEAALEKISDL--QVRLYAVGHGPLVRTSLIALTQAYAD.. 248
49 -24.0004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  16  28.....................................ESREAVLIDP----ETAPRDAQLIKEL-GLRLLYAVNTHCHADHITGSGLLRSL------LPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRAS-PGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDF-QQGCAKTLYHSVHEKIFTLPGDCLIYPAHD.................. 180
50 -23.2003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  15  21............DHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAF--TNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYVQLLYT-PGHSPGHQSLFIETEQVLLTIDASYEDEVPFAGF----DPELALSSIKRLKEVVKKEKIIFFGHDI-EQEKSCRVFPEYI... 254
51 -23.2002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  15  31............................LKDNFSYLINDHTLAAVDVNAD---YKPILTYIEEHLKQTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVV-ANDSIPAVTKPVREGDRVQVGDLSVEVIDA-PCHTRGHVLYKVQHPQALFTGDTMFIAG---IGAFFEGDEKDMCRAMEKVYHIHKGNDYALDGH---------EYTSGFMT.. 228
52 -23.1002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  15  19............DHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAF--TNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYVQLLYT-PGHSPGHQSLFIKTEQVLLTIDASYEDEVPFAGF----DPELALSSIKRLKEVVKKEKIIFFGHDI-EQEKSCRVFPEYI... 252
53 -22.6002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  14  2....KAAAKRISDGVY-LRNYHGYTLQGTTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKFLGLLERIQMIAPSHGQI................ 236
54 -22.5004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  20  22.....................................ATRQAVLIDP----EQVDRDLQMVAEL-DLTLTHVFDTHVHADHITASGALRER-------TQATVVGSVNGASCANVQVRHGDEVRVGQLVFQVLAT-PGHTDDSISYLLGDR--VFTGDALLVRGNGRTDF-QNGNASQLYDSLTRVLFTLPDETLVYPGHD.................. 171
55 -22.5002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  15  3SKPKYVQDQEMIPGVYIFHGYHTDEGSSYNS---YFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKIGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMKALEVASTV--EIKYILSAHGVSWRGDAMGLAIAEYDR. 248
56 -22.1002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  20  27......................................DKPALLIDP----KTVDRDLKLIDEL-GLKLIYAMNTHVHADHVTGTGLLKTK------LPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRAT-PGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTDF-QEGSSDQLYESVHSQIFTLPKDTLIYPAHD.................. 184
57 -21.7003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  13  21................VFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYEKHQTIPGALGLLGLEPIDVVVNSHFHFDHCGGNKYF--PHAKKICHRSEVPQACNPQPFEHLEGIDGDVDLARGVKLIST----PGHSIGHYSLLVEFPRILFTIDAAYTQKSTLCQAAFHIDPVAGVNSMRKVKKLAEDHGALMYSHDM................. 254
58 -21.5001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  13  2......QPVAITDGIYYFHGPAFSTHRGTTYNA-YLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKASHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYAR.. 244
59 -21.5001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  18  1.....MQATKIIDGFHSRDFHGYTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLLKAIETLVGAGVAPEFICPDHGVI................ 229
60 -20.7004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  17  1......MSIVVKNNIHDFHGTEYKTLRGSSYNS-YLIREEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPEWNF--NVVKTGDTLDIGGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLK.. 240
61 -20.6001vme_A mol:protein length:410 Flavoprotein  ali model follow..  15  42..........................EGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEGFYGIKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGLPHVTKYIVTVIGHYKNYILEGAEKLSSL--KIKALLPGHGLI................ 237
62 -20.4003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  17  30..............................SQASYLIGCQKAMIID----PIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHT-PGHTPESISFLLTDEGGLFSGDFIFVGKAVKVEGSSEIGAKQMFKSIESIKDL-PDYIQIWPGHGSPCGKSLGAIPTSTLGYE 234
63 -19.8003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  20  15..............................AHASYLVGCQEACVID----PARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAIVSDEGPPEWKSEYVKAYPHRLLKDGDELHFGNVRIVVMHT-PGHTPEHVSYLLYDGKALFSGDFVFVGRVAGESGSSEALARQMFRSLRKFEAL-PDHVQVLPAHGSACGKALGAVPSSTVGYE 220
64 -18.9003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  10  49...............................HPILIQTAQYNLIIDAGIGNGKESHIIADLANLTPKDIDYVLMTHMHFDHAAGLTDQAGHNAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLIIKMQHSG-GHSFGHTIITIESDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDA. 269
65 -18.4004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  18  90...............................NAYLINTGDNLVLIDTGAAQCFGPVVQTNLKASGYQPVDTVLLTHLHPDHACGLEFWLDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEGELLSLVASPGHTPGHTSYLFKSQSLLVWGDILLNHAVPEVVFEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV................ 303
66 -18.4004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  18  90...............................NAYLINTGDNLVLIDTGAAQCFGPVVQTNLKASGYQPVDTVLLTHLHPDHACGLEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGELLSLVASSGHTPGHTSYLFKSQSLLVWGDILINHAVPEVVWEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV................ 303
67 -18.3004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  16  60...............................NILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGFSAITDIFLSHAHPDHIGGVVFISKIEHDFWINASIKDFNNSALKAHPEKFYDLNKTLYSHFNFQLA----PGHTPGLTVTTISSEKLMYVADLIHSDVIPDWGFSGDTDLDIATASRKKFLKQLADTKARAPGLGFT................ 278
68 -18.2004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  19  59...............................NAFLVNIGKSLILIDSGAASCFGSSVLSNLKASGYQPVDTILLTHLHPDHVCGISKDGVANATVYVSNDEASFWLDPKQAAKLEKIKQAIAPYQAKQRFKTYKLGDGHTPGHFSYELKTESIVFIGDIVHSHTVPETAIEYDIDPKKAVETRLKQFANFAKNGQTIPGIGHTYSAD............ 278
69 -17.9001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  18  98...............................TGYLVNTGSKLVLVDTGAAGLFGPRLAANLKAAGYQPVDEIYITHMHPDHVGGLLAFPNAVVRADQKEGAMASLNPYVKAGKFKPFSGNTDLVPGIKALAS----HGHTPGHTTYVVESQKLALLGDLILVAAVPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIPGIGHI................ 311
70 -16.5004nur_A mol:protein length:633 PSdsA  ali model follow..  17  89.......LFEVTDGIYQVRNYD-------LSNMTIVEGKDGITIFDPLISQETAKAALDLYYKRPKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAETLIPPTDIIKETETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTNTYSLRGAKIRDPLAWSKYLNEALKLWGDDVQVMPVWGNKEVREQLSLQRDMYR.. 348
71 -16.4002cfu_A mol:protein length:658 SDSA1  ali model follow..  14  107.......LFEVAEGIYQVRGFD-------LANITFIRGDSGWIVVDTLTTPATARAAYELVSRLGERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKESLLAPTRLIEGEEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTNLYTLRGAEVRDALGWSKYINQALHRFGRQAEVMPRWGNAEIVEVLEKQRDLYG.. 366
72 -16.3004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  17  28.....................................ETRQCALIDSRTCSASADRLVERVNE-LNASVRWVLETHVHADHLSAAAYLKEKGAHITQVQKVFGALFNAEPGFADVLLEDEEGFRIGNLQARALHT-PGHTPACMSFMIEDEIAVFVGDTLF---MPDYGTAPGADARTLYRSIRRLLAFPDQTRLFM-CHDYLPGGRDMQYVTTVAEQR 231
73 -16.3004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  14  82QINGISGLFKVTDKMYQVRGQD-------ISNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQRPQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISESIIAPTKTIVRTEKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENATHTNFYTLRGAKTRDTSKWTEYLNETLDMWGNDAEVLPVWGNKHINDYIGKYRDTIK.. 348
74 -16.0002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  16  117.......LFEVMPKLYQVRGLD-------PANMTIIEGDSGLVLIDTLTTAETARAALDLYFQRPKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSETLVAPNVLIEKPERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPANLLTPRGAEVRDAKAWAGYIDASLEKYGDRTDVLPVWGGDKVRTYLADQRDMYA.. 377
75 -16.0002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  21  16............................FQDNYIWVLTNDECVIVDPG----EAAPVLKAIAE-HKWMPEAIFLT----DHVGGVKELLQHQMTVYG--------AETQDKGATHLVGDGDTIRVLGEKFTLFAT-PGHTLGHVCYFSRP--YLFCGDTLFSGGC---GRLFEGTPSQMYQSLMKINSL-PDDTLICCAH................... 168

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 4 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Robinson-Rechavi M, Alibes A, Godzik A. Contribution of electrostatic interactions, compactness and quaternary structure to protein thermostability: lessons from structural genomics of Thermotoga maritima. J Mol Biol. 2006 Feb 17;356(2):547-57. Epub 2005 Dec 7.