current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3lvz_A mol:protein length:294 Blr6230 protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst MRRLTAALCALTLLSTGAQAQTIKDFLAVAMKKWTAPFEPFQLIDNIYYVGTDGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGMQAKRAEMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQTAALEKKLast
1 -109.0003lvz_A mol:protein length:294 Blr6230 protein  ali model  100  1MRRLTAALCALTLLSTGAQAQTIKDFLAVAMKKWTAPFEPFQLIDNIYYVGTDGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGMQAKRAEMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQTAALEKK 294
2 -98.3003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  29  2..............................DRDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEKR..... 262
3 -97.4001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  35  1..............................AYPMPNPFPPFRIAGNLYYVGTDDLASYLIVTPRGNILINSDLEANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYANSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQETG.... 263
4 -96.8005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  30  1........................TPGCEVCATWNADQAPFRLFGNTYYVGMKGLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGEVGPDDPHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGSASSEYPNALADLRHSFETLEKLPCDVLISAHPEASQLWQRLEASATGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQQ.... 271
5 -96.8001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  31  1.................AEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGA------RAGAKALTCKAYADAAEQKFDGQLAKETAGAR.. 269
6 -96.0005aeb_A mol:protein length:272 LRA-12  ali model follow..  31  3...................ASQKVKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN....... 272
7 -95.0004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  28  1MKRRFTLLGSVVALALSSTALASDAPASADDAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVYDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIG---PRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAA.... 295
8 -94.9004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  27  1MKRRFTLLGSVVALALSSTALASDAPASADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIG---PRAAAPLMDTTACRRYAQGARQRLEKRLAEEAATSPSS 299
9 -49.6002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  21  4.............................................FPVTLGPLQENAYLVETGEGPVLIDPG--DEPEKLLALFQTTGLI---PLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEG-ADLAARAWGLAIPKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGS--------VGRYDLPADPKALFASLKRLLSLPPETVHPGHGPGTTLGL------EARTNPFLTGLEWEA....................... 207
10 -48.8002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  15  21.......................................PGQLDDDLCLLGDVQVPVFLLRLGESWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLNVQVLASERTCQAWKSQLLRAEQRLPEACAWDALPVRAVADGEWLELGPHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDAL----GEFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLQLIPGHGGLLRGRLAADGAESAYTE-LLWRQSMGESLDELSEELHRAWGGQSVD.... 289
11 -48.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  15  20......................................................ATVYVMCGEKLTVMIDAGVSNSIADFSF--------LDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKV-DQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVD--------DFLFTGDSGAYFNGVVIPTTPPVDYKMYMESLKRQIELKPKVVGFAHGGLVSIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS. 260
12 -44.4001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  16  29......................................................STVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFE---NATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEK--VKVFHTPWHAREHLSFLLDTENAG---RVLITGDI-TPNRLSYYDIIKGYGSVQVKNFLDRVGRI--DLLVFPHDAPLKPEVKK.......................................... 215
13 -44.4002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  23  4.............................................RIIPVTAFSQNCSLIWCEQLAALVDPG--GDAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGG--------VGRSDFPGDHTQLIDAIKKLLPLGDDVFIPGHGPLSTLGY------ERLHNPFLQD............................ 210
14 -39.9002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  17  3.........................................ALLPGLYLLPLKTVNLYLLQGAGEVALVDTALRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEG-LGARVFLHEEEFARGHRFWREPEAFAEASRVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALL----KVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFGPI--------------------ADVRQRAEELKAHHQARLEALLALLDG. 264
15 -37.7004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  19  68......................................................AEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPG---AALLVSHDFCLPGGR-----------------YLPHGLGEGQPLRLGP-GLEVWATPGHGGQRDVSV--VVAGTALGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV-ADVVVPGHGPPFRVLREASQ........................................ 243
16 -37.2003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  21  35......................................................VYSILIEHAEGRFLIDTGYDEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFP---HAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEAEGIDGDVDLARG--VKLISTPGHSIGHYSLLVEFPRRK---PILFTIDAAYTQKSLETLAAFHIDPVAGVNSMRKVKKLAEDELMYSH.................................................... 252
17 -37.2002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  16  20..................................................RNIDFNGFAWIRPEGNILIDP--VALSNHDWKHLESLG----GVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENF-----------------PIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLE-------ETTLITGDLYRAGGLEILPDEKLMNKQKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKE...................................... 195
18 -36.8004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  15  1MLKVYMTASVMAVASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEA---------EGNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAN------VLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGG............................................... 245
19 -36.5002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  17  43......................................................VSAYLIQCTDATVLYDTGCHPECCNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDEFATAVRYFATGDKDIEAWLATPRNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVRLEKQPGFLLVSDACYTATNYGPPARRAGVLHDTIGYDRTVSHIRQYAESTVLFGH.................................................... 259
20 -36.4003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  19  39......................................................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEMKECILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIETEQSGSV--LLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGH.................................................... 239
21 -36.3002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  19  37......................................................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEMKECILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIKTEQSGSV--LLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGH.................................................... 237
22 -36.0002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  14  1MFQIGISAFVMAVLGSAAYSAQPGGEYPTVDDIPVGEVRLYKIGDGVWSHTVYSSNGLIVRDADELLLIDTAWAKNTVALLAEIEKQ--IGLPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAEAA---------GNEVPAHSLKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVPAVR------VLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQREAEVVIPGHGLPGGLEL----------------QHTTNVVKTHKVRPVAE........... 265
23 -35.8005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  17  1............GPSPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEAE---------GNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAN------VLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGG............................................... 227
24 -35.7002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  13  1MFKVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWS-AVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEVE---------GNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAS------VLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHEAQFVIPGHGLPGG----------------------LDLLKHTTNVVKAHTNRSVVE.... 266
25 -35.3001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  20  14........................................................AYILHDEDTVGVVDPS---EAEPIIDSLKRSGRN---LTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPG------------------IDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKL---------FEGTPKQMLASLQKITSLPDDTSICGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKA..... 216
26 -34.3005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  17  1MKNVLVFLILLVALPALAQG--------------HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPSEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAR--------------EGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSK------ILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSYPIQMVVPGHGKVGSSDI----------------DHTIDLAESASNKLMQPTAEASAD.... 250
27 -34.2004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  13  12KLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDS............................................... 255
28 -34.2004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  18  21........................................................TYLLGDRESAVLIDPVL-ETAPRDAQLIKELGLR---LLYAVNTHCHADHITGSGLLRSLLPGCQSVIS--------------------RLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGC--------GRTDFQGCAKTLYHSVEKIFTLPGDCLIPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMR. 230
29 -34.0004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  16  2.........................PKSSDHVDLPYNLTATKIDSDVFVVDFYSSNVLVAKMLDGVVIVSSPFENLTQTLMDWVAKT--MKPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRLEENKKDKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGD---------ANVKAWPDSARRLKKFDAKIVIPGHGEWGG............................................... 230
30 -33.9004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  17  15........................................................TYLIGDEATAVLIDPVL-EQVDRDLQMVAELDLT---LTHVFDTHVHADHITASGALRERTQATVVGSVNGAS---------------------CANVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLG--DRVFTGDALLVRGN--------GRTDFQGNASQLYDSLRVLFTLPDETLVPGHDYKGRTVTSIA--EEKRHNPRVAGKSREEFIHIMEN................ 204
31 -33.8004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  15  4..................................VPELRIEKVKENIFLHGLVSSNGLVVIDKGNAFIVDTPSDRDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIKWLNDQ-SISTYATTSTNHLLKENKK--------------EPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPKSK------ILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSREAQIVIPGHGKIGDIAL----------------KHTKSLAETASNKSIQPNANASAD.... 233
32 -33.8003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  14  3..................................EKNLTLTHFKGPLYIVEYVQENSMVYIGTDGITIIGATTPETAETLYKEIRKV--SPLPINEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDPGDFNLQNGSIRAMYLEAHTKDGIFVYFPAERVLYGNCILKENLGNMS----------FANRTEYPKTLEKLKGLKVDSIIAGHDTPIHDVGLIDHYLT..................................... 226
33 -33.7002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  19  1........................................MKLLFRQLFENESSTFTYLLADDKPALLIDP-VDKTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKA--------------------SGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGADQPQPRMAFTGD--AVLIRGCGRTDFQGSSDQLYESVSQIFTLPKDTLIPAHDYKGFEVSTVGEEMQHNPRLTKDKETFKTIMSNLNLSYPKMIDVAVPANMV. 234
34 -33.7002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  17  8..................................TGTISISQLNKNVWVHEAVPSNGLVLNTSKGLVLVDSSWDDKTKELIEMVEKK--FQKRVTDVIITHAHADHIGGIKTLKER-GIKAHSTALTAELAKKNGYE-------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEVGD............................................... 210
35 -33.6003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  15  3..................................KDFVIEPPIKNNLHIYKEYSANSMYLVTKKGVVLFDVPWEKVYQSLMDTIKKR--HNLPVVAVFATHSHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKDGKA-------------TSTEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFPKYN------VLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKKATLIIPGHDEWKG............................................... 205
36 -33.4004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  19  20..........................................LGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGN--------GEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVF-----------EDLYDYMNSLKELLKIKADIIYPGHGPVIH-------------NAEAKIQQYISHRNIREQQILTLFRENFEKS... 236
37 -33.3002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  15  1.....................ASQKVEKTVIKNETGTISISQLNKNVWVHTELGSNGLVLNTSKGLVLVDSSWDDKTKELIEMVEKK--FQKRVTDVIITHAHASRIGGIKTLKER-GIKAHSTALTAELAKKNGYE-------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEVGD............................................... 216
38 -33.1001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  17  1...........................AQKSVKISDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPINDATETLVNWVADS--LHAKVTTFIPNHWHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEKGL-------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTEN------ILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGDYGG............................................... 211
39 -33.0003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  14  1...............MPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAA----------------THTARMADKLRKLVPRGSAAAALE.... 257
40 -33.0003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  16  8..................................TGTISISQLNKNVWVHTELGSSGLVLNTSKGLVLVDSSWDKLTKELIEMVEKK--FQKRVTDAIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKNGYE-------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRNINAVVPSHGEVGD............................................... 210
41 -33.0004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  14  1................SNAIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAKASMIVMSHSAPDS............................................... 228
42 -32.9001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  17  1...........................AQKSVKISDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPINDATEMLVNWVTDS--LHAKVTTFIPNHWHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKGL-------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTEN------ILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGNYGG............................................... 211
43 -32.9001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  14  2.....................................VKIEKLKDNLYVYTKYAANAVYLVTDKGVVVIDCPWGEDFKSFTDEIYKK--HGKKVIMNIATHSHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKENKP-------------RAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFPKEK------VLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKGAQYVVAGHDDWKD............................................... 201
44 -32.7004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  15  1.....GSHMGEIRPTIGQQMETGDQR--------FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDS............................................... 231
45 -32.5003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  14  1......................SNANYMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDS............................................... 222
46 -32.5001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  16  1...................................AGMSLTQVSGPVYVVYYVQENSMVYFGAKGVTVVGATTPDTARELHKLIKRV--SRKPVLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDWAEIVAFTRKGDLPLVLPNVVHDGDFTLQEGKVRA-FYAGPAHTPDGIFVYFPDEQVLYGGCILKEKLGNLS----------FADVKAYPQTLERLKALPIKTVIGGHDSPLHGPELIDHYEA..................................... 219
47 -32.4004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  15  5..................................LPDLKIEKLEEGVYVHGVVSKHGLVVLVNTDAYLIDTPTATDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIEWLNSQ-SIPTYASELTNELLKKDGKVQAKNS---------------SGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGD---------ANLEAWPKSAKILMSKKAKLVVSSHSEIGD............................................... 203
48 -32.4005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  15  19..................................FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDS............................................... 228
49 -32.3004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  15  4..................................LPDLKIEKLDEGVYVHGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKKDGKVQATNS---------------SGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGD---------ANIEAWPKSAKLLKSKKAKLVVPSHSEVGD----------------------ASLLKLTLEQAVKGLNESKKPSKP. 226
50 -32.2004tyf_A mol:protein length:231 NDM-4  ali model follow..  15  7..................................FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGLVAAQ-----HSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDS............................................... 216
51 -32.0002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  16  4..................................HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPWEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAR--------------EGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSK------ILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKPIQMVVPGHGKVGSSDI----------------DHTIDLAESASNKLMQPTAEASAD.... 233
52 -30.2001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  17  3.....................................VEVLPALTDNY--------MYLVIDDETAAIVDPV---QPQKVVDAARKHGVK---LTTVLTTHHHWDHAGGNEKLVKLEGLKVYGGDDRIGAL---------------------THKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSETGDTLFVAGCG-----------YEGTADEMCKALEVLGRLPPDTRVCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFT..... 220
53 -30.0005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  16  20...................................AAGDTFEVAPGVRWLSLDHINLWLLRDQAGWTIVDCGISEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGNVRLWMTLGEDPAALDKLRSRRSYYSDLVPAVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALHSEADGVLISGDMVLPR---STNVSVFDLEPEANPLALYLESLGRYETMAPDLVLPSHG-----------------KPF---RGVRTRIAQLRAHHDARLEEVRVACAEK 303
54 -30.0003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  14  48......................................................THPILIQTAQYNLIIDAGIGNEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHANAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPG--IKMQHSGGHSFGHTIITIESQGD----KAVHMGDIFPTTA-VTAYDDYPMQSIREKERMIPYFIQQQYWFLFYH.................................................... 251
55 -28.8004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  22  59......................................................INILLVKTKEKLILMDTGMGIRTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTISSGNE----KLMYVADLIHSDVILFPHPDWLDIATASRKKFLKQLADTKARAFTSH.................................................... 269
56 -28.2004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  19  57.....................................................SINAFLVNIGKSLILIDSGAASHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISKDGVANNATVYVSNDEASFWLDPKQAAKLPKEKAPYQAKQRFKTYKLGDDIQ----GFKVINTAGHTPGHFSYELKTKGE----SIVFIGDIVHSHTVQFDRPETPKKAVETRLKQFANFAKNGQTIAAPH.................................................... 265
57 -28.2004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  18  10...............................................FFDPATCTISYLLFDSGSCALIDSVLDASADQLIARVAALGAR---VRWLLETHVHADHLSAAPYLKTRVGGEIAIGR-HVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARAAFVGDTLFMPDYGTARCDFPGDARSLYRSIRKVLSLPPATLYMCHDYQPNGRAASTVADELRENVHIREGVTEDDFVAMRTARDATLDMPV...... 265
58 -28.0002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  18  25.....................................VTVVPTLKDNF--------SYLINDHTTLAAVDV--NADYKPILTYIEEHLKQQGTFSTILSTHKHWDHSGGNAKLKAELEAVVVGGANDS----------------------AVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGDTMFIAG-------FEGDEKDMCRAMEKVYALDKVTFIPGH--EYTSGFMTFSEKTFPDRASDDLAFIQAQRAKYAASVPSSLAEEKR..... 272
59 -28.0004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  16  12...............................................FYDEATSTISYLVMDRETCALIDSVLDASADRLVERVNELNAS---VRWVLETHVHADHLSAAAYLKEKLGGHTAIGA-HITQVQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMI----EDAGEIAVFVGDTLFMPDYGTARCDFPADARTLYRSIRRLLAFPDQTLFMCHDYLPGGRDVTTVAEQRASNIHIHQGIDEDSFVAMREARDKTLEMPV...... 261
60 -26.7004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  17  1MRLFSLSTALSSAMIALVSLPLQAAAPAQQKTQ---DFEVTALYDGYVDLPASAVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPEGMAPYAKMNKLKPYKTEGELLPG---VSLVASPGHTPGHTSYLFKSGGQ----SLLVWGDILLNHAVQFAKPEFDVDSDQARQSRQRILAEAATWVAGAH.................................................... 294
61 -26.6004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  17  1MRLFSLSTALSSAMIALVSLPLQAAAPAQQKTQ---DFEVTALYDGYVDLPASAVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPEGMAPYAKMNKLKPYKTEGELLPG---VSLVASSGHTPGHTSYLFKSGGQ----SLLVWGDILINHAVQFAKPEFDVDSDQARQSRQRILAEAATWVAGAH.................................................... 294
62 -26.6003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  15  9...............................................FYDEGLAHASYLVGCQETACVIDP--ARDVEPYLLTAKREGLR---IVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEWKSEYVKAYPH------------RLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKTSPSGDFVFVGDVGLLERVAGESGSSEALARQMFRSLRKFEALPDHVQVPAHGAGSACGKALGAVPEKLVNWALQHKDEDAFVQALLA................ 241
63 -26.5001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  16  96.....................................................SVTGYLVNTGSKLVLVDTGAAGTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMVGEQLANAVVRADQKEADFWLSQTNLDKAPDDESPYVKAGKFKPFSGNTDLVPG---IKALASHGHTPGHTTYVVESQGQ----KLALLGDLILVAAVQFDDPSLDSDSKSVAVERKKAFADAAKLIAASH.................................................... 302
64 -26.1003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  13  24...............................................FYDKHLSQASYLIGCQKTAMIIDP-----IRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLGYKNMPNHT-------------HFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGASGDFIFVGDIGLLEKAVKVEGSSEIGAKQMFKSIESIKDLPDYIQIPGHGAGSPCGKSLGAIPEKQTNWAFSENNEATFIDKLIS................ 255
65 -26.0002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  15  10.....................................LNSIPAFQDNY--------IWVLTNDEGCVIVDPG---EAAPVLKAIAEHKWM---PEAIFLT----DHVGGVKELLQHFQMTVYGPAET--------------------QDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSR--PYLFCGDTLFSGGCGRL---------FEGTPSQMYQSLMKINSLPDDTLICAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERK..... 215
66 -25.7001vme_A mol:protein length:410 Flavoprotein  ali model follow..  18  12.....................................TERIFDDPEIYVLRIDDYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKI-VDPKEITHIIVNHTEPDHSGSLPATLKTIDVEIIASNFGKRLLEG-------------FYGIKDVTVVKDGEEREIGGKKFKFVMTP-HWPDTMVTYLDGILFSCDVGGGYLLPEILDDSNESVVERYLPHVTKYLEGAEKLSSLKIKALLPGHGLILNHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKEK....... 287
67 -24.2002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  12  8.....................................VQDQEMIPGVYWVGISSYNSYFID-DECPTVIDSVKYPFAEEWLSRIAAC-CPLDKIKYVVMNHAEGDHASSLKDHYHKFNATFVCTKKCQEHLKILYGMEKATW-----------LIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCPEDKILFSNDGF-HYATSRRWADECDVSHVMHLFKEYRKALEVASTVEIKYILSAHGVSIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCETV.. 289
68 -23.9002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  16  3.....................................AAAKRISDGVYWTGVTTYNAYLVCGDEGVALIDNSYPGTFDELMARVEDAQVGMERVDYIIQNHVEKDHSGVLVELHRRFEAPIYCTEVAVKGLLKHYPSLREAE-----------MTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLDEDGILFSNDARLDREIPEYILMDAARKFYANLITPLLKKFDEVKELRIQMIAPSHGQIWTDPMKIIEAYTGWATGMVDERVTVIYTRKMAHAIAEGAMSEGVDVR.. 289
69 -23.7004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  9.....................................VQVLPIATNTKVLRARSSNSYVIE-GDKTAIIDPPVESFMKIYLEALQQT-VNLKKLDYVILGHFSPNRIPTFKALLELAQITFVCSLPAAGDLRAAFPDDNLNI-----------LPMRGKETLDLGGHVLKFLPIP-RWPAGL-CTYDVQTQILYTDKIFGAHICGDDVFDDNWESFKEDQRYYEAALEKISDLQVRLYAVGHGP.................................................. 233
70 -22.4001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  14  1.....................................MQATKIIDGFHLVGATTYNAYLVE-DEKTTLFDTVKAEYKGELLCGIASV-IDPKKIDYLVIQHLELDHAGALPALIEACPEKIFTSSLGQKAMESHFHYKDWPV-----------QVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFADEKVLISNDIRFSDQIPVHTLERAMREYYANIVNPYLKAIETLVGVAPEFICPDHGVIFRGADQCTAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVK.. 285
71 -21.6001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  16  2......................................QPVAITDGIYWVGATTYNAYLIV-DDKTALVDTVYEPFKEELIAKLKQI-KDPVKLDYLVVNHTESDHAGAFPAIMELCDAHVLCTQRAFDSLKAHYSHIDFNY-----------TIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVPEEALLLPNDAF-HIATSVRFDDQVDAGLIMDEAAKYTKKLDEIQKLAIKTIAPSHGIIWRKDPGR-AEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVK.. 284
72 -20.7004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  17  3........................................IVVKNNIHWVGQSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNE-IDLADIDYIVINHAEEDHAGALTELMAQIDTPIYCTANAIDSINGPEWN----------------NVVKTGDTLDIGNGQLIFVETP-HWPDSMMTYLTGDAVLFSNDALFNDEVDQTELFEQCQRYYANILTPFTPKITEILGLPVDMIATSHGVVWRDNPTQ-AADYQEDRITIFYDTMSNNTRMMADAIAQGIAETDPRVAVK 282
73 -20.0002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  15  29........................................................SLLLKKGNKEIVVDTG---QSENFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPVKIYTHKEDLSFYEKYKNNFVLIDKDAEIEERIPDKFLDEVFVVVKEEDGINVVTGCSHA-GILNILETARNRFGVSYISLIGGFHL----------RGMEEEKVKDIARKIEEYGVKKVLTGH.................................................... 249
74 -17.9002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  10  13.............................................LIRPLGAGGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSGRTFMTHADYVKVSNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHA-GHVLGAAMFMIEIAG----VKLLYTGDFSRQEDRHLMAAEIPEREARFCNTVHDIVNRGGRGLIPVFA-LLILDEYWQNHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIRKQINI 299
75 -17.7003h3e_A mol:protein length:267 uncharacterized protein Tm1679  ali model follow..  15  12..........................................LCDDS-FESEHGFSVLV-----DSVLFDTG---KSDVFLKNARKLGIDLPKD--VLISHGHYDHAGGLLYLSGKYNTGKFVIERITEIANLRGKVPTGDFFVERNGERRKDLFEDEQTLVVRTKEGLVVITGCSHR-GIDNILLDIAETFNERIKMVVGGFHL----------LKSSDDEIEKIVKAFNELGVETVVPCH.................................................... 230

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 3 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]