current user: public

anford Burnham Prebys Medical Discovery Institute
Please be advised that due to the planned maintenance our websites might be temporarily unavailable on December 17-18, 2018. We apologise for the inconvenience that this may cause.

Query: 3q6v_A mol:protein length:233 Beta-lactamase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MSEKNLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAPKLast
1 -104.0003q6v_A mol:protein length:233 Beta-lactamase  ali model  100  1MSEKNLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAPK 233
2 -93.9001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  59  1...AGMSLTQVSGPVYVVEDNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEKLGNLSFADVKAYPQTLERLKAM----KLPIKTVIGGHDSPLHGPELIDHYEALIKAAPQ 226
3 -84.6003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  17  12.RFGDLVFRQLAPNVWQHTSFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFP----KASMIVMSHSAP-DSRAAITHTARMADKLR. 237
4 -84.5004tyf_A mol:protein length:231 NDM-4  ali model follow..  17  6.RFGDLVFRQLAPNVWQHTSFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFP----KASMIVMSHSAP-DSRAAITHTARMADKLR. 231
5 -84.2005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  17  18.RFGDLVFRQLAPNVWQHTSFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFP----KASMIVMSHSAP-DSRAAITHTARMADKLRL 244
6 -83.7004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  17  18.RFGDLVFRQLAPNVWQHTSFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGAADTEHYAASARAFGAAFP----KASMIVMSHSAP-DSRAAITHTARMADKLR. 243
7 -83.1004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  17  21.RFGDLVFRQLAPNVWQHTSFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFP----KASMIVMSHSAP-DSRAAITHTARMADKLR. 246
8 -82.9003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  17  19.RFGDLVFRQLAPNVWQHTSFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFP----KASMIVMSHSAP-DSRAAITHTARMADKLRK 245
9 -81.7004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  17  45.RFGDLVFRQLAPNVWQHTSFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMV----------AAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSLGNLGDADTEHYAASARAFGAAFP----KASMIVMSHSAP-DSRAAITHTARMADKLRL 271
10 -81.1003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  29  2.VKDFVIEPPIKNNLHIYKTGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGK------------------ATSTEIIKTGYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNLGYIKEANVEQWPKTINKLKAKYS----KATLIIPGHDE-WKGGGHVEHTLELLNK... 218
11 -80.8001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  25  1....DVKIEKLKDNLYVYTTGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKEN------------------KPRAQYTFDNNFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSALGYIGEAYVNDWTQSVHNIQQKFS----GAQYVVAGHDD-WKDQRSIQHTLDLINEYQQ 217
12 -80.7002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  23  12NETGTISISQLNKNVWVHTEGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNG------------------YEEPLGDLQTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTLGNVADAYVNEWSTSIENVLKRY----RNINAVVPGHGE-VGDKGLLLHTLDLLK.... 228
13 -80.7002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  23  6NETGTISISQLNKNVWVHTEGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNG------------------YEEPLGDLQTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTLGNVADAYVNEWSTSIENVLKRYR----NINAVVPGHGE-VGDKGLLLHTLDLLK.... 222
14 -80.5004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  23  10.LPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKLSSHPVPADNVFDLKQGFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKLGYLGDANVKAWPDSARRLKK------FDAKIVIPGHGE-WGGPEMVNKTIKVAEKAVG 246
15 -80.4001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  25  7.ISDDISITQLSDKVYTYVGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKG------------------LPVPEHGFTDSVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNIGNISDADVTAWPKTLDKVKAKFP----SARYVVPGHGD-YGGTELIEHTKQIVNQYIE 227
16 -80.3001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  25  6KISDDISITQLSDKVYTYVGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKG------------------LPVPEHGFTDSVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNIGNISDADVTAWPKTLDKVKAKFP----SARYVVPGHGN-YGGTELIEHTKQIVNQYIE 227
17 -80.2003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  22  6NETGTISISQLNKNVWVHTEGEAVPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNG------------------YEEPLGDLQTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTLGNVADAYVNEWSTSIENVSKRY----RNINAVVPSHGE-VGDKGLLLHTLDLLK.... 222
18 -79.7005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  21  21IPVGEVRLYQIADGVWSHIAGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNE--------------IPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALAGNVADADLAEWPTSVERIQKHYP----EAEVVIPGHGLP-GGLDLLQHTANVVTAHKN 243
19 -78.3004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  22  4.RLPDLKIEKLEEGVYVHTGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVE-RGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDG------------------KVQAKNSFSGSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDLGNLGDANLEAWPKSAKILMSKY----VKAKLVVSSHSE-IGDASLLKRTWEQAVKGLN 219
20 -77.8002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  21  3.GHKPLEVIKIEDGVYLHTGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREG------------------KPVPTHYFKDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHLGYVGDASISSWADSIKNIVSKK----YPIQMVVPGHGK-VGSSDILDHTIDLAESASN 221
21 -77.8004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  22  3.SLPDLKIEKLDEGVYVHTGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVE-RGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDG------------------KVQATNSFSGNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYLGNLGDANIEAWPKSAKLLKSKYG----KAKLVVPSHSE-VGDASLLKLTLEQAVKGLN 218
22 -77.0004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  21  39IPVGEVRLYQIADGVWSHIAGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNE--------------IPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELAGNVADADLAEWPTSVERIQKHYP----EAEVVIPGHGLP-GGLDLLQHTANVVKAHKN 261
23 -77.0002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  22  40.PVGEVRLYQIADGVWSHIDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNE--------------IPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELAGNVADADLAEWPTSIERIQQHYP----EAQFVIPGHGLP-GGLDLLKHTTNVVKAHTN 261
24 -77.0002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  22  38IPVGEVRLYKIGDGVWSHIADTVYSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPAHS--------------LKALSSSGDVVRFGPVEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEAAGNVADANLAEWPATIKRIQQRYP----EAEVVIPGHGLP-GGLELLQHTTNVVKTHKV 260
25 -76.4005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  21  20.GHKPLEVIKIEDGVYLHTSFKNVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREG------------------KPVPTHYFKDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHLGYVGDASISSWADSIKNIVSKK----YPIQMVVPGHGK-VGSSDILDHTIDLAESASN 238
26 -76.0004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  23  2DEVPELRIEKVKENIFLHTSFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRK-NGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKE-------------------PAKYTLKESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLLGYTGEAHIDQWSRSAQNALSRYS----EAQIVIPGHGK-IGDIALLKHTKSLAETASN 221
27 -35.5002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  14  5......SSGLVPRGSHMLR--GDVQVPVFLLRGEASWALVEGGISRD-AELVWADLCRADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAQLLRAEQRLPEACAWDALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDAL-GVWRPLVFDDMEAYLESLERLQRL------TLLQLIPGHGGLLRGRLAADGAESAYTECLR 257
28 -34.4001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  13  18..LQPMAPLQIADHTWQI---GTEDLTALLVQTPDGAVLLDGG-MPQMASHLLDNMKARTPRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMD---GEVITVGGIVFTAHFM-AGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGHLIEDYRRSFATVRA------LPCDVLLTPHPGASNWDYAAG........... 236
29 -34.1004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  14  38..NDPAMPQKVYGNTWYV---GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALGFRPVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIV-TLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRSCEMVYADSLTAISDDVYRYSDDAAHPGYLAAFNTLARVAALDCDILVTPHPSASGLWNRIG........... 261
30 -33.8003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  14  35..TAPFEPFQLIDNIYYV---GTDGIAVYVIKTSQGLILMDTA-MPQSTGMIKDNIAKLKVADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKVDRAVKE---GDRVTLGDTTLTAHAT-PGHSPGCTSWEMTVKDGKEDREVLFFCSGTVAAGIVDDYRATFAKAKA------MKIDVLLGPHPEVYGMQAKRAEMKD....... 257
31 -33.7004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  14  38..NDPAMPLKVYGNTWYV---GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALRPEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIV-TLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRSCEMVYADSLTAISDDVFRYSDDAAHPGYLAAFNTLARVAALDCDILVTPHPSASGLWNRIG........... 261
32 -33.4005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  19  11..NADQAPFRLFGNTYYV---GMKGLSSVLVTSPQGHVLIDGG-LPESAPKIIANIGALRIEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVGPDDPQYHALPKYPPVKDMR--ARDGGQFNVGPVYLTAHAT-PGHTPGGLSWTWQSCDMVYADSINAVSRPGFKFSASSEYPNALADLRSFETLEKLPCDVLISAHPEASQLWQRLEASAT....... 238
33 -33.3001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  12  5..PNPFPPFRIAGNLYYV---GTDDLASYLIVTPRGNILINSDLEAN-VPMIKASIKKLKFSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKSDFHYANDSSTYFTQSTVDK-VLHDGERVELGGTVLTAHLT-PGHTRGCTTWTMKLKDAVIIGSIGVNPGYKLVDKIAEDYKHSIKVLES------MRCDIFLGSHAGMFDLKNKYVLLSK....... 230
34 -33.2003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  16  6..SSPQQPFTIYGNTHYV---GTGGISAVLLSSPQGHILVDGT-TEKGAQVVAANIRAMKLSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVR-AVADGELVKLGPLAVKAHAT-PGHTEGGITWTWQSCEVVFADSLTAVSADSYRFSDHPEVVASLRG--SFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAK....... 230
35 -32.6002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  15  1.......MKALLPGLYLLPPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHLGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEASWRLFLDHGTPEGALQGIRETVEKTRERVHPPQNPLEALEVAGKRLRVLW-TPGHADGHAAFYLEEEGVLLAGDALLEKVSP-RENPLKDFLRSLDRLAD------LGARVAYAGHFGPIADEELKAHHQARLEALLA 260
36 -31.6005aeb_A mol:protein length:272 LRA-12  ali model follow..  18  18..SKPYRPFRIAGNLYYI---GTYDLACYLITTKQGNIIVNTGLAAS-ALQIKNNIKALGFKLTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSSDYAFGGHG----SMFEPIIADRLLHDTIQLGDTKLVMLHH-PGHTKGSCSFLFDTKRILIANMPTIVIEKKFSEGIAKDYAYTLQAMKN------LSFDIWVASHASQFSMHSKHKP.......... 239
37 -31.5002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  14  9.....................GPLQENAYLVETGEGPVLIDPGDE---PEKLLALFQT-TGLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLAARAW------GLAIPKPPLPVRPLEEGMRL---GFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPGADPKALFASLKRLLSLP--PETRVHPGHGPGTT................. 189
38 -30.7003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  14  20.........................ATVYVMCGEKLTVMIDAGVSNSIADFSFL-------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDGLKKLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYT-PGHARHHMSVLV--DDFLFTGDSA--IPTTPPVIDYKMYMESLKRQIE------LKPKVVGFAHGGLVSPKIMEEHLKQMLSKEE. 228
39 -29.1002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  13  6..........HRPDLYTFNPARNIDFNGFAWIRPEGNILIDPV---ALSNHDWKHLESLGG--VVWIVLTN--SDHVRSAKEIADQYTKIAGPVAEKENFPIY----------------------CDRWLSDGDELVPG-LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYLEILPDEKLMNKQKVVASVRRLAALE--KVEAVLVGDGWSVDGRDRLKELVATL..... 200
40 -28.8001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  14  4DKIMELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSS-MDELEEKFSELGISPITDVLFTHVHLDHIFNSVLFE--NATFYVHEVYKTKNYLSFGTIVG-----RIYSKVISSWKNVVLLKGEESLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVG-----RIDLLVFPHDAPL.................. 209
41 -25.0004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  17  12LSNRVVRVLGCNPGPMTLQG-----TNTYLVGTGPRRILIDTGAIPEYISCLKQALTE-FNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKD----------GDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCIL-GEGTTVFEDLYDYMNSLKELLK------IKADIIYPGHGPVIHNAE.............. 208
42 -24.9002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  14  47.............................LIQCTDATVLYDTGCHPECMCNLPERLRQLGLSPISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEATAVRYFATGDHSSPYIVKDIEAWLATPRNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVRLEKFLLVSDACYPARRAGVLHDTIGYDRTVSHIRQYAESRSL---TVLFGHDR.................... 261
43 -24.6005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  14  23......DTFEVAPGVRWLR-------NLWLL-GQAGWTIVDCGISSEAIRTHWEQIRHLDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTAAAADHFARHGLTDPAALDKLRSRRSYYSDLVPAVPPRDAVKIGARTWRVVT-GYGHSPEHCALHSEADGVLISGDMVLPRISTNVSNPLALYLESLGRYETMAPD-----TLVLPSHGKPFRGAQLRAHHDARLEEVRV 298
44 -24.4002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  11  11.......................FSQNCSLIWCEQTAALVDPGGD---AEKIKQEVDA-SGVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQGLPAQSRM------GLDECQPLTPDRWLNDRVSVGNVTLQVLHC-PGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLPLG-DDVTFIPGHGPLST................. 197
45 -24.3004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  11  68.........................AEAALEEAARGPILVDTGGPWAR-EALLGALAGQGVAPVTLVVGTHGHSDHIGNLGLFP--GAALLVSHDFCLPGGRYLPH--------------------GLGEGQPLRLGPG-LEVWAT-PGHGGQRDVSVVVAGTVVVAGDVFERDSWQALSEDPAAQERSRKRVLVV-------ADVVVPGHGPPF.................. 235
46 -23.3003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  15  39.............................LIEHAEGRFLIDTGYDYEKHQTIPGALGLLGLEPIDVVVNSHFHFDHCGGNKYFP--HAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATEGIDGDVDLARG-VKLIST-PGHSIGHYSLLVEFPRILFTIDAAYTQKTLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDM.................... 254
47 -23.2004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  12  5.KPRDVQVLPIATNTKVLRARSGTTSNS-YVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRA---------------FPDDNLNILPMRGKETLDLGKGVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFHICGDDVFDDNWESFKEDQRYEAALEKISDLQVRLYAVGHGPLVRTIALTQAYADWSKAQKL 255
48 -23.2002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  14  1MDMTVKKLYFIPAGRCMLDHSSVNSALCYLLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLN-----------KIIEGDYEVVPG-VQLLYT-PGHSPGHQSLFIKTEQVLLTIDASYENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQ---KSCRVFPEYI..... 252
49 -23.1003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  14  3ISMTVKKLYFIPAGRCMLDHSSVNSALCYLLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLN-----------KIIEGDYEVVPG-VQLLYT-PGHSPGHQSLFIETEQVLLTIDASYENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQ---KSCRVFPEYI..... 254
50 -22.7001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  20  9.......................LKDNYAYILHDEDVGVVDPSEAEPIIDSL-----KRSGRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAMDKDRIPGIDMALKD---------------------GDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSSCGKLFEGTPKQMLASLQKITSL------DDTSIYCGHEYTLSNSK.............. 177
51 -21.1001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  17  9.......................LTDNYMYLVIDDEAAIVD----PVQPQKVVDAARK-HGVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGGDDRIGALTHKITH------------------------LSTLQVGSLNVKCLAT-PCHTSGHICYFVSEPPAVFTGDTLFAGCGKFYEGTADEMCKALLEVLGRLP----PDTRVYCGHEYTINNLK.............. 181
52 -20.1001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  11  1.....MQATKIIDGFHYTLSPMGTTYNA-YLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESH--------------FHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDILERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVIFRGADQCTFAVQKYVEYAE 248
53 -20.0002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  12  31.......................LKDNFSYLINDHTLAAVDVNAD---YKPILTYIEEHLKQTFSTILSTHKHWDHSGGNAKLKAE-LEAMNSTVPVVVVGGANDSIPAVTKPVRE--------------GDRVQVGDLSVEVIDA-PCHTRGHVLYKVQHPQALFTGDTMFIGIGAFFEGDEKDMCRAMEKVYHIHNDYALDKVTFI-GHEYTSGFMT.............. 228
54 -19.7002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  13  2....KAAAKRISDGVYWTGVLDGTTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREAE-------------FMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDALMDAARKFYANLITPLSKLVLKKFDEVKELGLRIQMIAPSHGQIWTDPMKI............ 243
55 -19.0001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  16  2......QPVAITDGIYAFSTHRGTTYNA-YLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKAH--------------YSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKGRIIEAYARWAEGQGK 251
56 -18.8003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  11  1MKIGDISIHYLNGGNTKMDGGA-LPTHPILIQTAQYNLIIDAGIGNGKESHIIADLANLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPG-IKMQHSG-GHSFGHTIITIESDKAVHMGDIFPTTAPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYH...................... 251
57 -18.7002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  13  4.KPKYVQDQEMIPGVY-YHTDEGSSYNS-YFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKI---------------YGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGF-TSRRWADECDVSHVMHLFKERKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSK. 251
58 -18.7004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  14  4.........VVKNNIHEYKTLRGSSYNS-YLIREEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPEWNFNVVKT------------------GDTLDIGNGQLIFVETPMLHWPDSMMTYLTGDAVLFSNDALFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDTQIVELYLKWAADYQE 247
59 -18.1004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  10  35.RGNVAELKTILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGFSAITDIFLSHAHPDHIGGKLVFPNASIFISKIEINASIKDFNNSALKAHPERLNQIIPALQNIL--KAIQPKLKFYDLNKTLYQLAPGHTPGLTVTTISSEKLMYVADLIHSDVILFPDTDLDIATASRKKFLKQLADTKATSHLPWPGLGFTKVKAPGFE........... 286
60 -17.9004nur_A mol:protein length:633 PSdsA  ali model follow..  18  89.......LFEVTDGIYQVRNYD--LSNMTIVEGKDGITIFDPLISQETAKAALDLYYKRPKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAENVMAGTAMSRTTTSAGTVTLIPPTDIIKETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTLHNTYSRDPLAWSKYLNEALKLWGD---DVQVMYAMHHWPVWGNKEVREQLSLQRDMYR 348
61 -17.8001vme_A mol:protein length:410 Flavoprotein  ali model follow..  14  7MPKIWTERIFDDPEIYVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEGFYGIKDVTVVKDG----------------EEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGPEILDDSNESVVERYLPHVTKLEGAEKLSSLKIKALLPGHGLIWKK................ 240
62 -17.8004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  13  28................................ESREAVLIDP----ETAPRDAQLIKEL-GLRLLYAVNTHCHADHITGSGLLRSLGCQSVISRLSGAQADLHIED------------------------GDSIRFGRFALETRAS-PGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLP-GDCLIYPAHDYHGFTVSTVEEERTLNPRLTL 201
63 -17.8002cfu_A mol:protein length:658 SDSA1  ali model follow..  15  107.......LFEVAEGIYQVRGFD--LANITFIRGDSGWIVVDTLTTPATARAAYELVSRLGERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKENVLAGNAMMRKGLARGPLSLLAPTRLIEEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTLHNLYTRDALGWSKYINQALHRFGR---QAEVMFAVHNWPRWGNAEIVEVLEKQRDLYG 366
64 -17.6004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  16  89.......LFKVTDKMYQVRGQD--ISNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQRPQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISENVLAGNIMSRVTLATGDPSIIAPTKTIVEKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENATHTLHNFYTRDTSKWTEYLNETLDMWGN---DAEVLFMPHTWPVWGNKHINDYIGKYRDTIK 348
65 -17.3002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  15  117.......LFEVMPKLYQVRGLD--PANMTIIEGDSGLVLIDTLTTAETARAALDLYFQRPKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSENAQVDSGLFKTTATNATNTLVAPNVLIEERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPAMHNLLTRDAKAWAGYIDASLEKYGD---RTDVLIQQHNWPVWGGDKVRTYLADQRDMYA 377
66 -17.3001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  13  98..........................TGYLVNTGSKLVLVDTGAAGLFGPRLAANLKAAGYQPVDEIYITHMHPDHVGGLMVGEQLNAVVRADQKEADFWLSQTNLDKAPDDESKGFFKGAMASLNPYVKAGKFKPFSGNTDLVLASHGHTPGHTTYVVESQKLALLGDLILVAAVQFDDSDSKSVAVERKKAFADAAKGGYASHLSFPGIGHIRAEGKGYR........... 319
67 -17.3004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  10  69......DLQSLLARMFVASEKGVQTANAYLINTGDNLVLIDTGAAQCFGPVVQTNLKASGYQPVDTVLLTHLHPDHACG--LVNADGSPAYPNATVEVPQAEDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGELLVASSGHTPGHTSYLFKSQSLLVWGDILINHAVQFADVDSDQARQSRQRILAEAATDKLGAHLPFPGLGHVREEAQGYA........... 311
68 -17.3004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  10  90..........................NAYLINTGDNLVLIDTGAAQCFGPVVQTNLKASGYQPVDTVLLTHLHPDHACG--LVNADGSPAYPNATVEVPQAEDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEGELLVASPGHTPGHTSYLFKSQSLLVWGDILLNHAVQFADVDSDQARQSRQRILAEAATDKLGAHLPFPGLGHVRKEAQGYA........... 311
69 -17.1004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  11  59..........................NAFLVNIGKSLILIDSGAASCFGSSVLSNLKASGYQPVDTILLTHLHPDHVCGISKDGVANATVYVSNDEASFWLDPKQAAKLPKEKQANYLGTVEKIKQAIAYQAKQRFKTYKLGDDIQGAGHTPGHFSYELKTESIVFIGDIVHSHTVQFDRPETADPKKAVETRLKQFANFAKNGQTIAAPH...................... 265
70 -16.3004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  13  22................................ATRQAVLIDP----EQVDRDLQMVAEL-DLTLTHVFDTHVHADHITASGALRERQATVVGSVNGASCANVQVRH------------------------GDEVRVGQLVFQVLAT-PGHTDDSISYLLGDR--VFTGDALLVRGNGRTDFQNGNASQLYDSLTRVLFTLP-DETLVYPGHDYKGRTVTSIAEEKRH...... 186
71 -16.1002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  15  27.................................DKPALLIDP----KTVDRDLKLIDEL-GLKLIYAMNTHVHADHVTGTGLLKTKGVKSVISKASGSKADLFLEP------------------------GDKVSIGDIYLEVRAT-PGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLP-KDTLIYPAHDYKGFEVSTVGEEMQHNPRLTK 205
72 -15.5003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  13  1...........SNAMYLRRFYDEGLAHASYLVGCQEACVID----PARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAICVSDEGPPEWKSEYVKAYPHRLLKD---------------GDELHFGNVRIVVMHT-PGHTPEHVSYLLYDGKALFSGDFVFAGESGSSEALARQMFRSLRKFEAL------DHVQVLPAHGAGSACGKALGAVPSSTVGYEK 221
73 -15.4002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  10  3........SKAKTTVTFHSGILTIGGTVIEVAYKDAHIFFDFGTETLINNRLVPELKDLYDPRLGYVFLSHAHLDHS-RMINYLDPAVPLYTLKETKMILNSLNRK----DFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDAYGASALLPDHFITYTGDLRLHGHNREETLAFCEKAKHTELLMMEGVSISFPEREPDPAQIAVVSEEDLVQHLVRLELENPN 253
74 -14.8003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  15  16...........SNAMFFKQFYDKHLSQASYLIGCQKAMIID----PIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDDTLGYKNMPNHTHFVQHN----------------DDIYVGNIKLKVLHT-PGHTPESISFLLTDEGGLFSGDFIFVKVEGSSEIGAKQMFKSIESIKDL------DYIQIWPGHGAGSPCGKSLGAIPTSTLGYEK 235
75 -14.3003x2x_A mol:protein length:227 UPF0173 metal-dependent hydrolase TM_1162  ali model follow..  10  8.........................GHAVVLIEGKKNIIID----PFISGNPVCPVKLEGLPKIDYILVTAGHGDHLGDAVEIAKKDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIY------GGNPSGFLITIEGKKIYHAGDTLTREMELLAEENVD----VMDVEDAVRAAVMIKPKKVVPMH...................... 191

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 3 1 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13.