current user: public

anford Burnham Prebys Medical Discovery Institute
Please be advised that due to the planned maintenance our websites might be temporarily unavailable on December 17-18, 2018. We apologise for the inconvenience that this may cause.

Query: 3vpe_A mol:protein length:262 Metallo-beta-lactamase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst QDRDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEKRLast
1 -111.0003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model  100  1QDRDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEKR 262
2 -104.0005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  45  6VCATWNADQAPFRLFGNTYYVGMKGLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGEVGPDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGFKFSEYPNALADLRHSFETLEKLPCDVLISAHPEASQLWQRLEASATGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQ 270
3 -101.0001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  28  2..YPMPNPFPPFRIAGNLYYVGTDDLASYLIVTPRGNILINSDLEANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYANDSSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKLDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQET 262
4 -99.5005aeb_A mol:protein length:272 LRA-12  ali model follow..  26  13SNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSS-DYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN.. 272
5 -98.3003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  29  31.MKKWTAPFEPFQLIDNIYYVGTDGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKNED--LAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGMQAKRAEMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQTA 289
6 -97.6004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  45  33DDAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVYRYSDHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIG---PRAAAPLMDTTACRRYAQGARQRLEKRLAEEAA 294
7 -96.8004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  45  33DDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIG---PRAAAPLMDTTACRRYAQGARQRLEKRLAEEAA 294
8 -93.3001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  31  14.DASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGG--SDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAG------ARAGAKALTCKAYADAAEQKFDGQLAKETA 266
9 -50.1002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  17  4................FPVTLGPLQENAYLVETGEGPVLIDPG--DEPEKLLALFQTTGLI---PLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEG---ADLAARAWGLAIPKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSV---GRYDLPGADPKALFA----SLKRLLSLPPETVHPGHGPGTTLGLEAR------TNPFLTGLEWEA.................. 207
10 -48.0002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  17  15....MLRLSAPGQLDDDLCLLGDVQVPVFLLRLGESWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLNVQVLASERTCQAWKSESAVRVVERLNRQLL-WDALPVRAVADGEWLELGPHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDAL-----EFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLQLIPGHGGAADGAESAYTECLRLCRRLLWRQSMGESLDELSEELHRAWGGQSV 288
11 -47.4003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  15  20.........................ATVYVMCGEKLTVMIDAGVSNSIADFSF--------LDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVD--------DFLFTGDSAGAYFNGVVIPTTPP-YKMYMESLKRQIELKPKVVGFAHGGLVSHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS 260
12 -45.0002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  21  4................RIIPVTAFSQNCSLIWCEQTAALVDPG--GDAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHYGVPVI-GPEKEDEFWLQGLPAQSRMFG-LDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGV---GRSDFPRGDHTQLIDAIK---RKLLPLGDDVFIPGHGPLSTLGYERL------HNPFLQD....................... 210
13 -42.3001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  17  30..........................TVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFEN---ATFYVHEVYKTKNYLSFGTIVGRIYSKVI---SSWKNVVLLKGEESLFDE-KVKVFHTPWHAREHLSFLLDTENAG---RVLITGDITPNRLSYYD-IIKGYGSVQVKNFLDRVGRI--DLLVFPH............................................... 205
14 -40.5002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  18  3............ALLPGLYLLPLKTVNLYLLQGAGEVALVDTATRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEG-LGARVFLHEEEFARGHRFWREPEAFAEASWRLFHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTREN----LKDFLRSLDRLADLGARVAYAGHFPIADVRQRAEELKAHHQARL---EALLALLDGPKTAWE........ 270
15 -36.1004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  21  68.........................AEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPG---AALLVSHDFCLPGGR-------------------YLPHGLGEGQPLRLGP-GLEVWATPGHGGQRDVSV--VVAGTALGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV-ADVVVPGHGPPFRVLREASQ................................... 243
16 -35.7002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  15  20.....................RNIDFNGFAWIRPEGNILIDP--VALSNHDWKHLESLG----GVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENF-------------------PIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLE-ETTLITGDLVRAYR---AGGLEILPDEKLMNKQKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKE................................. 195
17 -35.6004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  17  6............PILLRQMFEPVSCTFTYLLGDRESAVLIDPVL-ETAPRDAQLIKELGLR---LLYAVNTHCHADHITGSGLLRSLLPGCQSVISR----------------------LSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGC---GRTDFQQGCAKTLYHSVH---EKIFTLPGDCLIPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQI..... 221
18 -35.3002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  13  43.........................VSAYLIQCTDATVLYDTGCHPECCNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDEFATAVRYFATGDHSSPYIVKDIEARNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVRLEKQP----FLLVSDACYTATNYGPPARRAGVLHDYDRTVSHIRQYAESTVLFGHDREQ........................................... 263
19 -34.9003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  16  35.........................VYSILIEHAEGRFLIDTGYDYDHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFP---HAKKICHRSEVPQACNPQAEARGATAQLLEGTTRANSTFEGIDGDVDLARG--VKLISTPGHSIGHYSLLVEFPRRKFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRK-VKKLAEDHGAELMYSHDMDN........................................... 256
20 -34.8002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  16  1...........MKLLFRQLFENESSTFTYLLHPDKPALLIDPVD-KTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKA----------------------SGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGADQPQPRMAFTGDAVLIGRTDFQEGSSDQLYESVH---SQIFTLPKDTLIPAHDYKGFEVSTVGEEMQHNPRLTKDKETFKTIMSNLNLSYPKMI..... 225
21 -34.7003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  18  39.........................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKE-CILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIETEQSGSV--LLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGH............................................... 239
22 -34.6002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  18  37.........................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKE-CILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIKTEQSGSV--LLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGH............................................... 237
23 -34.6004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  15  1.............MIFRQLFDSESSTYTYLIGDEATAVLIDPVL-EQVDRDLQMVAELDLT---LTHVFDTHVHADHITASGALRERTQATVVGSVNGASCA-----------------------NVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLG--DRVFTGDALLVRGN---GRTDFQNGNASQLYDSLT---RVLFTLPDETLVPGHDYKGRTVTSIAEEKRH--NPRVAGKSREEFIHIMEN........... 204
24 -34.3005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  15  23.....VGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAGAKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEAEGNE-----------IPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAN------VLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGG.......................................... 227
25 -33.9001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  21  14...........................AYILHDEDTVGVVDPS---EAEPIIDSLKRSGRN---LTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRI--------------------PGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKL---------FEGTPKQMLASLQKITSLPDDTSICGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKA 216
26 -33.8004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  13  11.....PYNLTATKIDSDVFVVDFYSSNVLVAKMLDGVVIVSSPFENLTQTLMDWVAKT--MKPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRLEENKKDRIKAAELSSHPVPADNVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGDAN---------VKAWPDSARRLKKFDAKIVIPGHGEWGG.......................................... 230
27 -33.7002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  18  8.....TGTISISQLNKNVWVHTELGSNGLVLNTSKGLVLVDSSDDKLTKELIEMVEKK--FQKRVTDVIITHAHADHIGGIKTLKER-GIKAHSTALTAELAKKNGYE---------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEVGD.......................................... 210
28 -33.5004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  14  41.....VGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAGAKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEAEGNE-----------IPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAN------VLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGG.......................................... 245
29 -33.4003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  17  3.....KDFVIEPPIKNNLHIYKEYSANSMYLVTKKGVVLFDVPWEKVYQSLMDTIKKR--HNLPVVAVFATHSHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKDGKA---------------TSTEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFPKYN------VLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKKATLIIPGHDEWKG.......................................... 205
30 -33.4004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  16  20.............LGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGN----------GEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFED-----------LYDYMNSLKELLKIKADIIYPGHGPVIHNAEAK--------------QQYISHRNIREQQILTLFRENFE 234
31 -33.3004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  16  19.....FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAKASMIVMSHSAPDS.......................................... 228
32 -33.3004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  13  4.....VPELRIEKVKENIFLHGLVSSNGLVVIDKGNAFIVDTPSDRDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIKWLNDQ-SISTYATTSTNHLLKENKK----------------EPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPKSK------ILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSREAQIVIPGHGKIGDIAL----------------KHTKSLAETASNKSIQPNANASA 232
33 -33.2002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  17  14.....TGTISISQLNKNVWVHTELGSNGLVLNTSKGLVLVDSSDDKLTKELIEMVEKK--FQKRVTDVIITHAHASRIGGIKTLKER-GIKAHSTALTAELAKKNGYE---------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEVGD.......................................... 216
34 -33.2003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  16  3.....EKNLTLTHFKGPLYIVEYVQENSMVYIGTDGITIIGATTPETAETLYKEIRKV--SPLPINEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLDTVFPGDFNLQNGSIRAMYLEAHTKDGIFVYFPAER------VLYGNCILKENLGNMSFANRTEYPKTLEKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLT................................ 226
35 -33.2003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  18  8.....TGTISISQLNKNVWVHTELGSSGLVLNTSKGLVLVDSSDDKLTKELIEMVEKK--FQKRVTDAIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKNGYE---------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN------ILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRNINAVVPSHGEVGD.......................................... 210
36 -33.1001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  12  8.....SDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPINDATETLVNWVADS--LHAKVTTFIPNHWHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEKGL---------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTEN------ILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGDYGG.......................................... 211
37 -33.0001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  12  8.....SDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPINDATEMLVNWVTDS--LHAKVTTFIPNHWHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKGL---------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTEN------ILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGNYGG.......................................... 211
38 -32.9004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  16  22.....FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDS.......................................... 231
39 -32.9005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  16  19.....FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDS.......................................... 228
40 -32.8003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  16  13.....FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDS.......................................... 222
41 -32.7003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  16  20.....FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAA----------------THTARMADKLRKLVPRGSAAAA. 255
42 -32.7004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  14  5.....LPDLKIEKLEEGVYVHGVVSKHGLVVLVNTDAYLIDTPTATDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIEWLNSQ-SIPTYASELTNELLKKDGKVQAKNSF----------------SGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG---------DANLEAWPKSAKILMSKKAKLVVSSHSEIGD.......................................... 203
43 -32.6001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  16  2........VKIEKLKDNLYVYTKYAANAVYLVTDKGVVVIDCPWGEDFKSFTDEIYKK--HGKKVIMNIATHSHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKENKP---------------RAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFPKEK------VLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKGAQYVVAGHDDWKD.......................................... 201
44 -32.6002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  14  41.....VGEVRLYQIADGVWS-AVYPSNGLIVRDGDELLLIDTAGAKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEVEGNE-----------IPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAS------VLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHEAQFVIPGHGLPGG.......................................... 245
45 -32.5002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  13  40.....VGEVRLYKIGDGVWSHTVYSSNGLIVRDADELLLIDTAGAKNTVALLAEIEKQ--IGLPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAEAAGNE-----------VPAHSLKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVPAVR------VLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQREAEVVIPGHGLPGG.......................................... 244
46 -32.4004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  14  4.....LPDLKIEKLDEGVYVHGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKKDGKVQATNSF----------------SGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDAN---------IEAWPKSAKLLKSKKAKLVVPSHSEVGD.......................................... 202
47 -32.4004tyf_A mol:protein length:231 NDM-4  ali model follow..  16  7.....FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGLVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDS.......................................... 216
48 -32.3004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  16  46.....FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTD------IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDS.......................................... 255
49 -32.3001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  15  1......AGMSLTQVSGPVYVVYYVQENSMVYFGAKGVTVVGATTPDTARELHKLIKRV--SRKPVLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDWAEIVAKGLPEYPDLPLVLPNVVHDGDFTLQEGKVRA-FYAGPAHTPDGIFVYFPDEQ------VLYGGCILKEKLGNLSFAD----VKAYPQTLERLKALPIKTVIGGHDSPLHGPELIDHYEA................................ 219
50 -31.9002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  15  4.....HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPSEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGKPVPTHYF----------------KDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSK------ILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKPIQMVVPGHGKVGS.......................................... 205
51 -31.6005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  15  21.....HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPSEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGKPVPTHYF----------------KDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSK------ILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSYPIQMVVPGHGKVGSSDI----------------DHTIDLAESASNKLMQPTAE... 246
52 -30.8001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  20  3........VEVLPALTDNY--------MYLVIDDETAAIVDPV---QPQKVVDAARKHGVK---LTTVLTTHHHWDHAGGNEKLVKLEGLKVYGGDDRIGAL-----------------------THKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRL---PDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFT 220
53 -30.3005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  14  20......AAGDTFEVAPGVRWLSLDHINLWLLRGQAGWTIVDCGISEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGNVRLWMTLGEYMFGCLMAAGNGSNAGGAAAA-AVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALHSEADGVLISGDMVLPRISTNVSV--FDLEPEANPLALYLESLGRYETMAPDLVLPSHGPFRGVRTRIAQLRAHHDARLEEVRVACAEKPMSAAGIVPIMFRRRE 319
54 -29.3003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  15  47........................PTHPILIQTAQYNLIIDAGIGNEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHANAIHVVQQDEWHEFIAPN-IRSKSTYWDKNKGDYSNKLILFEKHFEPVPG---IKMQHSGGHSFGHTIITIESQGD----KAVHMGDIFPTTA-VTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVK....................................... 259
55 -28.7004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  19  57........................SINAFLVNIGKSLILIDSGAASHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISKDGVANNATVYVSNDEASFWLDPKQAAKLPK-QAIAPYQAKQRFKTYKLGDDIQ-----FKVINTAGHTPGHFSYELKTKGE----SIVFIGDIVHSHTVQFDRPETPKKAVETRLKQFANFAKNGQTIAAPHLPFPGIGHTYSADGKS............................... 281
56 -28.2003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  13  9..................FYDEGLAHASYLVGCQETACVIDP--ARDVEPYLLTAKREGLR---IVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEWKSEYVKAYPH--------------RLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKTSPSGDFVFVGDVGLLERVAGESGSSEALARQMFRSLRKFEALPDHVQVPAHGAGSACGKALGAVPSSTVNWALQHKDEDAFVQAL............. 239
57 -28.0004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  16  58........................AINILLVKTKEKLILMDTGMGIRTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLNASIFISKIEHDFWINASIKDFNNSALKAHP-AIQPKLKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTISSGNE----KLMYVADLIHSDVILFPHPDWLDIATASRKKFLKQLADTKARAFTSH............................................... 269
58 -27.4003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  14  24..................FYDKHLSQASYLIGCQKTAMIIDP--IRDLSSYIRVADEEGLT---ITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLGYKNMPNHT---------------HFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGASGDFIFVGDIGLLEKAVKVEGSSEIGAKQMFKSIESIKDLPDYIQIPGHGAGSPCGKSLGAIPTSTTNWAFSENNEATFIDKL............. 253
59 -27.3004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  20  10..................FFDPATCTISYLLFDSGSCALIDSVLDASADQLIARVAALGAR---VRWLLETHVHADHLSAAPYLKTRVGGEIAIGR---HVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARAAFVGDTLFMPDYGTARCDFPG-ARSLYRSIRKVLSLPPATLYMCHPNGRAIQYASTVADELRENVHIREGVTEDDFVAMRTARDATLDMPV. 265
60 -27.3004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  18  88........................AVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPE-QAVAPYAKMNKLKPYKTEGELLPG---VSLVASPGHTPGHTSYLFKSGGQ----SLLVWGDILLNHAVQFAKPEVSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVP........................... 314
61 -27.2004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  18  88........................AVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPE-QAVAPYAKMNKLKPYKTEGELLPG---VSLVASSGHTPGHTSYLFKSGGQ----SLLVWGDILINHAVQFAKPEVSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVREEAQGYAWVP........................... 314
62 -27.1001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  22  96........................SVTGYLVNTGSKLVLVDTGAAGTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMVGEQLANAVVRADQKEADFWLSQTNLDKAPD-ASLNPYVKAGKFKPFSGNTDLVPG---IKALASHGHTPGHTTYVVESQGQ----KLALLGDLILVAAVQFDDPSVSKSVAVERKKAFADAAKGGYLIAASHLSFPGIGHIRAEGKGYRFVP........................... 322
63 -27.0004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  17  12..................FYDEATSTISYLVMDRETCALIDSVLDASADRLVERVNELNAS---VRWVLETHVHADHLSAAAYLKEKLGGHTAIGA---HITQVQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIEDAGE----IAVFVGDTLFMPDYGTARCDFPG-ARTLYRSIRRLLAFPDQTLFMCHPGGRDMQYVTTVAEQRASNIHIHQGIDEDSFVAMREARDKTLEMPV. 261
64 -26.9002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  16  25........VTVVPTLKDNF--------SYLINDHTTLAAVDV--NADYKPILTYIEEHLKQQGTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVVGGANDSIPA---------------VTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGTMFIAGIGAFFEGDEKDMCRAMEKHKGNDYALDKVTFIPGHEYTSGFMTFSEKTFPDRASDDLA-AKYAAAVKTGDPSVPSSLAEEKR 272
65 -25.4001vme_A mol:protein length:410 Flavoprotein  ali model follow..  13  12........TERIFDDPEIYVLRIDDYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKI-VDPKEITHIIVNHTEPDHSGSLPATLKTIDVEIIASNFGKRLLEG---------------FYGIKDVTVVKDGEEREIGGKKFKFVMTP-HWPDTMVTYLDGILFSCDVGGGYLLPEILDDSNESVVERYLPHVTKYLEGAEKLSSLKIKALLPGHGLI-NHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKEK.. 287
66 -25.1002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  13  8........VQDQEMIPGVYWVGISSYNSYFID-DECPTVIDSVKYPFAEEWLSRIAAC-CPLDKIKYVVMNHAEGDHASSLKDHYHKFNATFVCTKKCQEHLKILYGMEKATW-------------LIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCPEDKILFSNDGRWADECDVSHVMHLFKEYTANILGLFRKALEVASTVEIKYILSAHGVS-AEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARST.. 284
67 -24.9002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  14  3........AAAKRISDGVYWTGVTTYNAYLVCGDEGVALIDNSYPGTFDELMARVEDAQVGMERVDYIIQNHVEKDHSGVLVELHRRFEAPIYCTEVAVKGLLKHYPSLREAEF------------MTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLDEDGILFSNDARLDREIPEYILMDAARKFYANLITPLLKKFDEVKELRIQMIAPSHGQIWTDPMKIIEAYTGWATGMVDERVTVIYTRKMAHAIAEGAMSE.. 284
68 -24.8002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  17  10........LNSIPAFQDNY--------IWVLTNDEGCVIVDPG---EAAPVLKAIAEHKWM---PEAIFLT----DHVGGVKELLQHFPQMTVYGPAETQD---------------------KGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSR--PYLFCGDTLFSGGCGRL---------FEGTPSQMYQSLMKINSLPDDTLICAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERK 215
69 -22.9001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  14  1........MQATKIIDGFHLVGATTYNAYLVE-DEKTTLFDTVKAEYKGELLCGIASV-IDPKKIDYLVIQHLELDHAGALPALIEACPEKIFTSSLGQKAMESHFHYKDWPV-------------QVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFADEKVLISNDIRFSDQIPVHTLERAMREYYANIVNPYAPQTLKAIEVAPEFICPDHGVIFRGADQCTFEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDE.. 280
70 -22.8004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  13  9........VQVLPIATNTKVLRARSSNSYVIE-GDKTAIIDPPVESFMKIYLEALQQT-VNLKKLDYVILGHFSPNRIPTFKALLELAQITFVCSLPAAGDLRAAFPDDNLNI-------------LPMRGKETLDLGK-VLKFLPIP-RWPAGL-CTYDVQTQILYTDKIFGAHICGDDVFDDNWESFKEDQRYYEAALEKISDLQVRLYAVGHGPL............................................ 234
71 -22.5001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  17  2.........QPVAITDGIYWVGATTYNAYLIV-DDKTALVDTVYEPFKEELIAKLKQI-KDPVKLDYLVVNHTESDHAGAFPAIMELCDAHVLCTQRAFDSLKAHYSHIDFNY-------------TIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVPEEALLLPNDARFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDLAIKTIAPSHGDPGRIIEAYARWAEGQGKAVIAYDTMWLSTEKMAHALMDGLVAG.. 279
72 -21.2002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  10  29...........................SLLLKKGNKEIVVDTGQSE---NFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPVKIYTHKE-ITNTDITYDNEFTTKNFFVEKEGKRIPDKFLDEVFVVVKEEDGINVVTGCSHA-GILNILETARNRFGVSYISLIGGFHLRGMEE----------EKVKDIARKIEEYGVKKVLTGHCTGIDEYGFLKSV.................................. 262
73 -20.5004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  14  3...........IVVKNNIHWVGQRDYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNE-IDLADIDYIVINHAEEDHAGALTELMAQIDTPIYCTANAIDSINGPEWN------------------NVVKTGDTLDIGN-QLIFVETP-HWPDSMMTYLTGDAVLFSNDALFNDEVDQTELFEQCQRYYANILTPFSRLVTPKITLPVDMIATSHGNPTQIVELYLKWAADYQEDTIFYDTMSNNTRMMADAIAQGIAET.. 275
74 -19.6002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  11  13................LIRPLGAGQ-SCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSGRTFMTHATKDYVKVSNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHA-GHVLGAAMFMIEIAGVKLLYDILIIESTYGTHIHEKREEREARFCNTVHDIVNRGGRGLIPVFALGRAQE--LDEYWQNHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIR 294
75 -19.5002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  11  3.....SKAKTTVTFHSGILTIGG---TVIEVAYKDAHIFFDFGTEFRPELLVPELKDL--KDYQHTAVFLSHAHLDHSRMINYLDP--AVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDAYGASALLIRTPD----HFITYTGDLRLHGHN----REETLAFCEKAKHTELLMMEGVSISFPERESEEDLVQHLVRLELENPNRQITFNGYPANVERFAKIIEKS...... 275

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 3 1 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13.