current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst SMAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHLLast
1 -109.0004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model  100  1SMAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL 289
2 -44.4002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  24  1........MKALLPGLYLL----PIPYPLKTVNLYLLQGAGEVALVDTATRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLDHGTPEGALQGIRETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVNPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALLD----GPKTAWELSLHLFQELDPAGRRFAFAETLAHLEYLREEGAVGRGGPPYRYFR... 316
3 -37.9002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  16  4......SSSGLVPRGSHMLRLSAPGQLD-VQVPVFLLRLGEASALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERLRAEQRLPEACAWDALPVRAVADGEWLEGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDAL-VWRPLVFDDMEAYLESLERLQRLPTLQLIPGHGGLLRG--RLAADGAESAYTECLRLCRRLLWRQSMGESLDELSEELHRAWGGQSVDFLPGE--LHLGSMRRMLEILSRQALPLD..... 315
4 -36.6003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  17  20...............................ATVYVMCGEKLTVMIDAGVSNSIADFSFLDK--------LDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLV--DDFLFTGDSAVIPTTPPVIDYKMYMESLKRQIELKPKVVGFAHGGLVSP--KIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNL........................................... 251
5 -36.3005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  21  19...PAAGDTFEVAPGVRWL----PLPFSLDHINLWLL-DGQAGWTIVDCGISSEAIRTHWEQIFDRDGLPVLRVLVTHCHPDHFGLANWLCEGGDQGRWNVDKLRSRRSYYSDLVPAVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALHSEADGVLISGDMVLPRISTNVSPLALYLESLGRYETMAPDLVLPSHGKPFRGVRTRIAQLRAHHDARLEEVRVACAEK---PMSAAGIVPIMFRELDIHQMTFALGEALAHLNLLWLAGELVREHGDDGVIRYA. 358
6 -35.6001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  14  26...................IADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSDDLHPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSA-HLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAACKAYADAAEQKFDGQLAKETAGAR....................................................... 269
7 -33.9001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  16  13...................IAGNLYYVGTDDLASYLIVTPRGNILINSDLEANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVTGCKNYIEQKANDFYTELKKQETG...................................................... 263
8 -33.5003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  19  43...................LIDNIYYVGTDGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGNPFIKPGELVTYATSLSEDFDKQLAKQTAAL..................................................... 291
9 -33.4002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  24  7.........................TLGPLQENAYLVETGEGPVLIDPGDE-----PEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEGADLAARKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLVGRYDLPGADPKALFASLKRLLSLPPETVHPGHGPGTTLGLEA............................................................................... 194
10 -33.4003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  16  14...................IYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSAVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQ-GACRAIAAAGRKRLETRLASEKR....................................................... 262
11 -33.4005aeb_A mol:protein length:272 LRA-12  ali model follow..  18  26...................IAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVGIAKDYAYTLQAMKNLSFDIWVASHASQFSKSFMDRKGYDESLDKLQKEYEKHLNE.......................................................... 271
12 -32.7005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  18  19...................LFGNTYYVGMKGLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGEVGPDDPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVS-LADLRHSFETLEKLPCDVLISAHPEASQDAFVDPQACRAYVAAARTLLDSRLDQEKQQ...................................................... 271
13 -32.6004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  17  8.......RIEKVKENIFLHTSSRVNGFGLVSSNGLVVIDKGNAFIVDT--PWSDRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQ--------ISTYATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLAHIDQWSRSAQNALSREAQIVIPGHGKI--GDIALLKHTKSLAETASNKSIQPNANASAD...................................................... 233
14 -31.6004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  17  46...................VYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRDCRQMVYADSLTAISDDVYGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRI-TACRRYAQGARQRLEKRLAEEAAA...................................................... 295
15 -31.4005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  19  27.......RLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNT--ALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKA--GVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAADLAEWPTSVERIQKHEAEVVIPGHGLPLQHTANVVTAHKNRSVAE.................................................................... 248
16 -31.4004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  18  46...................VYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRDCRQMVYADSLTAISDDVFGYLAAFRNTLARVAALDCDILVTPHPSASG-DTTACRRYAQGARQRLEKRLAEEAATSPSSGA................................................... 301
17 -31.4004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  19  1AESLPDLKIEKLDEGVYVHTSEEVNGWGVVPKHGLVVLVNAEAYLIDT--PFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSR--------IPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDIEAWPKSAKLLKSKKAKLVVPSHSEVGD--ASLLKLTLEQAVKGLNESKKPSKPSNWSHPQFEK................................................ 236
18 -30.9004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  19  9.......KIEKLEEGVYVHTSEEVNGWGVVSKHGLVVLVNTDAYLIDT--PFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQ--------IPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDLEAWPKSAKILMSKKAKLVVSSHSEIGD--ASLLKRTWEQAVKGLNESKKPSQPSN........................................................ 229
19 -30.6004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  18  45.......RLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNT--ALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYP--AAHSTDNLVVYVPSANVLYGGCAVLELSSTSAADLAEWPTSVERIQKHEAEVVIPGHGLPLQHTANVVKAHKNRSVAE.................................................................... 266
20 -29.9002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  17  8.......EVIKIEDGVYLHTSKNIEGYGLVDSNGLVVLDNNQAYIIDT--PWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSK--------IPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALASISSWADSIKNIVSKPIQMVVPGHGKV--GSSDILDHTIDLAESASNKLMQPTAEASAD...................................................... 233
21 -29.8002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  19  23..............................DFNGFAWIRPEGNILIDPV-----ALSNHDWKHLESLG-GVVWIVLTN--SDHVRSAKEIADQTYTKIAG---------PVAEKENFPIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLL-EETTLITGDLVRAYRAGGLENKQKVVASVRRLAALEKEAVLVGDGSVFRDGRDRLKELVAT........................................................................ 199
22 -29.5002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  17  45.......RLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNT--ALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYP--AAHSTDNLVVYVPSASVLYGGCAIYELSRTSAADLAEWPTSIERIQQHEAQFVIPGHGLPLKHTTNVVKAHTNRSVVE.................................................................... 266
23 -29.4001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  20  8...........................CLKDNYAYILDEDTGTVGVVDPSEAEP-----IIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPGID----------MALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMLSCGKLFEGTPKQMLASLQKITSLDDTSIYCGHALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAADEAEALGIIRK.................. 249
24 -29.4002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  17  12.......SISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSS--WDDKLTKELIEMVEKFQKRVTDVIITHAHADHIGGIKTLKER------GIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLAYVNEWSTSIENVLKRNINAVVPGHGEV...................................................................................... 208
25 -29.2002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  14  44.......RLYKIGDGVWSHIATQKLGDTVYSSNGLIVRDADELLLIDTAW-GAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAA--GVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVVRFGPVEVFYP--AAHSGDNLVVYVPAVRVLFGGCAVHEASRESAANLAEWPATIKRIQQREAEVVIPGHGLPLQHTTNVVKTHKVRPVAE.................................................................... 265
26 -29.0001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  20  12.......SITQLSDKVYTYVSAEIEGWGMVPSNGMIVINNHQAALLDT--PINDAQTEMLVNWVTDSHAKVTTFIPNHWHGDCIGGLGYLQRK------GVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQTTSIADVTAWPKTLDKVKAKSARYVVPGHGNYIEHTKQIVNQYIESTSK..................................................................... 231
27 -29.0005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  17  25.......EVIKIEDGVYLHTSKNIEGYGLVDSNGLVVLDNNQAYIIDT--PWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSK--------IPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLASISSWADSIKNIVSKPIQMVVPGHGKV--GSSDILDHTIDLAESASNKLMQPTAEASAD...................................................... 250
28 -29.0001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  19  12.......SITQLSDKVYTYVSAEIEGWGMVPSNGMIVINNHQAALLDT--PINDAQTETLVNWVADLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYAN------QMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQATSIADVTAWPKTLDKVKAKSARYVVPGHGDYIEHTKQIVNQYIESTSK..................................................................... 231
29 -28.9003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  15  12.......SISQLNKNVWVHTELGSFNGEAVPSSGLVLNTSKGLVLVDS--SWDDKLTKELIEMVEKFQKRVTDAIITHAHADRIGGIKTLKER------GIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLAYVNEWSTSIENVSKRNINAVVPSHGEV...................................................................................... 208
30 -28.8001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  18  5.......KIMELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFENATVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEK--VKVFHTPWHAREHLSFLLDTENVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRRIDLLVFPHDAPLKPEVKK............................................................................... 215
31 -28.8004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  20  17.............................SCTFTYLLGESREAVLIDP------ETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSV------------ISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLGCAKTLYHSVHEKIFTLP-----GDCLIYPAH-----DYHGFTVSTVEEERTLNPRL-------TLSCEEFVKIMGNLNLPKPQQIDFAVPANM........................... 229
32 -28.7004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  16  15.......TATKIDSDVFVVTDRD--------SNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAENVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGDVKAWPDSARRLKKFDAKIVIPGHGEWVNKTIKVAEKAVGEMR...................................................................... 249
33 -28.6002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  16  18.......SISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSS--WDDKLTKELIEMVEKFQKRVTDVIITHAHASRIGGIKTLKER------GIKAHSTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLAYVNEWSTSIENVLKRNINAVVPGHGEV...................................................................................... 214
34 -28.5002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  23  7.........................PVTAFSQNCSLI-EQTRLAALVDPGGD----AEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIVGRSDFPRGDHTQLIDAIRKLLPLGDDVFIPGHGPLSTLGYER............................................................................... 202
35 -28.3001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  15  8...........................ALTDNYMYLVDETKEAAIVDPVQP------QKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVY------------GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSEPPAVFTGDTLFGTADEMCKALLEVLGRLP-----PDTRVYCGHARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD........... 260
36 -28.2003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  14  7.......IEPPIKNNLHIYKTFGVFGGKEYSANSMYLVTKKGVVLFDVP--WEKVQYQSLMDTIKKHNLPVVAVFATHSHDDRAGDLSFFNNK------GIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLANVEQWPKTINKLKAKKATLIIPGHDEW-GGHVEHTLELLNKK....................................................................... 219
37 -28.1001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  15  3.......KIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDC--PWGEDKFKSFTDEIYKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYST------KMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLAYVNDWTQSVHNIQQKGAQYVVAGHDDWKD------QRSIQHTLDLINEYQQKQKASN........................................................ 223
38 -26.9004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  20  11.............................SSTYTYLIGDATRQAVLIDP-----EQVDRDLQMVAELDLTLTHVFDTHVHADHITASGALRERTQATVVG-------------SVNGASCANVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLGD--RVFTGDALLGNASQLYDSLTRVLFTLP-----DETLVYPGH-----DYKGRTVTSIAEEKRHNPRV------AGKSREEFIHIMENLNLPRPKLIDAAVPANR........................... 221
39 -26.8003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  16  24.......VFRQLAPNVWQHTSLDMPGFGAVASNGLIVRDGGRVLVVDTAW--TDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLADTEHYAASARAFGAAKASMIVMSHSAPDS------RAAITHTARMADKLRKLVPRGSAAAAL................................................... 256
40 -26.7004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  17  23.......VFRQLAPNVWQHTSLDMPGFGAVASNGLIVRDGGRVLVVDTAW--TDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLADTEHYAASARAFGAAKASMIVMSHSAPITHTARMADKL........................................................................... 242
41 -26.6002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  18  13.............................SSTFTYLLAPDKPALLIDP------KTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSV------------ISKASGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEPRMAFTGDAVLGSSDQLYESVHSQIFTLP-----KDTLIYPAH-----DYKGFEVSTVGEEMQHNPRL-------TKDKETFKTIMSNLNLSYPKMIDVAVPANMVCGLQDVPSQA................ 244
42 -26.6005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  16  23.......VFRQLAPNVWQHTSLDMPGFGAVASNGLIVRDGGRVLVVDTAW--TDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLADTEHYAASARAFGAAKASMIVMSHSAP-RAAITHTARMADKLRLE.................................................................... 245
43 -26.6004tyf_A mol:protein length:231 NDM-4  ali model follow..  17  11.......VFRQLAPNVWQHTSLDMPGFGAVASNGLIVRDGGRVLVVDTAW--TDDQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLADTEHYAASARAFGAAKASMIVMSHSAPITHTARMADKL........................................................................... 230
44 -26.3003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  17  17.......VFRQLAPNVWQHTSLDMPGFGAVASNGLIVRDGGRVLVVDTAW--TDDQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLADTEHYAASARAFGAAKASMIVMSHSAPITHTARMADKL........................................................................... 236
45 -26.2004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  17  26.......VFRQLAPNVWQHTSLDMPGFGAVASNGLIVRDGGRVLVVDTAW--TDDQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLADTEHYAASARAFGAAKASMIVMSHSAPITHTARMADKL........................................................................... 245
46 -26.1002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  18  30...........................TLKDNFSYLINDHTTHTLAAVDVNADYKPIHLKQQGNADVTYTFSTILSTHKHWDHSGGNAKLKAELEAM-----NSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQDGVALFTGDTMFGIGAFFEGDEKDMCRAMEKVYHIKVTFIFPGHEYTSGFMTAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVAKMNQGNAHALMMYLYNACD.................. 305
47 -25.7004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  25  68...............................AEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLG----LFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPG---------LEVWATPGHGGQRDVSVVVAGTVVVAGDVFEDSWQALSEDPAAQERSRKRVLVV-ADVVVPGHGPPFR.................................................................................... 236
48 -25.4004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  17  50.......VFRQLAPNVWQHTSLDMPGFGAVASNGLIVRDGGRVLVVDTAW--TDDQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLADTEHYAASARAFGAAKASMIVMSHSAPITHTARMADKL........................................................................... 269
49 -25.1001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  13  4.......SLTQVSGPVYVVEDNY--------ENSMVYFGAKGVTVVGATW--TPDTARELHKLIKRSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWAEIVAFTRKPNVVHDGDFTLQEGKVRAFYA--PAHTPDGIFVYFPDEQVLYGGCILKKLGNLSFADVKAYPQTLERLKAMPIKTVIGGHDSPLHGPELI---------DHYEALIKAAPQSS........................................................ 228
50 -25.0003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  17  1...........MSEKNLTLTHFKGPLYIVEDENSMVYIGTDGITIIGAT--WTPETAETLYKEIRKSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNPGDFNLQNGSIRAMYLEAHTKDGIFVYFPAERVLYGNCILKNLGNMSFANRTEYPKTLEKLKGLKVDSIIAGHDTPIHDVG................................................................................. 219
51 -23.5002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  16  15...........................AFQDNYIWVLTNDEGRCVIVDPGEAAP-----VLKAIAEHKWMPEAIFLT----DHVGGVKELLQHFPQMTVY-----------GPAETQDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF--SRPYLFCGDTLFSGGCGLFEGTPSQMQSLMKINSLDDTLICCAHEYTLANIKEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEARFAWLRSKKDT................. 253
52 -22.0003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  19  15..............................AHASYLVGQETGEACVIDPARDVEPYLL----TAKREGLRIVAALETHIHADFVSGAREMADRAGAAICV----SDEGPPEWKSEYVKAYPHRLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKALFSGDFVFGESGSSEALARQMFRSLRKFEALPDHVVLPAHGA--SACGKALGAVPSSTVGYEKLVNWALQHKDED-----AFVQALLAGQPE------APIYFARMKLVNKVG................ 260
53 -21.9003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  21  30..............................SQASYLIGQKTGEAMIIDPIRDLSSYIR----VADEEGLTITHAAETHIHADFASGIRDVAIKLNANIY-----VSGESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGGLFSGDFIFKVEGSSEIGAKQMFKSIESIKDLPDYIIWPGHGA--SPCGKSLGAIPTSTLGYEKQTNWAFSENNEA-----TFIDKLISDQPA------PPHHFAQMKKINQFG................ 274
54 -21.3004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  12  10.......QVLPIATNTKVLRARSWSRLRFEGTNSYVIEGDKTAIIDPPVESFMKIYLEALQQTVN--LKKLDYVILGHFSPNRIPTFKALLELAPQITF--VCSLPAAGDLRAAFPDDNLNILPMRGKETLDGKGHVLKFLPIP-RWPAGLCTYDVQTQILYTDKIFGAHICGFKEDQRYYEAALEKISDLQVRLYAVGHGPLVRTSLIALTQAYADWSKAQKL................................................................. 255
55 -20.6003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  21  2..........RISMTVKKLYFIPAGRCMLDHSSCYLLETEEGPILVDTGMPESEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPG---VQLLYTPGHSPGHQSLFIETEQVLLTIDASYTKENFAGFDPELALSSIKRLKEVVKKIIFFGHDIEQEKSCRVFPEYI.......................................................................... 254
56 -20.6002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  20  1...........MDMTVKKLYFIPAGRCMLDHSSCYLLETEEGPILVDTG--TEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPG---VQLLYTPGHSPGHQSLFIKTEQVLLTIDASYTKENFAGFDPELALSSIKRLKEVVKKIIFFGHDIEQEKSCRVFPEYI.......................................................................... 252
57 -19.4003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  21  22..................FWNRGPGGEVRFPVYSILIEHAEGRFLIDTG--EKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGTTRANSTFEGIDGDVDLARG--VKLISTPGHSIGHYSLLVEFPRILFTIDAAYTQKSAFHIDPVAGVNSMRKVKKLAEDELMYSHDMDNFKTYRTGTQFYG......................................................................... 268
58 -19.3002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  17  43...............................VSAYLIQCTDATVLYDTG--ASECNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIERDERERELAPGVNL-LNFGTGHASGMLGLAVRLEKFLLVSDACYTATNGVLHDTIGYDRTVSHIRQYAESTVLFGHDR....................................................................................... 261
59 -18.5002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  19  4.......AAKRISDGVYWTGVLDWDLRNYHGYNAYLVCGDEGVALIDNSYPGFDELMARVEDALQQVGERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLKHYPSLREA-EFMTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLDEDGILFSNDAFGQHLCCLMDAARKFYANFDEVKELG-QMIAPSHGQIWTDPMKIIEAYTATGMVDERVTVIYDTMHGSTRKMAHAIAEGA-EGVDVRVYCLHEDDRSEIVKDILESGAIA............. 312
60 -18.4004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  18  17.............................TSTISYLVDRETRQCALIDSGRTCSASADRLVERVNELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHITQVQKVFGALFNDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIEDEIAVFVGDTLFDYGTARCDDARTLYRSIRRLLAFPDQTLFMCHDYLPGGRDMQYVTTVAEQRASEDSFVAMREARDKTLEMPVLILPSVQVNMRSGQLPPPEANGVSYLK...................... 288
61 -18.2004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  16  15.............................TCTISYLLDSGSGECALIDSGRTRTASADQLIARVAALGARVRWLLETHVHADHLSAAPYLKTRVGGEIAIGRHVTRVQDVFGKLFNDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEDAAAFVGDTLFDYGTARCDDARSLYRSIRKVLSLPPATLYMCHDYQPNGRAIQYASTVADELREEDDFVAMRTARDATLDMPVLMLPSVQVNMRAGRLPEPEDNGVRYLK...................... 292
62 -17.9002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  16  9.......QDQEMIPGVYWVGIVDWMVRIFHG-NSYFIDDECPTVIDSVKYPFAEEWLSRIAACCP--LDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKK--CQEHLKILYGMEKATWLIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCPEDKILFSNDGFGQHYATVMHLFKEYTANLEVASTVEIKYILSAHGVSWRGDAAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGA-TGCETVLLEMTSSDITKVALHTYDSGAVA............. 312
63 -17.3001vme_A mol:protein length:410 Flavoprotein  ali model follow..  16  16..........FDDPEIYVLRIDDDRIRYFEAVNAYLVKLNGANVLIDGWKGNAKEFIDALSKIVD--PKEITHIIVNHTEPDHSGSLPATLKTIGHDVEIIASNFGKRLLEG-----GIKDVTVVKDGEEREIGGKKFKFVMTP-HWPDTMVTYL--DGILFSCDVGGGYLLPYLPHVTKYIVTAEKLSSLKIKALLPGHGLIWKKDPQRLVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLFTPVVYKFSDEERPAISEILKDIPDSEALI............. 318
64 -16.7003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  13  34.................KQYNANERNQINLPTHPILIQTAQYNLIIDAGGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPG--IKMQHSGGHSFGHTIITIEGDKAVHMGDIFTAYDDYPMQSIREKERMIPYFIQQQYWFLFY-HDE....................................................................................... 253
65 -16.6004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  19  37.........QQVHEILKKYYADQEKGVQT-SINAFLVNIGKSLILIDSGASCFGSHLGSVLSNLKASGEQVDTILLTHLHPDHVCGIPKQAAKLPKEKQANYLGTVEKIKQAIAPYQAKQRFKTYKLGDDIQG----FKVINTAGHTPGHFSYELKTESIVFIGDIV-ETAIEYDIDPKKAVETRLKQFANFAKLPFPGIGHTYS.................................................................................... 276
66 -16.6004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  18  66.......DDKDLQSLLARMFVASEKGVQT-AVNAYLINTGDNLVLIDTGAQCFGPTLGVVQTNLKASGEQVDTVLLTHLHPDHACG---LVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVSLVASPGHTPGHTSYLFKSQSLLVWGDIL-EVVFEFDVDSDQARQSRQRILAEAATLPFPGLGHVRKEAQGYAWVPVEFSPIRSDR................................................................. 324
67 -16.5004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  22  38............VAELKTILKDNADHYIDMAINILLVKTKEKLILMDTGGIFADERTGFLLKSLQKAGHDITDIFLSHAHPDHIGG---VVDKQNKLVFPNASIFISKIEHDFWINASIKDFKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTISSEKLMYVADLI-DWGFSGDTDLDIATASRKKFLKQLADLPWPGLGFTKVKAPGF............................................................................... 285
68 -16.5004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  18  2........SIVVKNNIHWVGQRDWEVRDFHGTNSYLIREEKNVLIDTVDHKFSREFVQNLRNEIDLA--DIDYIVINHAEEDHAGALTELMAQIPDTPIYC------TANAIDSINGPEWNFNVVKTGDTLDGNGKQLIFVETP-HWPDSMMTYLTGDAVLFSNDAFGQHYCDLFEQCQRYYANITEIFNLPVDMIATSHGVVWRDNPTQIVELYLKADYQEDRITIFYDTMSNNTRMMADAIAQGIAEVAVKIFNVARSDKNEILTNVFRSKGVL............. 305
69 -16.4001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  14  1......SQPVAITDGIYWVGAVDWNIRYFHGPNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPV--KLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQR--AFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVPEEALLLPNDAFGQHIATIMDEAAKYYANI-QKINLAIKTIAPSHGIIWRKDPGRIIEAYAREGQGKAKAVIAYDTMWLSTEKMAHALMLVAGGCEVKLFKLSVSDRNDVIKEILDARAVL............. 307
70 -16.3004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  17  66.......DDKDLQSLLARMFVASEKGVQT-AVNAYLINTGDNLVLIDTGAQCFGPTLGVVQTNLKASGEQVDTVLLTHLHPDHACG---LVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVSLVASSGHTPGHTSYLFKSQSLLVWGDIL-EVVWEFDVDSDQARQSRQRILAEAATLPFPGLGHVREEAQGYAWVPVEFSPIRSDR................................................................. 324
71 -16.1001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  12  2.......QATKIIDGFHLVGAIDWNSRDFHGYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPK--KIDYLVIQHLELDHAGALPALIEACQPEKIFTSSL--GQKAMESHFHYKDWPVQVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFADEKVLISNDIFGQNIAALERAMREYYANIETLAGVAPEFICPDHGVI-DQCTFAVQKYVE-EQKPTNKVVIFYDSMWHSTEKMARVLAFRDEGCTVKLMWCKACHHSQIMSEISDAGAVI............. 308
72 -15.6001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  21  96..............................SVTGYLVNTGSKLVLVDTGAGLFGPTLGRLAANLKAAGEQVDEIYITHMHPDHVGGLPNAVVRADQKEADFWLSQTNLDKAPDDESKGFFKGAMASLNPYVKAGKFKIKALASHGHTPGHTTYVVESQKLALLGDLI-SVTTQLDSDSKSVAVERKKAFADAAKLSFPGIGHIRAEGKGY............................................................................... 318
73 -14.1001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  14  17.........NAMKMTVVGFWGGFPEA---EATSGYLFEHDGFRLLVDCGSGV----LAQLQKYITPS--DIDAVVLSHYHHDHVADIGVLQYARQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTV-HPVTCFAMRITAGNVVYSAD------SSYIPEFIPFTKDADLFIC-ECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFSGHIT...................................... 252
74 -12.2003g1p_A mol:protein length:258 Protein phnP  ali model follow..  13  4.........................TLTLTGTGGGVVKFNDAITLIDAG-----------DLADRWSPGSFQQFLLTHYHMDHVQGLFPLRWGVGDPIPVYGPPDEQGCDDLFKHPGLLDFSHTVEPFVVFDLQGLQVTPLPL--HSKLTFGYLLETARVAWLSD-----TAGLPEKTLKFLRNNQPQVMVMDCSHPPRADAPRNHCDLNTVLALNQVIRSPRVILTHISHQFDAWLMENALFEVGFDGMEIGV................................... 251
75 -11.1002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  16  1........MRGSGSVEVQVLIENARNFVAEHGLSLLLKKGNKEIVVDTGQSEN---FIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPEVKIYTHKEIFTTKNFFVEKEGKRIPDKFLDEVFVVVKEEDGINVVTGCSHAG--ILNILETARNRFGVSYLIGGFHLRGMEEEKVKDIARKIEEYGVKKVLTGH......................................................................................... 249

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 3 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]