current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst MKRRFTLLGSVVALALSSTALASDAPASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAATSPSSGARPLast
1 -116.0004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model  100  1MKRRFTLLGSVVALALSSTALASDAPASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAATSPSSGARP 303
2 -112.0004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  98  1MKRRFTLLGSVVALALSSTALASDAPASRGCADDAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAA........ 295
3 -98.9005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  44  1...........................TPGCEVCATWNADQAPFRLFGNTYYVGMKGLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGEVGPDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGFKFSASSEYPNALADLRHSFETLEKLPCDVLISAHPEASQLWQRLETGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQQ........ 271
4 -96.8003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  45  1................................QDRDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSD---HPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQKEGNSAYVDNGACRAIAAAGRKRLETRLASEKR......... 262
5 -95.2001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  23  1.................................AYPMPNPFPPFRIAGNLYYVGTDDLASYLIVTPRGNILINSDLEANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYANDSSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVN--PGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVKGQNNPFVDPTGCKNYIEQKANDFYTELKKQETG........ 263
6 -94.9003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  27  1MRRLTAALCALTLLSTGAQAQTIKDFLA---VAMKKWTAPFEPFQLIDNIYYVGTDGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKN--EDLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRLVGQPT---YAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGMQAKRADGAPNPFIKPGELVTYATSLSEDFDKQLAKQTAALEKK.... 294
7 -93.5005aeb_A mol:protein length:272 LRA-12  ali model follow..  23  1....................HMASQKVKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSS-DYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKK--FSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN........... 272
8 -90.3001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  36  1....................AEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARG--GSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSA---PGYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGA---RAGAKALTCKAYADAAEQKFDGQLAKETAGAR...... 269
9 -48.2002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  14  21..........................................PGQLDDDLCLLGDVQVPVFLLRLGESWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLNVQVLASERTCQAWKSESAVRVVERLNRQLL-WDALPVRAVADGEWLELGPRRLQVIEAHGHSDDHVVFY-----DVRRRRLFCGDALGEFDEAEGVWR--PLVFDDMEAYLESLERLQRLPTLQLIPGHGGLLRGRLAADLRLCRRLLWRQSMGESLDELSEELHRAWGGQSVDFLPGEL.. 295
10 -47.2003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  13  5................................................GLHSIPAEIATVYVMCGEKLTVMIDAGVSNSIADFSF--------LDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVD-------DFLFTGDSAGAYFNGVVIPTTPPVID--YKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEELSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS..... 260
11 -44.3001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  16  29.........................................................STVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFE---NATFYVHEVYKTKNYLSFGTIVGRIY--SKVISSWKNVVLLKGEESL---DEKVKVFHTPWHAREHLSFLLDTENAGR--VLITGDITPNRLS-----YYDIIKGYGSVQVKNFLDRVGRI--DLLVFPHDAPLKPEVKK........................................... 215
12 -41.9002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  18  3............................................ALLPGLYLLPLKTVNLYLLQGAGEVALVDTALRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEG-LGARVFLHEEEFARGHGALQGIRETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLE-----EEGVLLAGDALLEKVSPNVGLWAYT-RENPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQR-------------AEELKAHHQARLEALLALLDGPKTA..... 268
13 -41.1002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  20  8....................................................LGPLQENAYLVETGEGPVLIDPG--DEPEKLLALFQTTGLI---PLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLP---VRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVG----------RYDLPGADPKALFASLKRLLSLPPETVHPGHGPGTTLGLEAR---TNPFLTGLEWEA........................... 207
14 -38.2003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  19  35.........................................................VYSILIEHAEGRFLIDTGYDEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFP---HAKKICHRSEVPQACNPQPFEHEGTTRANSTFEGIDGDVDLARG---------VKLISTPGHSIGHYSLLVEFPRRKP--ILFTIDAAYT--QKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDELMYSH..................................................... 252
15 -38.0003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  17  39.........................................................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKE-CILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIETEQSGS--VLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGH..................................................... 239
16 -37.9002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  14  43.........................................................VSAYLIQCTDATVLYDTGCHPEECNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDEFATAVRYFATGDHSSPYIVKDIEARNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVRLEKQP---GFLLVSDACYTATNYGPPARRAGVLHDTIGYDRTVSHIRQYAESTVLFGH-------------------DREQFASLIKSTDGFYE................. 276
17 -37.8002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  17  37.........................................................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKE-CILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIKTEQSGS--VLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGH..................................................... 237
18 -36.7002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  17  23........................................................DFNGFAWIRPEGNILIDP--VALSNHDWKHLESLG----GVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENF-------------------PIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLE------ETTLITGDLVRAYRAGGLEILPDEKLMNK-QKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKE....................................... 195
19 -36.3004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  23  68.........................................................AEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPG---AALLVSHDFCLPGGR-------------------YLPHGLGEGQPLRLGP-GLEVWATPGHGGQRDVSVV-VAGTALGTVVVAGDVFERDGDEDSW----QALSEDPAAQERSRKRVLVV-ADVVVPGHGPPFRVLREASQPETEG.................................... 248
20 -35.5004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  14  1MLKVILVYMTASVMAVASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEAE-----------GNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVP-----SANVLYGGCAVLELSSTSAGNVAD----ADLAEWPTSVERIQKHEAEVVIPGHGLPGG-------------------LDLLQHTANVVKAHKNRSVAE........ 266
21 -34.9002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  16  1MFQIFLVGISAFVMAVLGSAAYSAQPGGEYPTVDDIPVGEVRLYKIGDGVWSHTVYSSNGLIVRDADELLLIDTAWAKNTVALLAEIEKQ--IGLPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAEAA-----------GNEVPAHSLKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVP-----AVRVLFGGCAVHEASRESAGNVAD----ANLAEWPATIKRIQQREAEVVIPGHGLPGG-------------------LELLQHTTNVVKTHKVRPVAE........ 265
22 -34.7002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  13  4LLSKLLVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEVE-----------GNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVP-----SASVLYGGCAIYELSRTSAGNVAD----ADLAEWPTSIERIQQHEAQFVIPGHGLPGG-------------------LDLLKHTTNVVKAHTNRSVVE........ 266
23 -34.3005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  15  1...............GPSPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEAE-----------GNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVP-----SANVLYGGCAVLALSRTSAGNVAD----ADLAEWPTSVERIQKHEAEVVIPGHGLPGGLDL-------------QHTANVVTAHKNRSVAE............... 248
24 -33.7004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  15  7MHPVAKLALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDS................................................ 255
25 -33.7003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  14  3.....................................EKNLTLTHFKGPLYIVEYVQENSMVYIGTDGITIIGATTPETAETLYKEIRKV--SPLPINEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLDTVFPGDFNLQNGSIRAMYLEAHTKDGIFVYFPAER------VLYGNCILKENLGNMSFANRTEYPKTLEKL-KGLIEQGELKVDSIIAGHDTPIHDVGLID.......................................... 222
26 -33.6005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  16  1MKNVLVFLILLVALPALAQG-----------------HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPSEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGKPVPTHYF----------------KDDEFTLGNGLIELYYPAGHTEDNIVAWLP-----KSKILFGGCLVRSHEREGLGYVGD----ASISSWADSIKNIVSYPIQMVVPGHGKVGSSDI-------------DHTIDLAESASNKLMQPTAEASAD........ 250
27 -33.0004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  12  4.....................................VPELRIEKVKENIFLHGLVSSNGLVVIDKGNAFIVDTPSDRDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIKWLNDQ-SISTYATTSTNHLLKENKKEPA----------------KYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLP-----KSKILFGGCFVRSLDSEGLGYTGE----AHIDQWSRSAQNALSREAQIVIPGHGKIGD-------------------IALLKHTKSLAETASNKSIQPNANASAD. 233
28 -32.6004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  12  2............................PKSSDHVDLPYNLTATKIDSDVFVVDFYSSNVLVAKMLDGVVIVSSPFENLTQTLMDWVAKT--MKPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRLEENKKDRIKAAELSSHPVPADNVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKK------LLFGGCMIKPKELGY------LGDANVKAWPDSARRLKKFDAKIVIPGHGEWGG................................................ 230
29 -32.6003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  16  2...................PGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDSRAA-------------THTARMADKLRKLVPRGSAAAALE........ 257
30 -32.4002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  14  8.....................................TGTISISQLNKNVWVHEAVPSNGLVLNTSKGLVLVDSSWDKLTKELIEMVEKK--FQKRVTDVIITHAHADHIGGIKTLKER-GIKAHSTALTAELAKKNGY---------------EEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLP-----QYNILVGGSLVKSTSAKDLGNVAD----AYVNEWSTSIENVLKRNINAVVPGHGEVGD................................................ 210
31 -32.4004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  14  5.....................................LPDLKIEKLEEGVYVHGVVSKHGLVVLVNTDAYLIDTPTATDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIEWLNSQ-SIPTYASELTNELLKKDGKVQAKNSF----------------SGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKK------ILFGGCFVKPDGLGN--------DANLEAWPKSAKILMSKKAKLVVSSHSEIGD-------------------ASLLKRTWEQAVKGLNESKKPSQPSN... 229
32 -32.3003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  14  3.....................................KDFVIEPPIKNNLHIYKEYSANSMYLVTKKGVVLFDVPEKVQYQSLMDTIKKR--HNLPVVAVFATHSHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKDGK---------------ATSTEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFP-----KYNVLDGGCLVKSNSATDLGYIKE----ANVEQWPKTINKLKAKKATLIIPGHDEWKG................................................ 205
33 -32.2004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  15  4.....................................LPDLKIEKLDEGVYVHGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKKDGKVQATNSF----------------SGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERK------ILFGGGFIKPYGLGN--------DANIEAWPKSAKLLKSKKAKLVVPSHSEVGD-------------------ASLLKLTLEQAVKGLNESKKPSKPSNW.. 229
34 -32.2004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  16  1...................SNAIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGA----ADTEHYAASARAFGAAKASMIVMSHSAPDS................................................ 228
35 -32.0005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  14  20......................................AAGDTFEVAPGVRWLSLDHINLWLLRDQAGWTIVDCGISEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCERWNVRLWMTLGEYMFGCLMAAGNGSNAGGAAAA-AVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALH-----SEADGVLISGDMVLPRISTNVSVFDLEPEANPLALYLESLGRYETMAPDLVLPSHGKPF-----------------RGVRTRIAQLRAHHDARLEEVRVACAEKPMS. 306
36 -32.0002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  21  7.......................................PVTAFS----------QNCSLIWCEQTRLAALVDPG--GDAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMF--GLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVG----------RSDFPRGDHTQLIDAIRKLLPLGDDVFIPGHGPLSTLGYERL---HNPFLQD................................ 210
37 -32.0002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  12  1........................ASQKVEKTVIKNETGTISISQLNKNVWVHEAVPSNGLVLNTSKGLVLVDSSWDKLTKELIEMVEKK--FQKRVTDVIITHAHASRIGGIKTLKER-GIKAHSTALTAELAKKNGY---------------EEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLP-----QYNILVGGCLVKSTSAKDLGNVAD----AYVNEWSTSIENVLKRNINAVVPGHGEVGD................................................ 216
38 -31.8003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  14  8.....................................TGTISISQLNKNVWVHTELG-SGLVLNTSKGLVLVDSSWDKLTKELIEMVEKK--FQKRVTDAIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKNGY---------------EEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLP-----QYNILVGGCLVKSTSAKDLGNVAD----AYVNEWSTSIENVSKRNINAVVPSHGEVGD................................................ 210
39 -31.7003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  16  1.........................SNANYMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDS................................................ 222
40 -31.7004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  16  1................GSHMGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDS................................................ 231
41 -31.6005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  17  19.....................................FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDS................................................ 228
42 -31.6001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  15  2........................................VKIEKLKDNLYVYTKYAANAVYLVTDKGVVVIDCPWEDKFKSFTDEIYKK--HGKKVIMNIATHSHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKENK---------------PRAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFP-----KEKVLVGGCIIKSADSKDLGYIGE----AYVNDWTQSVHNIQQKGAQYVVAGHDDWKD................................................ 201
43 -31.6002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  13  4.....................................HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPWEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGKPVPTHYF----------------KDDEFTLGNGLIELYYPAGHTEDNIVAWLP-----KSKILFGGCLVRSHEWEALGYVGD----ASISSWADSIKNIVSKPIQMVVPGHGKVGS-------------------SDILDHTIDLAESASNKLMQPTAEASAD. 233
44 -31.6001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16  1..............................AQKSVKISDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPNDAQTETLVNWVADS--LHAKVTTFIPNHWHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEKGL---------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLP-----TENILFGGCMLKDNQATSIGNISD----ADVTAWPKTLDKVKAKSARYVVPGHGDYGG-------------------TELIEHTKQIVNQYIES--------TSKP 232
45 -31.6001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  15  1..............................AQKSVKISDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPNDAQTEMLVNWVTDS--LHAKVTTFIPNHWHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKGL---------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLP-----TENILFGGCMLKDNQTTSIGNISD----ADVTAWPKTLDKVKAKSARYVVPGHGNYGG-------------------TELIEHTKQIVNQYIES--------TSKP 232
46 -31.4004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  18  20.............................................LGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGE----------QQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLE-----EENAIFSGDCILGEGTTVF---------EDLYDYMNSLKELLKIKADIIYPGHGPVIH--------------AEAKIQQYISHRNIREQQILTLFRENFEKSFT.. 238
47 -31.4004tyf_A mol:protein length:231 NDM-4  ali model follow..  17  7.....................................FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGLVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDS................................................ 216
48 -31.0002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  14  1...........................................MKLLFRQLFENESSTFTYLLADDKPALLIDPVD-KTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKA----------------------SGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTEGADQPQPRMAFTGDAVLIRGCGRTDFQE-----SSDQLYESVHSQIFTLPKDTLIPAHGFEVSTVGEEMQHNPRLTKDKETFKTIMSNLNLSYPKMIDVAVPANMVCGLQD 239
49 -31.0001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  18  1......................................AGMSLTQVSGPVYVVYYVQENSMVYFGAKGVTVVGATTPDTARELHKLIKRV--SRKPVLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPPNVVHDGDFTLQEGKVRA-FYAGPAHTPDGIFVYFPDEQ------VLYGGCILKEKLGNLSFAD-------VKAYPQTLERLKALPIKTVIGGHDSPLHGPELID.......................................... 215
50 -30.5003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  12  48.........................................................THPILIQTAQYNLIIDAGIGNEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHANAIHVVQQDEWHEFIAPNIRSKSTYWDKNKG-DYSNKLILFEKHFEPVPG---IKMQHSGGHSFGHTIITI---ESQGDKAVHMGDIFPTTAHKNPLWVAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGE....................................... 265
51 -30.5004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  15  1.............................................MIFRQLFDSESSTYTYLIGDEATAVLIDPVL-EQVDRDLQMVAELDLT---LTHVFDTHVHADHITASGALRERTQATVVGSVNGASCA-----------------------NVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLGD-------RVFTGDALLVRGNGRTDFQN-----NASQLYDSLTRVLFTLPDETLVPGHDYKGRTVTSIAEEKRNPRVAGKSREEFIHIMENLRPKLIDAAVPANRACGHTA 227
52 -30.3004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  15  1......................................GPVDAPILLRQMFEPVSCTFT-YLLGDRESAVLIDPVL-ETAPRDAQLIKELGLR---LLYAVNTHCHADHITGSGLLRSLLPGCQSVISR----------------------LSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVL-----NDHSMAFTGDALLIRGCGRTDFQQ-----CAKTLYHSVHEKIFTLPGDCLIPAHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGVQT 235
53 -30.3001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  18  14...........................................................AYILHDEDTVGVVD---PSEAEPIIDSLKRSGRN---LTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPG--------------------IDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFP-----GSRAIFTGDTMFSLS---------KLFEGTPKQMLASLQKITSLPDDTSICGHEYTLSNSKSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNP...... 219
54 -29.5004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  20  58.........................................................INAFLVNIGKSLILIDSGAASHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISKDGVANNATVYVSNDEASFWLDPKQAAKLPKEKQAAPYQAKQRFKTYKLGDDIQ----GFKVINTAGHTPGHFSYEL---KTKGESIVFIGDIVHSHTVQFDRPETAIEYDIDPKKAVETRLKQFANFAKTIAAPH..................................................... 265
55 -29.4001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  20  3........................................VEVLPALTDNY--------MYLVIDDETAAIVD---PVQPQKVVDAARKHGVK---LTTVLTTHHHWDHAGGNEKLVKLEGLKVYGGDDRIGAL-----------------------THKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAG---------KFYEGTADEMCKALEVLGRLPPDTRVCGHEYT---------------INNLKFARHVEPGNAAIREKLAWAKEKYSIG.... 207
56 -28.5004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  20  59.........................................................INILLVKTKEKLILMDTGMGIRTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLNASIFISKIEHDFWINASIKDFNNSALKAHP-AIQPKLKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTI---SSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADRAFTSH..................................................... 269
57 -28.3004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  18  1MRLFSLSTALSSAMIALVSLPLQAAAPAQQKTQVPGYYRDFEVTALYDGYVDLPASAVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPEGMQGAPYAKMNKLKPYKTEGELLPG---VSLVASPGHTPGHTSYLF---KSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATWVAGAH..................................................... 294
58 -28.1004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  18  1MRLFSLSTALSSAMIALVSLPLQAAAPAQQKTQVPGYYRDFEVTALYDGYVDLPASAVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPEGMQGAPYAKMNKLKPYKTEGELLPG---VSLVASSGHTPGHTSYLF---KSGGQSLLVWGDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAATWVAGAH..................................................... 294
59 -26.8001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  20  97.........................................................VTGYLVNTGSKLVLVDTGAAGTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMVGEQLANAVVRADQKEADFWLSQTNLDKAPDMASLNPYVKAGKFKPFSGNTDLVPG---IKALASHGHTPGHTTYVV---ESQGQKLALLGDLILVAAVQFDDPSVTTQLDSDSKSVAVERKKAFADAAKLIAASH..................................................... 302
60 -25.9002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  15  25........................................VTVVPTLKDNF--------SYLINDHTTLAAVDV--NADYKPILTYIEEHLKQQGTFSTILSTHKHWDHSGGNAKLKAELEAVVVGGAND----------------------SIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHNDGVALFTGDTMFIAGGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIPGH-TSGFMTFSEKTFPDRASDDLAFIQAQRAKYAASVPSSLAEEKRQNL...... 275
61 -25.2002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  12  8........................................VQDQEMIPGVYWVGISSYNSYFID-DECPTVIDSVKYPFAEEWLSRIAAC-CPLDKIKYVVMNHAEGDHASSLKDHYHKFNATFVCTKKCQEHLKILYGMEKATW-------------LIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCP-----EDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEALEVASTVEIKYILSAHGAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARST........... 284
62 -25.1002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  17  3........................................AAAKRISDGVYWTGVTTYNAYLVCGDEGVALIDNSYPGTFDELMARVEDAQVGMERVDYIIQNHVEKDHSGVLVELHRRFEAPIYCTEVAVKGLLKHYPSLREAEF------------MTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLD-----EDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKKFDEVKELRIQMIAPSHGQIWTDPMKTGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSE........... 284
63 -24.8001vme_A mol:protein length:410 Flavoprotein  ali model follow..  11  12........................................TERIFDDPEIYVLRIDSYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKI-VDPKEITHIIVNHTEPDHSGSLPATLKTIDVEIIASNFGKRLLEG---------------FYGIKDVTVVKDGEEREIGGKKFKFVMTP-HWPDTMVTYLD-------GILFSCDVGGGYLLPEILDDSNESIVTVIGHYLEGAEKLSSLKIKALLPGHGNHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKEK........... 287
64 -24.8003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  13  14.............................................LAHASYLVGCQ--------ETGEACVIDP-----ARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEWKSEYVKAYPH--------------RLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKTSPDMALFSGDFVFVGDVGRPDLLERVASEALARQMFRSLRKFEALPDHVQVPAHGAGSACGKALGAVPSSTVGYEKLVNWALQHKEDAFVQALLAGQPEAPI..... 248
65 -24.0004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  15  10..................................................FFDPATCTISYLLFDSGSCALIDSVLDASADQLIARVAALGAR---VRWLLETHVHADHLSAAPYLKTRVGGEIAIGR---HVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVHAAHDARDAAAFVGDTLFMPDYGTARCD----PGGDARSLYRSIRKVLSLPPATLYMCHDYQPNGRAIQDELRENVHIREGVTEDDFVAMRTARDATLDMPV.......... 265
66 -23.9004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  10  9........................................VQVLPIATNTKVLRATTSNSYVIE-GDKTAIIDPPVESFMKIYLEALQQT-VNLKKLDYVILGHFSPNRIPTFKALLELAQITFVCSLPAAGDLRAAFPDDNLNI-------------LPMRGKETLDLGKGVLKFLPIP-RWPAGL-----CTYDVQTQILYTDKIFGAHICGDDVFDDNWEMAPHAIHVEAALEKISDLQVRLYAVGHG.................................................... 232
67 -23.6004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  17  12..................................................FYDEATSTISYLVMDRETCALIDSVLDASADRLVERVNELNAS---VRWVLETHVHADHLSAAAYLKEKLGGHTAIGA---HITQVQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMI---EDAGEIAVFVGDTLFMPDYGTARCD----PGADARTLYRSIRRLLAFPDQTLFMCHDYLPGGRDMQEQRASNIHIHQGIDEDSFVAMREARDKTLEMPV.......... 261
68 -23.5003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  13  29.............................................LSQASYLIGCQ--------KTGEAMIIDP-----IRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLGYKNMPNHT---------------HFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGAQMGLFSGDFIFVGDIGRPDLLEKAVSEIGAKQMFKSIESIKDLPDYIQIPGHGAGSPCGKSLGAIPTSTLGYEKQTNWAFSENEATFIDKLISDQPAPPH..... 262
69 -23.3001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  15  1........................................MQATKIIDGFHLVGATTYNAYLVE-DEKTTLFDTVKAEYKGELLCGIASV-IDPKKIDYLVIQHLELDHAGALPALIEACPEKIFTSSLGQKAMESHFHYKD--------------PVQVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFA-----DEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIAGVAPEFICPDHGVIFRGADQEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDE........... 280
70 -22.8001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  18  2.........................................QPVAITDGIYWVGATTYNAYLIV-DDKTALVDTVYEPFKEELIAKLKQI-KDPVKLDYLVVNHTESDHAGAFPAIMELCDAHVLCTQRAFDSLKAHYSHID--------------NYTIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVP-----EEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANIINLAIKTIAPSHG.................................................... 228
71 -22.7002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  18  10........................................LNSIPAFQDNY--------IWVLTNDEGCVIVD---PGEAAPVLKAIAEHKWM---PEAIFLT----DHVGGVKELLQHFQMTVYGPAET----------------------QDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSRP-------YLFCGDTLFSGG---------RLFEGTPSQMYQSLMKINSLPDDTLICAHETLANIKFALSILPHDSFINERKVKELRVKKQMTLPVILKNERK......... 215
72 -21.3002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  12  5......................................GSVEVQVLIENVNFVAEHGLSLL-LKKGNKEIVVDTG---QSENFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPVKIYTHKE-ITNTDITYDNEFTTKNFFVEKEGKRIPDKFLDEVFVVVKEEDGINVVTGCSHA-GILNILETARN-GVSYIKSLIGGFHLRGMEE-------------EKVKDIARKIEEYGVKKVLTGHCTGIDEYGFLKSVLKDKI................................... 267
73 -20.4004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  19  2..........................................SIVVKNNIHWVGQSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNE-IDLADIDYIVINHAEEDHAGALTELMAQIDTPIYCTANAIDSINGPEWN------------------NVVKTGDTLDIGNGQLIFVETP-HWPDSMMTYLT-----GDAVLFSNDAFGQHYCDEHLFNDEVDQTELFEQCQRYYANIFNLPVDMIATSHG.................................................... 224
74 -20.2002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  13  3.....................................SKAKTTVTFHSGILTIGG---TVIEVAYKDAHIFFDFGTEFRPELLVPELKDL--KDYQHTAVFLSHAHLDHSRMINYLDP--AVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDAYGASALLIRTPDH----FITYTGDL-------------RLHGHNREETLAFCEKAK--HTELLMMEGVSISFPEREPDPAQIAVVSEEDLVQHLVRLELENPNRQI.............. 256
75 -18.8002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  14  13................................................LIRPLGAGQ-SCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSGRTFMTHATKAIYR-SNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHA-GHVLGAAMFMIEIAG----VKLLYTGDFSRQEDRHLM------------------AEIPNIKPDILISTYGTHIHEKREEREARFCNTVHDI-IPVFALGRAQELLLILDEYWQNHPELHDIP 267

FFAS is supported by the NIH grant R01-GM087218-01
1 0 8 9 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.