current user: public

anford Burnham Prebys Medical Discovery Institute
Please be advised that due to the planned maintenance our websites might be temporarily unavailable on December 17-18, 2018. We apologise for the inconvenience that this may cause.

Query: 4bp0_A mol:protein length:250 METALLO-B-LACTAMASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst GPKSSDHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRLLast
1 -104.0004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model  100  1GPKSSDHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL 250
2 -82.7001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  23  1...AQKSVKISDDISITQLSDKVYTYVGWGMVPSNGMIVINNHQ-AALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKG--------------------------LPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGDADVTAWPKTLDKVKAKSARYVVPGHGNYGGTELIEHTKQIVNQYIESTS. 230
3 -82.7001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  24  1...AQKSVKISDDISITQLSDKVYTYVGWGMVPSNGMIVINNHQ-AALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKG--------------------------LPVPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGDADVTAWPKTLDKVKAKSARYVVPGHGDYGGTELIEHTKQIVNQYIESTS. 230
4 -82.0002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  27  5.VEKTVIKNETGTISISQLNKNVWVHTNGEAVPSNGLVLNTSKG-LVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNG--------------------------YEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGDAYVNEWSTSIENVLKRNINAVVPGHGEVGDKGLLLHTLDLLK........ 228
5 -81.8001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  27  1............DVKIEKLKDNLYVYTNGTKYAANAVYLVTDKG-VVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKEN--------------------------KPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGEAYVNDWTQSVHNIQQKGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQK. 220
6 -81.7003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  21  4.NYMETGDQRFGDLVFRQLAPNVWQHTGFGAVASNGLIVRDGGR-VLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAA------------------QHSLTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR..... 237
7 -81.7002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  28  2....TVIKNETGTISISQLNKNVWVHTNGEAVPSNGLVLNTSKG-LVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNG--------------------------YEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGDAYVNEWSTSIENVLKRNINAVVPGHGEVGDKGLLLHTLDLLK........ 222
8 -81.7005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  22  10.QQMETGDQRFGDLVFRQLAPNVWQHTGFGAVASNGLIVRDGGR-VLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAA------------------QHSLTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRLE... 245
9 -81.3003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  30  1........QVKDFVIEPPIKNNLHIYKGGKEYSANSMYLVTKKG-VVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGK--------------------------ATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGEANVEQWPKTINKLKAKKATLIIPGHDEWKGGGHVEHTLELLNK....... 218
10 -81.2003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  21  11.QQMETGDQRFGDLVFRQLAPNVWQHTGFGAVASNGLIVRDGGR-VLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAA------------------QHSLTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRKLVP. 248
11 -81.2004tyf_A mol:protein length:231 NDM-4  ali model follow..  22  1GPGDQR----FGDLVFRQLAPNVWQHTGFGAVASNGLIVRDGGR-VLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAA------------------QHSLTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR..... 231
12 -80.9003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  28  2....TVIKNETGTISISQLNKNVWVHTNGEAVPSSGLVLNTSKG-LVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNG--------------------------YEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGDAYVNEWSTSIENVSKRNINAVVPSHGEVGDKGLLLHTLDLLK........ 222
13 -80.7004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  21  10.QQMETGDQRFGDLVFRQLAPNVWQHTGFGAVASNGLIVRDGGR-VLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAA------------------QHSLTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGAADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR..... 243
14 -80.5003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  23  2.........SEKNLTLTHFKGPLYIVEDKEYVQENSMVYIGTDG-ITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNN--------KYPNLEKSLPDTVFPGD--FNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN-LGNMSFANRTEYPKTLEKLKGLKVDSIIAGHDTIHDVGLIDHYLTLLEKAPK.... 233
15 -80.0004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  21  13.QQMETGDQRFGDLVFRQLAPNVWQHTGFGAVASNGLIVRDGGR-VLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAA------------------QHSLTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR..... 246
16 -79.6004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  32  1......AGARLPDLKIEKLEEGVYVHTGWGVVSKHGLVVLVNTD-AYLIDTPFTATDTEKLVNWFVE-RGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGK--------------------------VQAKNSFSG-VSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESK. 222
17 -79.2004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  33  1.......AESLPDLKIEKLDEGVYVHTGWGVVPKHGLVVLVNAE-AYLIDTPFTAKDTEKLVTWFVE-RGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDG--------------------------KVQATNSFSG-VNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK. 221
18 -79.1004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  22  36GQQMETGDQRFGDLVFRQLAPNVWQHTGFGAVASNGLIVRDGGR-VLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAA------------------QHSLTFAANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRL.... 271
19 -78.9001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  27  2............GMSLTQVSGPVYVVEDNYYVQENSMVYFGAKG-VTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWAEIVAFTRKGLP--------EYPDLPLVLPNVVHDGDFTLQEGK--VRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK-LGNLSFADVKAYPQTLERLKALPIKTVIGGHDSPHGPELIDHYEALIKAAPQSS.. 228
20 -77.8005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  27  14.EYPTVNEIPVGEVRLYQIADGVWSHIDGAVYPSNGLIVRDGDE-LLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNEIPTHS----------------------LEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSV. 246
21 -76.7002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  29  1.......SQGHKPLEVIKIEDGVYLHTGYGLVDSNGLVVLDNNQ-AYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGK--------------------------PVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGDASISSWADSIKNIVSKPIQMVVPGHGKVGSSDILDHTIDLAESASNKLM. 224
22 -76.5004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  30  3.........EVPELRIEKVKENIFLHTSFGLVSSNGLVVIDKGN-AFIVDTPWSDRDTETLVHWIRK-NGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKE---------------------------PAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGEAHIDQWSRSAQNALSREAQIVIPGHGKIGDIALLKHTKSLAETASNKSI. 224
23 -76.0005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  29  13..ALPALAQGHKPLEVIKIEDGVYLHTSFKNVDSNGLVVLDNNQ-AYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREG--------------------------KPVPTHYFKDD-EFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHELGYVGDASISSWADSIKNIVSYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLM. 241
24 -75.4004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  27  32.EYPTVNEIPVGEVRLYQIADGVWSHIDGAVYPSNGLIVRDGDE-LLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHS----------------------LEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGDADLAEWPTSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSV. 264
25 -75.1002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  27  32.EYPTVSEIPVGEVRLYQIADGVWSHIDGAVYPSNGLIVRDGDE-LLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHS----------------------LEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSAGNVADADLAEWPTSIERIQQHEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSV. 264
26 -75.1002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  29  31.EYPTVDDIPVGEVRLYKIGDGVWSHIGDTVYSSNGLIVRDADE-LLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPAHS----------------------LKALSSSGDVVRFGP--VEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGDANLAEWPATIKRIQQREAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPV. 263
27 -38.5002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  15  5..............SSGLVPRGSHMLR--GDVQVPVFLLRLGEASWALVEGGISRD-AELVWADLCRADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAVRVVERLN-RQLLRAEQRLPEACAWDALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDAL-EGVWRPLVFDDMEAYLESLERLQRLPTLQLIPGHGGLRGRLAADGAESAYTECLRLCR. 260
28 -37.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  15  21...................................TVYVMCGEKLTVMIDAGVSNSIADFSFL-------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSDGLKKLNESAEKVLGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYT-PGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIVIDYKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQ.. 230
29 -35.7002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  13  1...............MKALLPGLYVPIPYPLKTVNLYLLQGAGEVALV-DTALGTRAARGALELHLAELGQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEERGHRFWREPEAFAEASWRLFLDHGTPEGALQERVHPPQNPLPLRDGEALEVAGKRLRVLW-TPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGENPLKDFLRSLDRLADLGARVAYAGHFGP--EELKAHHQARLEALLALLD. 263
30 -35.7001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  11  9.RAYTVDASWLQPMAPLQIADHTWQI---GTEDLTALLVQTPDG-AVLLDGGMPQM-ASHLLDNMKARTPRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSDDLHFGD-------------GITYPPANADRIVMDGEVITVGGIVFTAHFM-AGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGARAGAK........ 242
31 -34.5001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  14  1......AYPMPNPFPPFRIAGNLYYV---GTDDLASYLIVTPRGNILI-NSDLEAN-VPMIKASIKKLKFSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKSDFHYANDS-----------STYFTQSTVDKVLHDGERVELGGTVLTAHLT-PGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGKIAEDYKHSIKVLESMRCDIFLGSHAGMFD.................... 220
32 -34.0003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  16  26.FLAVAMKKWTAPFEPFQLIDNIYYV---GTDGIAVYVIKTSQG-LILMDTAMPQS-TGMIKDNIAKLKVADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYPG-------------DEKNEDLAFPAVKVDRAVKEGDRVTLGDTTLTAHAT-PGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNGIVDDYRATFAKAKAMKIDVLLGPHPEVYG.................... 247
33 -33.9005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  11  2.PGCEVCATWNADQAPFRLFGNTYYV---GMKGLSSVLVTSPQG-HVLIDGGLPES-APKIIANIGALRIEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVG-----------PDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHAT-PGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSPNALADLRHSFETLEKLPCDVLISAHPEASQ.................... 228
34 -33.8005aeb_A mol:protein length:272 LRA-12  ali model follow..  10  9.EPTVSNADWSKPYRPFRIAGNLYYI---GTYDLACYLITTKQGNIIV--NTGLAASALQIKNNIKALKLTDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSSDYAFGGH------------GSMFEPIIADRLLHDKDTIQLGDTKLVMLHH-PGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEGIAKDYAYTLQAMKNLSFDIWVASHASQFS.................... 232
35 -33.8003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  13  6..........SSPQQPFTIYGNTHYV---GTGGISAVLLSSPQG-HILVDGTTEKG-AQVVAANIRAMKLSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPKSDPQFG-----------SLSNFPGSAKVRAVADGELVKLGPLAVKAHAT-PGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSVASLRGSFEAVEKLSCDIAIAAHPEVND.................... 220
36 -33.0004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  12  29.RGCADDAGWNDPAMPQKVYGNTWYV---GTCGISALLVTSDAG-HILVDAATPQA-GPQILANIRALRPEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFE-----------VAEPVAPVANIVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRSCEMVYADSLTAISDDVYAHPGYLAAFRNTLARVAALDCDILVTPHPSASG.................... 255
37 -32.6004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  12  29.RGCADDAGWNDPAMPLKVYGNTWYV---GTCGISALLVTSDAG-HILVDAATPQA-GPQILANIRALRPEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFE-----------VAEPVAPVANIVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRSCEMVYADSLTAISDDVFAHPGYLAAFRNTLARVAALDCDILVTPHPSASG.................... 255
38 -31.6002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  20  12.................................QENAYLVETGEGPVLIDPGDE---PEKLLALFQT-TGLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLA--------------ARAWGLAIPKPPLPVRPLEEGMRL----FGFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVG-LPGADPKALFASLKRLLSLPPETVHPGHGPGTTLGLEARTNPFLTGLEWEA.. 207
39 -28.7004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  16  8..............RVERLSNRVVRVLGCN---TNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQ--------------------QYVYLKDGDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCILGEGTTVFED--LYDYMNSLKELLKIKADIIYPGHGPV-----IHNAEAKIQQYISHRN. 219
40 -28.1002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  13  6..................HRPDLYTFNPARNIDFNGFAWIRPEGNILIDPVALSNHDWKHLESL------GGVVWIVLTN--SDHVRSAKEIADQYTKIAGPVAEKENF------------------------------PIYCDRWLSDGDELVPG---LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYRAGGLE-MNKQKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKELVATL...... 200
41 -26.7005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  13  15......ADTLPAAGDTFEVAPGVRMPLPFSLDHINLWLLIDGQAGWTIVDCGISSEAIRTHWEQIRHLDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTLGEYMFGCNGSNAGGAAAADHFARHGLTDPAALDKLRVPPRYRRLREGDAVKIGARTWRVVT-GYGHSPEHCALHSEADGVLISGDMVLPRISTNVSANPLALYLESLGRYETMAPDLVLPSHGKP--AQLRAHHDARLEEVRVACA. 301
42 -26.1001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  23  10................................KDNYAYILEDTGTVGVVDPSEAEPIIDSL-----KRSGRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAMDKDRI-------------------------------PGIDMALKDGDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSI-GHEYTLSNSKFALSLE........... 183
43 -26.0002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  18  13.................................QNCSLIWCEQRLAALVDPGGD---AEKIKQEVDAS-GVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQGLPAQ-------------SRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHC-PGHTPGHVVFFDEQSQLLISGDVIFKGGVG-FPRGDHTQLIDAIRKLLPLGDDVFIPGHGPLSTLGYERLHNPFLQ........ 209
44 -25.5004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  10  2......SDSKPRDVQVLPIATNTKEYALERGTTSNSYVIEGDK--TAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRAAFPDDNLNI------------------------LPMRGKETLDLGGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFAHICGDDVFDDNWESFEAALEKISDLQVRLYAVGHGPLVRTSLIALTQAYADWSKAQKL. 255
45 -25.0001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  12  32.....................................VYLEHKDRRIIIDPGNLSS-MDELEEKFSEISPDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNV--------------VLLKGEESLFDEKVKVFHT----PWHAREHLSFLLDTENVLITGDITPLSYYDIIKGYGSVQVKNFLDRVGRID--LLVFPHD........................ 206
46 -24.5002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  11  46.....................................YLIQCTDATVLYDTGCHPESECNLPERLRQLSPDDISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRNWDLVGRDERERELAPG---------VNLLNFGTGHASGMLGLAVRLEKFLLVSDACYPPARRAGVLHDTIGYDRTVSHIRQYAESTVLFGHDREQFASLIKSTDGFYE........ 276
47 -23.7004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  17  71.....................................ALEEAARGPILVDTGGPWAR-EALLGALAGVAPGDVTLVVGTHGHSDHIGNLGLFP--GAALLVSHDFCLPGGRYLPHGLGE----------------------------GQPLRLGPG---LEVWAT-PGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQADPAAQERSRKRVLVV-ADVVVPGHGPP...................... 234
48 -23.5001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  13  11.................................DNYMYLVIDDKEAAIVDPVQPQKVVDAA-----RKHGVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGGDDRIGAL----------------------------------THKITHLSTLQVGSLNVKCLAT-PCHTSGHICYFVSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALEVLGRLPPDTRVCGHNNLKFARHVEPGNAAIREKLAWAK. 201
49 -22.9002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  14  33.................................DNFSYLINDHHTLAAVDVNAD---YKPILTYIEEHLKQTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVVGGANDS-------------------------IPAVTKPVREGDRVQVGDLSVEVIDA-PCHTRGHVLYKVQHPQALFTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIKVTFIFPGHEYTSGFMTFSEKTF........... 234
50 -22.4003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  13  38.....................................ILIEHAEGRFLIDTGYDYEKHQTIPGALGLLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARQLLEGTTRANSTFEGIDGDVDLARGVKLIST----PGHSIGHYSLLVEFPRILFTIDAAYTQK-----HIDPVAGVNSMRKVKKLAEDELMYSHDMDNFKTYRTGTQFY.......... 267
51 -21.0003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  12  42.....................................YLLETEEGPILVDTGMPESAVDRIVNILKRVEPDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYK------------------IIEGDYEVVPGVQLLYT----PGHSPGHQSLFIETEQVLLTIDASYTKE---FAGFDPELALSSIKRLKEVVKKIIFFGHDIEQ--KSCRVFPEYI......... 254
52 -21.0002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  12  40.....................................YLLETEEGPILVDTGMPESAVDRIVNILKRVEPDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYK------------------IIEGDYEVVPGVQLLYT----PGHSPGHQSLFIKTEQVLLTIDASYTKE---FAGFDPELALSSIKRLKEVVKKIIFFGHDIEQ--KSCRVFPEYI......... 252
53 -20.5004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  13  28.........................................ESREAVLIDPVLE--TAPRDAQLIKEL-GLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQAD--------------------------------LHIEDGDSIRFGRFALETRAS-PGHTPGCVTFVLNDHSMAFTGDALLCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIPAHDERTLNPRLTLSCEEFVKIMGNLNL 215
54 -20.4002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  10  8.............VQDQEMIPGVY-YHTDEGSSYNSYFID--DECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKI---------------------------MEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFYATSRRWADECDVSHVMKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSK.... 251
55 -18.9001vme_A mol:protein length:410 Flavoprotein  ali model follow..  16  32.................RYFEAVWEIPEGISYNA---YLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEG-----------------------------IKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGLPEILDDSNESVVERYLEGAEKLSSLKIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPK. 258
56 -18.8002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  12  2............KAAAKRISDGVYWTGVLDGTTYNAYLVCGDEGVALISYPGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKH------------------------PSLREAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFQHLCCPQRLDREIPE-LKKFDEVKELGIQMIAPSHGQI...................... 236
57 -18.7002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  14  26.........................................PDKPALLIDPVDKT--VDRDLKLIDEL-GLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKASGSKAD--------------------------------LFLEPGDKVSIGDIYLEVRAT-PGHTAGCVTYVTPQPRMAFTGDAVLCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIPAHDEMQHNPRLTKDKETFKTIMSNLNL 219
58 -18.6004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  13  22.........................................ATRQAVLIDPVLEQ--VDRDLQMVAEL-DLTLTHVFDTHVHADHITASGALRERQATVVGSVNGASCA----------------------------------NVQVRHGDEVRVGQLVFQVLAT-PGHTDDSISYLLGDR--VFTGDALLNGRTDFQNGNASQLYDSLTRVLFTLPDETLVPGHDKRHNPRVAGKSREEFIHIMENLNL 207
59 -18.5003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  18  1...................SNAMYLRRFYDEGLAHASYLVGCQGEACVID----PARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAICVSDEGPPEWKSEYVKAY-------------------------PHRLLKDGDELHFGNVRIVVMHT-PGHTPEHVSYLLYDGKALFSGDFVFVGDVG-SSEALARQMFRSLRKFEALPDHVQVPAHGA....................... 201
60 -18.4001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  12  2..............QPVAITDGIYAFSTHRGTTYNAYLIV--DDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKAH--------------------------HIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFYYANILMPFSNLITKKLDEIQKI-NLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGK. 251
61 -18.0003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  17  16...................SNAMFFKQFYDKHLSQASYLIGCQGEAMIID----PIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDD--------------------------TLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHT-PGHTPESISFLLTDEGGLFSGDFIFVGDIG-SSEIGAKQMFKSIESIKDLPDYIQIPGHGA....................... 215
62 -18.0001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  13  1.............MQATKIIDGFHYTLSPMGTTYNAYLVE--DEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESH--------------------------YKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFYYANIVNPYAPQTLKAIETLVGA-GVAPEFICPDHGVI...................... 229
63 -17.8004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  4.................VVKNNIHEYKTLRGSSYNSYLIR--EEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPE-----------------------------NFNVVKTGDTLDIGGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFYYANILTPFSRLVTPKITEILGF-NLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQE. 247
64 -17.7004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  11  25.FMSPNLFKDIPQQQVHEILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASCFGSSVLSNLKASQPEQVDTILLTHLHPDHVCGVANFPNATVYVSNDEASFWLDPKQAAKLPKEKQANYLGTVEKIKQAIAPYQAKQRFKTYKLGDDIQ-GFKVINT----AGHTPGHFSYELKTESIVFIGDIVHSHTVQF--DIDPKKAVETRLKQFANFAKLPFPGIGHTYSAD.................. 278
65 -17.5004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  14  27.ENLISFAPRGNVAELKTILKDNFRADHYIDMAINI-LLVKTKEKLILMDTGMGIERTGFLLKSLQKASAHDITDIFLSHAHPDHIGGVVDKQNKNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQNILQPKLKFYDLNKTLYSHFNFQLA----PGHTPGLTVTTISSEKLMYVADLIHSDVILF-LDIATASRKKFLKQLADTKARAFWPGLGFT...................... 278
66 -17.5003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  12  2GSDKIENLYFQGDSFKTKSGKELTIT-----FIKHGSLMLTYDNHSIQVDPVSEYADYTTF---------PKADIILITHEHGDHLDAIQAVEKSDTEIIANENSQKKLGKGKVLKNGDTDTSISY------------------MKIEAVPAYNTTPGRDKYHPRHRD---NGYILTFDGLRVYIAGDTEDIPEMKDLKDIDIA---QAAKAARMFSPKILYPYH----GDTKIGELKDALKDSGIDVRI 225
67 -17.4003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  51.....................................ILIQTAQYNLIIDAGIGNGEESHIIADLANYTPKDIDYVLMTHMHFDHAAGLTDQAGHNAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGD------------YSNKLILFEKHFEPVPG---IKMQHSG-GHSFGHTIITIESDKAVHMGDIFPTTAHKNPLDDYPMQSIREKERMIPYFIQWFLFYHDENYFAVKYSDDGENIDAY...... 270
68 -17.3002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  13  23.....................................VLTNDEGRCVIVDPGEAAPVLKAI-----AEHKWMPEAIFLT----DHVGGVKELLQHQMTVYGPAETQ---------------------------------DKGATHLVGDGDTIRVLGEKFTLFAT-PGHTLGHVCYFSRP--YLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLI-AHANIKFALSILPHDSFINEYYRKVK. 196
69 -17.1004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  14  69..............DLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPVVQTNLKASQPEQVDTVLLTHLHPDHACG--LVNADGSPAYPNATVEVPQAELDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGELLPGVSLVAS----SGHTPGHTSYLFKSQSLLVWGDILINHAVQF--DVDSDQARQSRQRILAEAATLPFPGLGHV...................... 303
70 -17.0004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  14  69..............DLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPVVQTNLKASGYQPVDTVLLTHLHPDHACG--LVNADGSPAYPNATVEVPQAELDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEGELLPGVSLVAS----PGHTPGHTSYLFKSQSLLVWGDILLNHAVQF--DVDSDQARQSRQRILAEAATLPFPGLGHV...................... 303
71 -15.9004nur_A mol:protein length:633 PSdsA  ali model follow..  15  74NPSLWRQSQLINISGLFEVTDGIYQVRNYD--LSNMTIVEGKDGITIFDPLISQETAKAALDLYYKHRPKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAENVMAGTAMSRRASGAGLGTTTSAGTVTLIPPTDIIKEGETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTNTYSLRGAKIRDWSKYLNEALKLDVQVMYAMHGNKEVREQLSLQRDMYRYINDET.. 354
72 -15.9002cfu_A mol:protein length:658 SDSA1  ali model follow..  12  92NPSLQRQALLNLKYGLFEVAEGIYQVRGFD--LANITFIRGDSGWIVVDTLTTPATARAAYELVSRELGERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKENVLAGNAMMRRATDMAIGKGLARGPLSLLAPTRLIEGGEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTNLYTLRGAEVRDWSKYINQALHRQAEVMFAVHGNAEIVEVLEKQRDLYGYLHDQT.. 372
73 -15.7004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  14  74NPSLWRQSQINGISGLFKVTDKMYQVRGQD--ISNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQHRPQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISENVLAGNIMSRRALGNGLGVTLATGDPSIIAPTKTIVRGEKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENATHTNFYTLRGAKTRDWTEYLNETLDMDAEVLFMPHGNKHINDYIGKYRDTIKYIHDQT.. 354
74 -15.4001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  15  99....................................GYLVNTGSKLVLVDTGAAGLFGPRLAANLKAAQPEQVDEIYITHMHPDHVGGLMVGEQLNAVVRADQKEADFWLSQTNLDKAPDDESKGFFKGAMASLNPYVK-AGKFKPFSGNTDLVPGIKALAS----HGHTPGHTTYVVESQKLALLGDLILVAAVQF--DSDSKSVAVERKKAFADAAKLSFPGIGHI...................... 311
75 -15.0002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  14  102NPSLWRQAQLNNIAGLFEVMPKLYQVRGLD--PANMTIIEGDSGLVLIDTLTTAETARAALDLYFQHRPKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSENILAGTAMARVDSGLFKTTATNATNTLVAPNVLIEKPYERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPANLLTPRGAEVRDWAGYIDASLEKRTDVLIQQHGGDKVRTYLADQRDMYAFLNNRA.. 383

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 3 1 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13.