current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst GPVDAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGVQTPTALast
1 -126.0004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model  100  1GPVDAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGVQTPTA 238
2 -118.0002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  61  1....MKLLFRQLFENESSTFTYLLADVPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHDYKGFEVSTVGEEMQHNPRLTKDKETFKTIMSNLNLSYPKMIDVAVPANMVCGLQDVPS 242
3 -115.0004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  48  1......MIFRQLFDSESSTYTYLIGDEATRQAVLIDPVLEQVDRDLQMVAELDLTLTHVFDTHVHADHITASGALRERTQATVVG-SVNGASCANVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLGD--RVFTGDALLVRGNGRTDFQNGNASQLYDSLTRVLFTLPDETLVYPGHDYKGRTVTSIAEEKRHNPRVGKSREEFIHIMENLNLPRPKLIDAAVPANRACGHTAPS. 229
4 -81.0004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  31  3..IGNNLHVDAFYDEATSTISYLVMDRETRQCALIDSVLDYADRLVERVNELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHIDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIEDEIAVFVGDTLFMPGTARCDFPGADARTLYRSI-RRLLAFPDQTRLFMCHDYLPQYVTTVAEQRASNIHIGIDEDSFVAMRRDKTLEMPVLILPSVQVNMRSGQLPPP. 279
5 -80.4004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  32  1..GPGSMTVEGFFDPATCTISYLLFDSGSGECALIDSVLDYADQLIARVAALGARVRWLLETHVHADHLSAAPYLKTRVGGEIAIGRHVDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEDAAAFVGDTLFMPGTARCDFPGGDARSLYRSI-RKVLSLPPATRLYMCHDYQPQYASTVADELRENVHIGVTEDDFVAMRRDATLDMPVLMLPSVQVNMRAGRLPEP. 283
6 -54.0001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  22  10................TDNYMYLVIDDETKEAAIVDPV--QPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSEPPAVFTGDTLFVAGCGK--FYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYN.......... 222
7 -49.6002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  24  1......MRVFPVTLGPLQENAYLVET--GEGPVLIDP--DEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLPKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPGADPKALFASL-KRLLSLPPETRVHPGHG-----GTTLGLEARTNPFLT...................................... 201
8 -49.4003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  26  1...SNAMYLRRFYDEGLAHASYLVGCQETGEACVIDPARD-VEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRAGAAICVSDEGPPE---RLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKALFSGDFVFVGDVGRPDLSEALARQMFRSL-RKFEALPDHVQVLPAHALGAVPSSTVGYEKLVNWALQKDEDAFVQALLAGQPEAPIYFARMKLVNKV........ 259
9 -48.9001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  23  10................KDNYAYILHDEDTGTVGVVDP--SEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKL---EGTPKQMLASL-QKITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACN.......... 218
10 -48.7003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  24  16...SNAMFFKQFYDKHLSQASYLIGCQKTGEAMIIDPIRD-LSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTNHTHFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGGLFSGDFIFVGDIGRPDLLEKAAKQMFKSI-ESIKDLPDYIQIWPGHSLGAIPTSTLGYEKQTNWAFSNNEATFIDKLISDQPAPPHHFAQMKKINQF........ 273
11 -47.1002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  28  16.....................SLIWCEQTRLAALVDPGGD-AEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLPLGDDVTFIPGHG-----LSTLGYERLHNPFLQ...................................... 209
12 -45.1002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  23  32................KDNFSYLINDHTTHTLAAVDPILTYIEEHLKQNADVTYTFSTILSTHKHWDHSGGNAKLKAELEAMNSTGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVNDGVALFTGDTMFIAGIGA--FFEGDEKDMCRAMEKNDYALDKVTFIFPGHEYDPSVPSSLAEEKRQNLFLRVADPA---FVAKMNQGNAHALMMYL............. 300
13 -39.7002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  24  17................QDNYIWVLTN-DEGRCVIVDP--GEAAPVLKAIAEHKWMPEAIFLT----DHVGGVKELLQHFPQMTVYGPAETQKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF--SRPYLFCGDTLFSGGCGRL---EGTPSQMYQSL-MKINSLPDDTLICCAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKIN.......... 217
14 -37.3005aeb_A mol:protein length:272 LRA-12  ali model follow..  17  25.....RIAGNLYYIGTYDLACYLITTKQGN--IIVNTGLASALQIKNNIKALGFKTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTEVSSYPGIAKDYAYTL-QAMKNLSFDI-WVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHL................. 269
15 -36.5003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  17  14............VEFPEIATVYVMCG--EKLTVMIDAGVSNSIADFSFLDK----LDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDD--FLFTGDSAFNGVVIPTTPPVIDYKMYMESL-KRQIELKPKV-VGFAH------LVSPKIMEEHLKQMLSKEEIQINVDIG.......................... 236
16 -35.9001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  17  22...............TDDLASYLIVTPRG--NILINSDLANVPMIKASIKKLGFKTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAEVLESMRCDIFL-GSHAGMFDLKNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQETG........... 263
17 -35.7003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  17  13.....TIYGNTHYVGTGGISAVLLSSPQG--HILVDGTTKGAQVVAANIRAMGFKVKYILSTHSHEDHAGGISAMQKLTGATVLAGAAFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLSADSYRFSDHPEVVASLREAVEKLSCDIAI-AAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRL................. 257
18 -35.1005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  21  33....................SVLVTSPQG--HVLIDGGLESAPKIIANIGALGFRVKLILNSHGHIDHAGGLAELQRRSNALVAASPSYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGFNALADLRHSFETLEKLPCDVLI-SAHPEASQLWQRLEASATGGSDAFVDPQACRAYVAAARTLLDSRLDQE.............. 268
19 -34.2003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  18  57....................VYVIKTSQG--LILMDTAMQSTGMIKDNIAKLGFKIKLILNTHAHLDHTGGFAEIKKETGAQLVAGEAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGGQPTYA-GIVDDYRATF-AKAKAMKIDVLL-GPHPEVYGMQAKRAEMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQTAALEK........ 293
20 -33.0001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  19  40....................ALLVQTPDG--AVLLDGMPQMASHLLDNMKARGVTLRLILLSHAHADHAGPVAELKRRTGAKVAANATYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYYRRSFATVRALPCDVLL-TPHPDYAAGARAGAKALTCKAYADAAEQKFDGQLAK.......................... 263
21 -31.8002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  19  38....................VFLLRLGEASWALVEGGISRDAELVWADLCRWVAQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAWKRAVADGEWLELGPHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALGEFDEAEGVWVFDDMEAYLESL-ERLQRLPTLLQLIPGH-------GGLLRGRLAADGAESAYTECLRLCRRL......................... 262
22 -31.5002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  19  19.............ARNIDFNGFAWIRPEG--NILIDPV-ALSNHDWKHLESLG-GVVWIVLT--NSDHVRSAKEIADQTYTKIAGPVAEKPIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDNKQKVVASV-RRLAALEKVEAVLVGD---GWSVFRDGRDR............................................. 192
23 -30.4004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  15  39DPAMPLKVYGNTWYVGTCGISLLVTSDAG--HILVDAATQAGPQILANIRALGFRVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWDDCRQMVYADSLTAISDDVFRYSD-GYLAAFRNTLARVAALDCDILV-TPH---PSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAATSPSSGARP... 303
24 -29.8004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  15  39DPAMPQKVYGNTWYVGTCGISLLVTSDAG--HILVDAATQAGPQILANIRALGFRVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWDDCRQMVYADSLTAISDDVYRYSD-GYLAAFRNTLARVAALDCDILV-TPH---PSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAA........... 295
25 -28.8004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  20  30................QGTNTYLVG--TGPRRILIDT--EYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCIL-----------GEGTTVFEDLYDYMNSLKKADIIYPGHNAEAKIQQYISHRNIREQQIFEKSFTVMELVKIIYKNTPENLHEMAKHNL......... 262
26 -26.5004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  16  40...........................DKGNAFIVDTPWRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYGEAHIDQWSRSAQNALSRYSEAQIVIPGHG.......................................................... 201
27 -25.2004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  20  40...........................VNAEAYLIDTTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG--DANIEAWPKSAKLLKSKYGKAKLVVPSHS.......................................................... 198
28 -24.7004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  18  41...........................VNTDAYLIDT--TDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG--DANLEAWPKSAKILMSKYVKAKLVVSSHS.......................................................... 199
29 -24.4005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  20  58...........................DGDELLLIDT--KNTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRKA---AEAEGNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHPEAEVVIPGHG.......................................................... 223
30 -24.3002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  16  40...........................DNNQAYIIDTPWSDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYGDASISSWADSIKNIVSKKYPIQMVVPGHG.......................................................... 201
31 -24.2002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  16  43...........................TSKGLVLVDS--KLTKELIEMVEKKQKRVTDVIITHAHADHIGGIKTLKERTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGVADAYVNEWSTSIENVLKRYRNINAVVPGHG.......................................................... 206
32 -24.1004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  19  76...........................DGDELLLIDT--KNTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRAA---AEAEGNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVAE................................. 266
33 -24.0003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  16  38...........................TKKGVVLFDV--VQYQSLMDTIKKRNLPVVAVFATHSHDDRAGDLSFFNNKTAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYKEANVEQWPKTINKLKAKYSKATLIIPGHD.......................................................... 201
34 -23.9001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  13  44...........................NNHQAALLDTPINQTETLVNWVADSHAKVTTFIPNHWHGDCIGGLGYLQKKNQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQATSIGISDADVTAWPKTLDKVKAKFPSARYVVPGHG.......................................................... 207
35 -23.8001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  15  44...........................NNHQAALLDTPINQTEMLVNWVTDSHAKVTTFIPNHWHGDCIGGLGYLQRKNQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKPSARYVVPGHG.......................................................... 207
36 -23.8003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  16  43...........................TSKGLVLVDSSWDLTKELIEMVEKKQKRVTDAIITHAHADRIGGIKTLKERTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGVADAYVNEWSTSIENVSKRYRNINAVVPSHG.......................................................... 206
37 -23.6002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  15  49...........................TSKGLVLVDS--KLTKELIEMVEKKQKRVTDVIITHAHASRIGGIKTLKERTALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGVADAYVNEWSTSIENVLKRYRNINAVVPGHG.......................................................... 212
38 -23.4002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  16  75...........................DADELLLIDT--KNTVALLAEIEKQGLPVTRSISTHFHDDRVGGVDVLRAA---AEAAGNEVPAHSLKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQRPEAEVVIPGHNVVKTHKVRPVAE.............................................. 265
39 -23.4002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  19  76...........................DGDELLLIDT--KNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRAARRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE................................. 266
40 -23.2005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  17  57...........................DNNQAYIIDT--EDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYGDASISSWADSIKNIVSKKYPIQMVVPGHG.......................................................... 218
41 -23.1001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  16  34...........................TDKGVVVIDC--DKFKSFTDEIYKKGKKVIMNIATHSHDDRAGGLEYFGKITKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYGEAYVNDWTQSVHNIQQKFSGAQYVVAGHD.......................................................... 197
42 -22.5002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  22  18..............PLKTVNLYLLQGAGE---ALVDTALGTRAARGALLAELGLCVKTILLTHHHPDHYGLSGFFEGIRETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLSPNVGLWAYTRENPLKDFLRSLDRLADLGAR-VAYAGHDVRQRAEELKAHHQARLEALLALLDGPKTAWELSLHLFPQELDPA.............. 283
43 -22.3001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  19  26...............AHFSTVVYL--EHKDRRIIIDPNLSSMDELEEKFSELGISITDVLFTHVHLDHIFNSVLFENAT-IVGRIYSKVISSWKNVVLLKGEESLFDE-KVKVFHTPWHAREHLSFLLNAGRVLITGDIT-----NRLSYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHD.......................................................... 206
44 -21.4004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  18  55...........................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPG-PGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAPKASMIVMSHS.......................................................... 224
45 -21.0004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  20  58...........................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLANGWVEPATAPNFGPLKVFYPG-PGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHS.......................................................... 227
46 -21.0004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  18  66................GGAEAALE--EAARGPILVDTGPWAREALLGALAGQGVAVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGP-GLEVWATPGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVVAD--VVVPGHG.......................................................... 232
47 -20.9003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  18  49...........................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPG-PGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHS.......................................................... 218
48 -20.9004tyf_A mol:protein length:231 NDM-4  ali model follow..  18  43...........................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAAPQEGLVAAQHSLTFAANGWVEPATAPNFGPLKVFYPG-PGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHS.......................................................... 212
49 -20.8005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  18  55...........................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPG-PGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHS.......................................................... 224
50 -20.7003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  17  56...........................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLANGWVEPATAPNFGPLKVFYPG-PGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHTHTARMADKLRKLVPRGSAAAALE................................... 257
51 -20.5004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  13  42...........................LDGTVVIVSSPFEGTQTLMDWVAKTKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEEFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKKLLFGGCMIK---PKELGYLGDANVKAWPDSARRLKKFDAKIVI-PGHG-----------EWGGPEMVNKTIKVAEKAVGEMRL....................... 250
52 -20.3005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  18  47....................LWLLRDEIDGQ-TIVDCGISSEAIRTHWEQIFGLPVLRVLVTHCHPDHFGLANWLCEGGDNVRLWMTLGEYMFGCLMLREGDAVKIGARTWRVVTGYGHSPEHCALHSEADGVLISGDMVLPRISTNVSVPEANPLALYLESLGRYETMAPDTLVLPSHGFRGVRTRIAQLRAHHDARLEEVRVACAE.............................. 302
53 -20.2004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  16  82...........................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLANGWVEPATAPNFGPLKVFYPG-PGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHS------------APDSRAAITHTARMADKLRLV......................... 272
54 -20.0001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  15  22................QENSMVYFGA---KGVTVVGA--DTARELHKLIKRVRKPVLEVINTNYHTDRAGGNAYWKSI--GAKVVSTRQTRDLMNVVHDGDFTLQEGKVRAFYAG-PAHTPDGIFVYFPDEQVLYGGCILK----KLGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPLHGPELIDHYEAL........................................... 220
55 -19.4003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  22  35..................VYSILIEHAEGR--FLIDPIQEKHQTIPGALGLLGLEIDVVVNSHFHFDHCGGNKYFPHAKGATAQLLEGTTRANSTFEGIDGDVDLARGVKL--ISTPGHSIGHYSLLVRRKPILFTIDAAYTQKSLETLCQAADPVAGVNSMRKKKLAEDHGAELMYSHD.......................................................... 253
56 -18.2003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  22  39..................VWCYLLETEEGP--ILVDPKMTEEDRIVNILKRVGYELLYIISSHLHFDHAGGNGAFTNTP-HREEYMKECILPHLNYKIIEGDYEVVPGVQL--LYTPGHSPGHQSLFIQSGSVLLTIDASYTKENFEDEVPF-DPELALSSIKRKEVVKKEKPIIFFGHD.......................................................... 240
57 -18.2002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  22  37..................VWCYLLETEEGP--ILVDPKMTEEDRIVNILKRVGYELLYIISSHLHFDHAGGNGAFTNTALHREEYMKECILPHLNYKIIEGDYEVVPGVQL--LYTPGHSPGHQSLFIQSGSVLLTIDASYTKENFEDEVPF-DPELALSSIKRKEVVKKEKPIIFFGHD.......................................................... 238
58 -17.8003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  13  33...........................GTDGITIIGA--ETAETLYKEIRKVPLPINEVINTNYHTDRAGGNAYWKTL--GAKIVATQMTYDLQKSQWGSPGDFNLQNGSIRAMYLEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGEKVDSIIAGHDTPIHDVGLIDHYLTLLEKAPK..................................... 233
59 -17.4002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  14  43..................VSAYLIQCTDAT--VLYDTIGASECNLPERLRQLGLSISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDATPRNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVKQPGFLLVSDACYTATNYGPPARRADTIGYDRTVSHRQYAESRSLTVLFGHD.......................................................... 260
60 -14.4004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  16  38.............ERGTTSNSYVIEGDKT---AIIDPPESFMKIYLEALQQTLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAGDLRLPMRGKETLDLGK-VLKFLPIP-RWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDNDQRYYFNCLMEKISDLQVRL-YAVGH........................................................... 231
61 -14.1002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  17  24.......NYHGYTLQGTTYNAYLVCGDE--GVALIDNS-ELMARVEDALQQVGMRVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLMTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDRDAARKFYANLITPLSKLVLKKFIAPSHGQIWTDPMKIIE--AYTGWATGMVDERVTVIYDTMHGSTRKMAHAIAEGAM........ 282
62 -13.9002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  13  29.......IFHGYHTDEGSSYSYFIDDECP---TVIDSVYPFAEEWLSRIAACLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKLIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCPEDKILFSNDGFGQHYATSRRWAD-LFKEYTANI-EVASTVEIK-YILSAHGWRGDAMGLAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTG...... 285
63 -13.4003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  16  45...............NLPTHPILI--QTAQYNLIIDA-VDEESHIIADLANYNLTIDYVLMTHMHFDHAAGL-FIAPNIRSKSTYWDKNKGDYSNKLFEKHFEPVPG---IKMQHSGGHSFGHTIITIQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPQQYWFLFYHDENYFAVKYSDDGENID.......................................... 268
64 -13.3001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  14  30..............PMGTTYAYLVEDEKT---TLFDTVAEYKGELLCGIASV--KIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMEQVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFADEKVLISNDIFGQNIAASERFSD-AMREYYANIVNPYAPQTLKAIICPDHGVIFRGADQCTF-QKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFR........ 278
65 -13.0003g1p_A mol:protein length:258 Protein phnP  ali model follow..  12  32.............SPQYRRQPCSGVVKFNDAITLIDAGLHD-----LADRWSPGSFQQFLLTHYHMDHVQGLFPLRWGVGDPIPVYGPPDEQGCDDLFKPFVVFDLQGLQVTPLPL--HSKLTFGYLLAHSRVAWLSDTAGLPEKTLKFLRNNQPQVMVMDCSHPPRADAPRN-----H-------CDLNTVLALNQVIRSPRVILTHISHQFDA---WLMENALPSGFEVG...... 243
66 -12.8001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  16  31..............HRGTTYAYLIVDDKT---ALVDTVEPFKEELIAKLKQIPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKTIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDD-EAAKYYANILMPFSNLITKKLIAPSHGWRKDPGRIIEAYARWA---EGQGKAKAVIAYDTMWLSTEKMAHALMDGLV........ 277
67 -12.7004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  17  30..............LRGSSYSYLIREEKN---VLIDTVHKFSREFVQNLRNE--DIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINNVVKTGDTLDIGN-QLIFVETP-HWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFND-QCQRYYANILTPFSRLVTPKIIATSHGWRDNPTQIVELYLKWA---ADYQEDRITIFYDTMSNNTRMMADAIAQGIA........ 273
68 -11.9004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  13  53.............HYIDMAINILLVK-TKEKLILMDT--ERTGFLLKSLQKAGFSITDIFLSHAHPDHIGG---VVDKQNKLVFPNASIFISKIEKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTIGNEKLMYVADLIHSDVILSGDTDLDIATASRKKFLKQLAD--TKARAFTSH........................................................... 269
69 -11.6004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  19  86...............QTAVNAYLI--NTGDNLVLIDT--PTLGVVQTNLKASGYQVDTVLLTHLHPDHACGPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGELLPG---VSLVASSGHTPGHTSYLFGGQSLLVWGDILINHAVQEFDVDSDQARQSRQRILAEAAT--DKLWVAGAH........................................................... 294
70 -11.6004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  21  86...............QTAVNAYLI--NTGDNLVLIDT--PTLGVVQTNLKASGYQVDTVLLTHLHPDHACGPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEGELLPG---VSLVASPGHTPGHTSYLFGGQSLLVWGDILLNHAVQEFDVDSDQARQSRQRILAEAAT--DKLWVAGAH........................................................... 294
71 -11.6001vme_A mol:protein length:410 Flavoprotein  ali model follow..  14  32..........RYFEPEGISYAYLV--KLNGANVLIDGWGNYAKEFIDALSKIPKEITHIIVNHTEPDHSGSLPATLKTIGHDVEIIASNFGKRL-TVVKDGEEREIGGKKFKFVMTP-HWPDTMTYL---DGILFSCDVGGGYLLPEVERYLPHVTKYIVTV-EKLSSLKIK-ALLPGHGLIWKKDPQRLLNHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLK........ 285
72 -11.6001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  22  92.............PLETSVTGYLV--NTGSKLVLVDT--PTLGRLAANLKAAGYQVDEIYITHMHPDHVGGDDESKGFFKGAMASLNPYVKAGKFKPFSGNTDLVPG---IKALASHGHTPGHTTYVVQGQKLALLGDLILVAAVQQLDSDSKSVAVERKKAFADAAK--GGYLIAASH........................................................... 302
73 -11.3004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  18  55...............QTSINAFLV--NIGKSLILIDS--SHLGSVLSNLKASGYQVDTILLTHLHPDHVCGQANYLGTVEKIKQAIAPYQAKQRFKTYKLGDDIQ-----FKVINTAGHTPGHFSYELKGESIVFIGDIVHSHTVQEYDIDPKKAVETRLKQFANFAK--NGQTIAAPH........................................................... 265
74 -11.1003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  15  37..........................TYDNHSIQVDPVSEYADYT---------KADIILITHEHGDHLDPKAIQAVEKSDTEIIANENSQKKLGVLKNGDTDTSISYMKIEAVPAPRHRDNGYILTFDGLRVYIAGDT--MKDLKDIDLPVNQPYTMTVSQAAKAARMFSPKILYPYH........................................................... 203
75 -10.9003x2x_A mol:protein length:227 UPF0173 metal-dependent hydrolase TM_1162  ali model follow..  13  7...................LGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGL-PKIDYILVTAGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPFLITIEGKKIYHAGDTGELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHIFADVELFKKKVEEKGVE...................... 215

FFAS is supported by the NIH grant R01-GM087218-01
1 1 4 9 7 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Igarashi Y, Eroshkin A, Gramatikova S, Gramatikoff K, Zhang Y, Smith JW,Osterman AL, Godzik A. CutDB: a proteolytic event database. Nucleic Acids Res. 2007 Jan;35(Database issue):D546-9. Epub 2006 Nov 16.