current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4efz_A mol:protein length:298 Metallo-beta-lactamase family protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
# Score Template Links and tools%idFirst GPGSMTVEGFFDPATCTISYLLFDSGSGECALIDSVLDYDPKSGRTRTASADQLIARVAALGARVRWLLETHVHADHLSAAPYLKTRVGGEIAIGRHVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARDAAAFVGDTLFMPDYGTARCDFPGGDARSLYRSIRKVLSLPPATRLYMCHDYQPNGRAIQYASTVADELRENVHIREGVTEDDFVAMRTARDATLDMPVLMLPSVQVNMRAGRLPEPEDNGVRYLKIPLDAILast
1 -146.0004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model  100  1GPGSMTVEGFFDPATCTISYLLFDSGSGECALIDSVLDYDPKSGRTRTASADQLIARVAALGARVRWLLETHVHADHLSAAPYLKTRVGGEIAIGRHVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARDAAAFVGDTLFMPDYGTARCDFPGGDARSLYRSIRKVLSLPPATRLYMCHDYQPNGRAIQYASTVADELRENVHIREGVTEDDFVAMRTARDATLDMPVLMLPSVQVNMRAGRLPEPEDNGVRYLKIPLDAI 298
2 -139.0004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  65  3IGNNLHVDAFYDEATSTISYLVMDRETRQCALIDSVLDYDPKSGRTCSASADRLVERVNELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHITQVQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIEDAG------EIAVFVGDTLFMPDYGTARCDFPGADARTLYRSIRRLLAFPDQTRLFMCHDYLPGGRDMQYVTTVAEQRASNIHIHQGIDEDSFVAMREARDKTLEMPVLILPSVQVNMRSGQLPPPEANGVSYLKIPLNKL 294
3 -87.9004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  29  3......FRQLFDSESSTYTYLIGDEATRQAVLIDPVLE-----------QVDRDLQMVAELDLTLTHVFDTHVHADHITASGALRERTQATVVGSVN--------------------GASCANVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLGD----------RVFTGDALLVR--GNGRTDFQNGNASQLYDSLRVLFTLPDETLVYPGHDYKG-----RTVTSIAEEKRHNPRVA-GKSREEFIHIM--ENLNLPRPKLIDAAVPANRACGHTAPSPQGA........... 233
4 -80.5002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  30  2...KLLFRQLFENESSTFTYLLADVSDKPALLIDPVDK-----------TVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISK-------------------ASGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEG--ADQPQPRMAFTGDAVLIR--GCGRTDFQEGSSDQLYESVSQIFTLPKDTLIYPAHDYKG-----FEVSTVGEEMQHNPRLTK--DKETFKTIM--SNLNLSYPKMIDVAVPANMVCGLQDVPSQAN........... 245
5 -80.4004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  32  3VDAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLET-----------APRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRL-------------------SGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLND--------HSMAFTGDALLIR--GCGRTDFQQGCAKTLYHSVEKIFTLPGDCLIYPAHDYHG-----FTVSTVEEERTLNPRL--TLSCEEFVKIM--GNLNLPKPQQIDFAVPANMRCGVQTPT............... 237
6 -37.4002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  27  15..................AYLVET--GEGPVLIDP-------------DEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGA--------QVFSGDLLFRGSVG--RYDLPGADPKALFASLKRLLSLPPETRVHPGHG----------GTTLGLEARTNPFLTG....................................................... 202
7 -37.3003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  29  1.SNAMYLRRFYDEGLAHASYLVGCQETGEACVIDPARDVEP------------YLLTAKREGLRIVAALETHIHADFVSGAREMADRAGAAICVSDE------------PPEWKSEYVKAYPHRLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKTSPD-VPMALFSGDFVFVGDVG--RPDLLERVARQMFRSLRKFEALPDHVQVLPAHGAGSKALGAVPSSTVGYEKLVNWALQH-KDEDAFV--QALLAGQPEAPIYFARMKLVNKVGPRL.................. 263
8 -36.9003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  21  16.SNAMFFKQFYDKHLSQASYLIGCQKTGEAMIIDPIRDLSS------------YIRVADEEGLTITHAAETHIHADFASGIRDVAIKLNANIYVSG-------------ESDDTLGYKNMPNHHFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGAQ-VPMGLFSGDFIFVGDIG--RPDLLEKAAKQMFKSIESIKDLPDYIQIWPGHGAGSPGKSLGAISTLGYEKQTNWAFSE-NNEATFI--DKLISDQPAPPHHFAQMKKINQFGMNLYQPYT............. 282
9 -34.0001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  24  10..............TDNYMYLVIDDETKEAAIVDPV-------------QPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRI-------------------GALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKP---GGSEPPAVFTGDTLFVAGCGK----FYEGTADEMCKALLEVLRLPPDTRVYCGHEYTINNLKFARHSTLAEEFTYNPFMRVREKTTTMRAVRREKDQ....................................... 254
10 -32.8001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  23  10..............KDNYAYILHDEDTGTVGVVDP-------------SEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKV-IGSAMDKDR-----------------PGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSR--------AIFTGDTMFSLSCGKL------GTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKFALSTTVKMEKACNPFLRSSNTDEALGIIRKAKDD....................................... 253
11 -31.9002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  29  16...................SLIWCEQTRLAALVDPGGD------------AEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYG--VPVIGPEKEDEFWLQGLPAQSRMFGLDECQ-DRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFF--------DEQSQLLISGDVIFKGGVG--RSDFPRGDHTQLIDAIKKLLPLGDDVTFIPGHG----------LSTLGYERLHNPFLQD....................................................... 210
12 -31.5002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  22  32..............KDNFSYLINDHTTHTLAAVDVNADYKPILTYIEEHLKQQ----NADVTYTFSTILSTHKHWDHSGGNAKLKAELEAMNSVGGANDSIPAV------------------TKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHP--NDGVALFTGDTMFIAGIGA----FFEGDEKDMCRAMEKVYALDKVTFIFPGHEYTSGFMTFSEKSSLAEEKRQNLFLRVADPAALMMYLYNACD........................................ 305
13 -31.1005aeb_A mol:protein length:272 LRA-12  ali model follow..  17  22RPFRIAGNLYYIGTYDLACYLITTKQGN--IIVNTGLA----------ASALQIKNNIKALGFKTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGMADGGSSDYAFGGHGSMFEP--IIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYR--ILIANMPTIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDI-WVASH---ASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLN.................................... 270
14 -28.2003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  18  48.........YYVGTDGIAVYVIKTSQG--LILMDTAMP----------QSTGMIKDNIAKLGFKIKLILNTHAHLDHTGGFAEIKKETGAQLVAGEDKPLLEGGYYPGDEKNEDLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDRE--VLFFCSGTVALNRLVGQPTYA-GIVDDYRATFAKAKAMKIDV-LLGPHPEVYGMQA---KRAEMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQT................................. 288
15 -27.9001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  19  18.........YYVGTDDLASYLIVTPRGN--ILINSDLE----------ANVPMIKASIKKLGFKTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGK-YANDSSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQ--AVIIGSIGVNPGYKLVDNITYPKIAEDYKHSIKVLESMRCDI-FLGSH---AGMFDLKNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQE................................. 261
16 -27.3003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  20  19.........HYVGTGGISAVLLSSPQG--HILVDGTTE----------KGAQVVAANIRAMGFKVKYILSTHSHEDHAGGISAMQKLTGATVLAGADTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKD--VVFADSLTAVSADSYRFSDHPE--VASLRGSFEAVEKLSCDI-AIAAH---PEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK................................. 261
17 -27.2003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  17  12........GPVEFPEIATVYVMCG--EKLTVMIDA--------GVSNSIADFSFLD-------KLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGNESAEKVLGDLYYYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDD----------FLFTGDSAGAYFNGVIPTTPPVIDYKMYMESLKRQIELKPKV-VGFAH.................................................................................. 207
18 -26.5001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  21  40..................ALLVQTPDG--AVLLDGGMP----------QMASHLLDNMKARGVTLRLILLSHAHADHAGPVAELKRRTGAKVAANASAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVR---IAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCDV-LLTPHP----------ASNWDYAAGARAGAKALTCKAYADAAEQKFDGQLAKET................................. 265
19 -26.1002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  24  13......IPAFQD----NYIWVLTND-EGRCVIVDP-------------GEAAPVLKAIAEHKWMPEAIFLT----DHVGGVKELLQHFPQMTVYGPAETQDKGA------------------THLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF----------SRPYLFCGDTLFSGGCGRL------GTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSI-----LPHDSFINEYYRKVK--ELRVKKQMTL--PVILKNERKIN........................ 217
20 -25.5005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  20  24.........YYVGMKGLSSVLVTSPQG--HVLIDGGLP----------ESAPKIIANIGALGFRVKLILNSHGHIDHAGGLAELQRRSNALVAASPLDLASGEVGPDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGFKFSASSEYPNALADLRHSFETLEKLPCDV-LISAH---PEASQLWQRLEASATGGSDAFVDPQACRAYVAAARTLLDSRLDQEK................................. 269
21 -24.5004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  15  51.........WYVGTCGISALLVTSDAG--HILVDAATP----------QAGPQILANIRALGFRVRAIVLSHEHFDHAGSLAELQKATGAPVYARADTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTW---RSCEGDDCRQMVYADSLTAISDDVYRYS-HPGYLAAFRNTLARVAALDCDILV-TPHPSASGLWNRI------GPRAAAPLMDTTACRRYAQGARQRLEKRLAEEA................................. 293
22 -24.0004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  15  51.........WYVGTCGISALLVTSDAG--HILVDAATP----------QAGPQILANIRALGFRVRAIVFSHEHFDHAGSLAELQKATGAPVYARADTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTW---RSCEGDDCRQMVYADSLTAISDDVFRYS-HPGYLAAFRNTLARVAALDCDI-LVTPHPSASGLWNRI------GPRAAAPLMDTTACRRYAQGARQRLEKRLAEEA................................. 293
23 -22.0002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  21  38..................VFLLRL-GEASWALVEGGI----------SRDAELVWADLCRWVAQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASEVERLNRQLLRAEQRLPEACAWDALPVRAVADGEWLELGPHRLQVIEAHGHSDDHVVFY--------DVRRRRLFCGDALGEFDEAEGVWPLVFDDMEAYLESLERLQRLPTLLQLIPGH.................................................................................. 235
24 -21.6002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  21  21.............NIDFNGFAWIRPEGN--ILIDP------------VALSNHDWKHLESLG-GVVWIVLTN--SDHVRSAKEIADQTYTKIAGPVA----------------EKENFPIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLEET---------TLITGDLVRAYRAGGLEIDEKLMNKQKVVASVRRLAALEKVEAVLVGD.................................................................................. 181
25 -18.2004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  16  30..............QGTNTYLV-GTGPRRILIDTG--------EPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIG-------NGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE--------ENAIFSGDCIL--GEGTTVFE----DLYDYMNSLKELLKIKADI-IYPGHGPVIHNAEAKIQQYISHRNIR---------EQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLK...... 267
26 -17.0002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  16  24..................LYLLQGAGE---ALVDTALGTRA-----ARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFE-GLGARVFLHEEEFARGHRFWREPEAFAEFLDHGTPEGALLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEG--------VLLAGDAL-LEKVSPNVGLWAYTRENPLLRSLDRLADLGARV-AYAGHFGPIADVRQRAEELKAHHQARLEALLALLDGPKFPQELDPAGRRFAFAETLAH-LEYLREEGAVGRGGPPYRYFRR...... 317
27 -16.4005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  16  48...................WLLRDEIDGQ-TIVDCGISSEAIRTHWEQIFDRHL------DGLPVLRVLVTHCHPDHFGLANWLCEGGDQGARHGLTDPAALDKLRSRRSYYSDLVPAVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALH--------SEADGVLISGDMVLSTNVSVFDLEPEANPLALYLESLGRYETMAPDTLVLPSHGKPFRGVRTRIAQLRAHHDARLEEVRVACAEKPMSAAGDIHQMTFALGEALAHLNLLWLAGELVREHGDDGVIRYA...... 358
28 -16.3004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  13  40.........................DKGNAFIVDT---------PWSDRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQ-------SISTYATTSTNHLL-------KENKKEPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPK--------SKILFGGCFVRSLDSEGL----GEAHIDQWSRSAQNALSRSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSINANASAD................................................... 233
29 -15.9003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  14  38.........................TKKGVVLFDV---------PWEKVQYQSLMDTIKKHNLPVVAVFATHSHDDRAGDLSFFNNK-------GIKTYATAKTNEFLKKDGKATS------TEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFPKYN--------VLDGGCLVKATDLGYI----KEANVEQWPKTINKLKAKYSKATLIIGHDEWKGGGHVEHTLELLNKK............................................................... 219
30 -15.8004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  15  40.........................VNAEAYLIDT---------PFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSR-------SIPTYASELTNELL-------KKDGKVQATNSFSGVNYWLVKNKIEVFYPPGHTPDNVVVWLPE--------RKILFGGGFIKPYGLGNL-----DANIEAWPKSAKLLKSKYGKAKLVV------PSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSNWSHPQ....................................... 233
31 -15.4004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  16  41.........................VNTDAYLIDT---------PFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQ-------SIPTYASELTNELL-------KKDGKVQAKNSFSGVSYWLVKNKIEVFYPPGHTQDNVVVWLPE--------KKILFGGCFVKPDGLGN----LGDANLEAWPKSAKILMSKYVKAKLVV.................................................................................... 195
32 -15.1001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  16  36.........................HKDRRIIIDP-----------NLSSMDELEEKFSELGISITDVLFTHVHLDHIFNSVLFEN---ATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDE-KVKVFHTPWHAREHLSFLL-----DTENAGRVLITGDIT--PNRLSYYDIIKGYGSVQVKNFLDRVGRI---DLLVFPHD................................................................................. 206
33 -15.0005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  15  58.........................DGDELLLIDT---------AWGAKNTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRKA-------GVATYASPSTRRLAEAEGNEIPT--HSLEGLSSSGDAVRFGPVELFYP--AAHSTDNLVVYVPS--------ANVLYGGCAVLALSRTSA-GNVADADLAEWPTSVERIQKHPEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRS........................................................... 245
34 -15.0004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  15  76.........................DGDELLLIDT---------AWGAKNTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRAA-------GVATYASPSTRRLAEAEGNEIPT--HSLEGLSSSGDAVRFGPVELFYP--AAHSTDNLVVYVPS--------ANVLYGGCAVLELSSTSA--NVADADLAEWPTSVERIQKHPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRS........................................................... 263
35 -14.9002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  14  40.........................DNNQAYIIDT---------PWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSK-------SIPTYTSELTKKLL-------AREGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSK--------ILFGGCLVRSHEWEAL---VGDASISSWADSIKNIVSKKYPIQMVVGHGKVGSSDILDHTIDLAESASNKLMTAEASAD................................................... 233
36 -14.7003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  13  49..................GPILVDTGMPESAVNNE--TFVEGQILPKMTEEDRIVNILKRVGYELLYIISSHLHFDHAGGNGAFT---------NTPIIVQRTEYEAALHREKECILPHLNYKIIEGDYEVVP----GVQLLYTPGHSPGHQSLFIE------EQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKPIIFFGHD................................................................................. 240
37 -14.7004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  19  75.........................AARGPILVDT-----------GPWAREALLGALAGQGVAVTLVVGTHGHSDHIGNLGLFPG-------------------AALLVSHDFCLPGGRYLPHGLGEGQPLRLGP-GLEVWATPGHGGQRDVSVV----VAGTALGTVVVAGDVFERDGDEDSWQALS--DPAAQERSRKRVLVVAD--VVVPGHGPETEGGGNSQQEPVVGDEEPALH.......................................................... 266
38 -14.6002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  13  47..................GPILVDTGMPESAVNNE--TFVEGQILPKMTEEDRIVNILKRVGYELLYIISSHLHFDHAGGNGAFT---------NTPIIVQRTEYEAALHREKECILPHLNYKIIEGDYEVVP----GVQLLYTPGHSPGHQSLFI-----KTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKPIIFFGHD................................................................................. 238
39 -14.6001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  18  44.........................NNHQAALLDT---------PINDAQTETLVNWVADSHAKVTTFIPNHWHGDCIGGLGYLQKK-------GVQSYANQMTIDLAKEKGLPVP------EHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPT--------ENILFGGCMLKATSIGNI----SDADVTAWPKTLDKVKAKPSARYVVPGHGDYGGTELIEHTKQIVNQYIEST........................................................... 229
40 -14.6001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  17  44.........................NNHQAALLDT---------PINDAQTEMLVNWVTDSHAKVTTFIPNHWHGDCIGGLGYLQRK-------GVQSYANQMTIDLAKEKGLPVP------EHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPT--------ENILFGGCMLKTTSIGNI----SDADVTAWPKTLDKVKAKPSARYVVPGHGNYGGTELIEHTKQIVNQYIESTS.......................................................... 230
41 -14.3002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  16  75.........................DADELLLIDT---------AWGAKNTVALLAEIEKQGLPVTRSISTHFHDDRVGGVDVLRAA-------GVATYTSPLTRQLAEAAGNEVPA--HSLKALSSSGDVVRFGPVEVFYP--AAHSGDNLVVYVPA--------VRVLFGGCAVHRESAGNV----ADANLAEWPATIKRIQQRPEAEVVIPGHGLPGGLELLQHTTNVVKTHKVRP........................................................... 262
42 -14.3004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  12  20...DSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSS---------PFENLGTQTLMDWVAKTKPKKVVAINTHFHLDGTGGNEIYKKM-------GAETWSSDLTKQLRLEENKKDRIKAAEFYK-LKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKK--------LLFGGCMIKPKELGY----LGDANVKAWPDSARRLKKFDAKI-VIPGHGEWGGPEMVNKTIKVAEKAVGEMRL......................................................... 250
43 -14.3002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  15  76.........................DGDELLLIDT---------AWGAKNTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRAA-------GVATYASPSTRRLAEVEGNEIPT--HSLEGLSSSGDAVRFGPVELFYP--AAHSTDNLVVYVPS--------ASVLYGGCAIYELSRTSA-GNVADADLAEWPTSIERIQQHPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRS........................................................... 263
44 -14.3005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  14  57.........................DNNQAYIIDT---------PWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSK-------SIPTYTSELTKKLL-------AREGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSK--------ILFGGCLVRSHEREGL---VGDASISSWADSIKNIVSKKYPIQMVVGHGKVGSSDILDHTIDLAESASNKLMTAEASAD................................................... 250
45 -13.9001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  14  34.........................TDKGVVVIDC---------PWGEDKFKSFTDEIYKHGKKVIMNIATHSHDDRAGGLEYFGKI-------GAKTYSTKMTDSILAKENKPRA------QYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFPK--------EKVLVGGCIIKSADSKDL---IGEAYVNDWTQSVHNIQQKSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKASN....................................................... 223
46 -13.8003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  20  35................VYSILIEHAEGR--FLIDTGYDYDHVMKVLPQEKHQTIPGALGLLGLEIDVVVNSHFHFDHFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEEGTTRANSTFEGI--DGDVDLARGV--KLISTPGHSIGHYSLLV-----EFPRRKPILFTIDAAYTQKSLETLC--AA-DPVAGVNSMRKVKKLAEDAELMYSHD................................................................................. 253
47 -13.7002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  20  43.........................TSKGLVLVDS---------SWDDKLTKELIEMVEKKQKRVTDVIITHAHADHIGGIKTLKER-------GIKAHSTALTAELAKKNGYEEP------LGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN--------ILVGGSLVKAKDLGNV----ADAYVNEWSTSIENVLKRYRNINAVV.................................................................................... 202
48 -13.5004tyf_A mol:protein length:231 NDM-4  ali model follow..  17  43.........................DGGRVLVVDT---------AWTDDQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-------GIATYANALSNQLAPQEGLVAAQHSLT-NGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTD--------IAFGGCLIKAKSLGNL----GDADTEHYAASARAFGAAPKASMIVMSHS................................................................................. 212
49 -13.5003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  17  56.........................DGGRVLVVDT---------AWTDDQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-------GIATYANALSNQLAPQEGMVAAQHSLT-NGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTD--------IAFGGCLIKDSKAKSL-GNLGDADTEHYAASARAFGAAPKASMIVMSHSAPDSRAAITHTARMADKLRKLVPRGSAAAALE................................................. 257
50 -13.4002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  14  43................VSAYLIQCTDAT--VLYDTGCHPECMGAPYIGASECNLPERLRQLGLSISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDFATGDHSSPYIVKDIEAWLATPRNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAV-----RLEKQPGFLLVSDACYTATNYGPPARRAG-DTIGYDRTVSHIRQYAESLTVLFGHD................................................................................. 260
51 -13.4003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  17  49.........................DGGRVLVVDT---------AWTDDQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-------GIATYANALSNQLAPQEGMVAAQHSLT-NGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDG--------TDIAFGGCLIKAKSLGNL----GDADTEHYAASARAFGAAPKASMIVMSHS................................................................................. 218
52 -13.4004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  17  55.........................DGGRVLVVDT---------AWTDDQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-------GIATYANALSNQLAPQEGMVAAQHSLT-NGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTD--------IAFGGCLIKAKSLGNL----GAADTEHYAASARAFGAAPKASMIVMSHS................................................................................. 224
53 -13.3005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  17  55.........................DGGRVLVVDT---------AWTDDQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-------GIATYANALSNQLAPQEGMVAAQHSLT-NGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTD--------IAFGGCLIKAKSLGNL----GDADTEHYAASARAFGAAPKASMIVMSHS................................................................................. 224
54 -13.1004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  17  58.........................DGGRVLVVDT---------AWTDDQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-------GIATYANALSNQLAPQEGMVAAQHSLT-NGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTD--------IAFGGCLIKAKSLGNL----GDADTEHYAASARAFGAAPKASMIVMSHS................................................................................. 227
55 -13.0002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  19  49.........................TSKGLVLVDS---------SWDDKLTKELIEMVEKKQKRVTDVIITHAHASRIGGIKTLKER-------GIKAHSTALTAELAKKNGYEEP------LGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN--------ILVGGCLVKAKDLGNV----ADAYVNEWSTSIENVLKRYRNINAVV.................................................................................... 208
56 -13.0004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  17  82.........................DGGRVLVVDT---------AWTDDQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-------GIATYANALSNQLAPQEGMVAAQHSLT-NGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDG--------TDIAFGGCLIKAKSLGNL----GDADTEHYAASARAFGAAPKASMIVMSHS................................................................................. 251
57 -12.9003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  19  43.........................TSKGLVLVDS---------SWDDKLTKELIEMVEKKQKRVTDAIITHAHADRIGGIKTLKER-------GIKAHSTALTAELAKKNGYEEP------LGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYN--------ILVGGCLVKAKDLGNV----ADAYVNEWSTSIENVSKRYRNINAVV.................................................................................... 202
58 -12.7001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  12  30.........................GAKGVTVVGA---------TWTPDTARELHKLIKRSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPD-NVVHDGDFTLQEGKVRAFYA--PAHTPDGIFVYFPD--------EQVLYGGCILK-----EKLGNLSFADVKAYPQTLERLKAMKLPIKTVIGHDSPLHGPELIDHY..................................................................... 217
59 -11.9003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  13  33.........................GTDGITIIGA---------TWTPETAETLYKEIRKSPLPINEVINTNYHTDRAGGNAYWKTL-------GAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNPGDFNLQNGSIRAMYLEAHTKDGIFVYFPA--------ERVLYGNCILK-----ENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLT.............................................................. 226
60 -11.8004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  13  68.................................EKLILMDTGMGIFADERTGFLLKSLQKAGFDITDIFLSHAHPDHIGG---VVDKQNKLVFPNASIKAHPERLNQIIPALQNILKAIQPKLKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTI------SSGNEKLMYVADLIHSDVILFPHPDWGFSDLDIATASRKKFLKQLADTKARAFTSHLP.............................................................................. 271
61 -11.0004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  18  67.................................KSLILIDSGAASCFGSHLGSVLSNLKASGYQVDTILLTHLHPDH----------VCGISKDGVANFPNATVY--VSNDEASFWLDPKQAAKLPKEKQANYLGTVEFKVINTAGHTPGHFSYEL------KTKGESIVFIGDIVHSHTVQFDRPETAIEDPKKAVETRLKQFANFAKNGQTIAAPHLP.............................................................................. 267
62 -10.8004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  16  98.................................DNLVLIDTGAAQCFGPTLGVVQTNLKASGYQVDTVLLTHLHPDHANATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLYKTEGELLPG---VSLVASPGHTPGHTSYLF------KSGGQSLLVWGDILLNHAVQFAKPEVV--DSDQARQSRQRILAEAATDKLWVAGAHLP.............................................................................. 296
63 -10.8004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  16  98.................................DNLVLIDTGAAQCFGPTLGVVQTNLKASGYQVDTVLLTHLHPDHANATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLYKTEGELLPG---VSLVASSGHTPGHTSYLF------KSGGQSLLVWGDILINHAVQFAKPEVV--DSDQARQSRQRILAEAATDKLWVAGAHLP.............................................................................. 296
64 -10.7003g1p_A mol:protein length:258 Protein phnP  ali model follow..  14  68...............................................................SFQQFLLTHYHMDHVQGLFPLRWGVGDPIPV--YGPPDEQGCDDLFK-----HPGLLDFSHTVEPFVVFDLQGLQVTPLPL--HSKLTFGYLL------ETAHSRVAWLSDTAGLPEKTLKF--LRNNQPQVM------VMDCSHPPRADAPRNHCDLNTVLALNQVIRSPRVILTHISHQFDAWL-MENALPSGFEVGFDGMEI.............................. 249
65 -9.8801p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  18  106.................................SKLVLVDTGAAGLFGPTLGRLAANLKAAGYQVDEIYITHMHPDH----------VGGLMVGEQLAFPNAVVR--ADQKEADFWLSQTNLDKAFSGNTDLVPG---IKALASHGHTPGHTTYVV------ESQGQKLALLGDLILVAAVQFDDPSVT--DSKSVAVERKKAFADAAKGGYLIAASHLS.............................................................................. 304
66 -9.7603esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  18  55.........................TAQYNLIIDAGIG-EKQLRNFGVDEESHIIADLANYNLTIDYVLMTHMHFDHAAG---LTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWD--ILFEKHFEPVPG---IKMQHSGGHSFGHTIITI------ESQGDKAVHMGDIFPTPLWVTAYDDYPMQSIREKERMIPYFIQ--QQYWFLFYHDYSDDGENIDAYILRETLVDNN............................................................ 280
67 -9.1504ojv_A mol:protein length:369 3`,5`-cyclic-nucleotide phosphodiesterase 1  ali model follow..  11  14GPTEYGTQCFILKPART-ELIAVDGGAGMYQLREMLVQLQSLKRQGEHFESANTMKKTYEVFQGITDYYITHPHLDHISGLVVNSPSISKKKTIWGLPHTIDVLQKHVFNIWPDLTAERSRKLKLPKEVQKCTIFPWDVIPFKV-HHGIGVKTGAPVYSTFDRKSKDCIIVCGDV------EQDRRESEESLLEEFWSYVAENIPLVHLKGILVECSCPLS----------SKPEQLYGHLSPIYLINELSNLNTLYNSSKGLSGLNVIVTHVK........................ 328

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 0 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. VISSA: a program to visualize structural features from structure sequence alignment. Bioinformatics. 2006 Apr 1;22(7):887-8. Epub 2006 Jan 24.