current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4f6h_A mol:protein length:236 Beta-lactamase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSNWSHPQFEKLast
1 -104.0004f6h_A mol:protein length:236 Beta-lactamase  ali model  100  1AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSNWSHPQFEK 236
2 -99.9004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  88  2GARLPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKPSQPSN........ 229
3 -95.7002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  43  1SQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEASA....... 232
4 -93.7005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  44  18AQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHELGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEASA....... 249
5 -93.7004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  45  1NDEVPELRIEKVKENIFLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQPNANASA....... 232
6 -90.9001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  34  5VKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKGLPVPEHGFTDLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQYIESTSKP............. 232
7 -90.9001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  34  5VKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKGLPVPEHGFTDLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSKP............. 232
8 -87.8002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  35  5KNETGTISISQLNKNVWVHTELGSFNGEA-VPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGDAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK...................... 222
9 -87.6003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  35  5KNETGTISISQLNKNVWVHTELGSFNGEA-VPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGDAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK...................... 222
10 -87.5002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  35  11KNETGTISISQLNKNVWVHTELGSFNGEA-VPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGDAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK...................... 228
11 -87.2001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  30  1.....DVKIEKLKDNLYVYTTYNTFNGTK-YAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKAS............. 222
12 -87.2003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  29  1.QVKDFVIEPPIKNNLHIYKTFGVFGGKE-YSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKATSTEIIKTKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNK..................... 218
13 -85.9005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  31  16DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRLE................. 245
14 -85.9003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  30  17DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRKLVPRGSAAAAL....... 256
15 -85.8003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  31  10DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR................... 237
16 -85.6004tyf_A mol:protein length:231 NDM-4  ali model follow..  30  4DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGTFAANGWVEP-ATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR................... 231
17 -84.9004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  31  16DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR................... 243
18 -84.2004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  31  19DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR................... 246
19 -83.3004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  31  43DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRL.................. 271
20 -81.1005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  30  20EIPVGEVRLYQIADGVWSHIATQSFDGAV-YPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNEIPTHSLEGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVA.............. 247
21 -80.3002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  30  37DIPVGEVRLYKIGDGVWSHIATQKLGDTV-YSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPAHSLKALGDVVRFGPVEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGDANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVA.............. 264
22 -79.4004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  30  38EIPVGEVRLYQIADGVWSHIATQSFDGAV-YPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGDADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVA.............. 265
23 -79.2004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  33  8VDLPYNLTATKIDSDVFVVT------DRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENPADNVFDLKQKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGDANVKAWPDSARRLKKF--DAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMR............... 249
24 -78.9002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  31  38EIPVGEVRLYQIADGVWSHIATQSFDGAV-YPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGDAVRFGP--VELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVV.............. 265
25 -77.8003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  22  2..SEKNLTLTHFKGPLYIVE------DKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWKSLPDTVFPG-DFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN-LGNMSFANRTEYPKTLEKLKGLIEKVDSIIAGHDTIHDVGLIDHYLTLLEKAPK.................. 233
26 -75.3001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  22  1....AGMSLTQVSGPVYVVE------DNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWLVLPNVVHDG-DFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK-LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPHGPELIDHYEALIKAAPQSS................ 228
27 -36.7002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  22  9............................GPLQENAYLVETGEGPVLIDPG---DEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLPVRGFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVG-LPGADPKALFASLKRLLSL-PPETRVHPGHGPGTTLGLEARTNPFLTGL.................... 203
28 -36.2002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  17  5.......SSGLVPRGSHMLR-DDDLCLLGDVQVPVFLLRGEASWALVEGGISRD-AELVWADLCRWPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAVRVVERLDGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALAEGVWRPLVFDDMEAYLESLERLQRL-PTLLQLIPGHGGLLRGRLAADGAESAYTECLRLCRRLLWRQSMGESLDE 274
29 -34.5001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  14  18...LQPMAPLQIADHTWQI---------GTEDLTALLVQTPDGAVLLDGG-MPQMASHLLDNMKARGRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSDDLHFG-DGEVITVGGIVFTAHFM-AGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGPHLIEDYRRSFATVRAL--PCDVLLTPHPGASNWDYAAGARAGAKAYADAAEQKFDGQLAKETAGAR 269
30 -33.9003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  14  20................................ATVYVMCGEKLTVMIDAGVSNSIADFSFL------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDGLKKLNE-GNEEFDLGGYRMRLIYT-PGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIVIDYKMYMESLKRQIEL--KPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQ 246
31 -33.9002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  15  1........MKALLPGLYLLP----PIPYPLKTVNLYLLQGAGEVALVDTALGTRAAELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEASWRLFLDHGTPEGALQ-DGEALEVAGKRLRVLW-TPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGENPLKDFLRSLDRLADL--GARVAYAGHFGPIAEELKAHHQARLEALLALLDGPKTAWELSLHLFPQ 278
32 -32.5001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  14  5...PNPFPPFRIAGNLYYV---------GTDDLASYLIVTPRGNILINSD-LEANVPMIKASIKKLGSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKSDFHYA-DGERVELGGTVLTAHLT-PGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGKIAEDYKHSIKVLESM--RCDIFLGSHAPFVDPTGCKNYIEQKANDFYTELKKQETG......... 263
33 -32.4003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  14  6...SSPQQPFTIYGNTHYV---------GTGGISAVLLSSPQGHILVDGT-TEKGAQVVAANIRAMGSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPKSDPQFDGELVKLGPLAVKAHAT-PGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSVASLRGSFEAVEKL--SCDIAIAAHPEVND.................................. 220
34 -32.3004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  14  38...NDPAMPQKVYGNTWYV---------GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALGEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFDDGVVSVGPLALTAVAS-PGHTPGGTSWTWRSCEMVYADSLTAISDDVY--PGYLAAFRNTLARVAAL--DCDILVTPHPPLMDTTACRRYAQGARQRLEKRLAEEAAA......... 295
35 -32.3003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  15  35...TAPFEPFQLIDNIYYV---------GTDGIAVYVIKTSQGLILMDTA-MPQSTGMIKDNIAKLGADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYPGDEKN-EGDRVTLGDTTLTAHAT-PGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNGIVDDYRATFAKAKAM--KIDVLLGPHPEVYGVTYATSLSEDFDKQLAKQTAALEK.......... 293
36 -32.2004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  15  38...NDPAMPLKVYGNTWYV---------GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALGEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFDDGVVSVGPLALTAVAS-PGHTPGGTSWTWRSCEMVYADSLTAISDDVF--PGYLAAFRNTLARVAAL--DCDILVTPHPSASGRRYAQGARQRLEKRLAEEAATSPSSGA....... 301
37 -31.5005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  13  11...NADQAPFRLFGNTYYV---------GMKGLSSVLVTSPQGHVLIDGG-LPESAPKIIANIGALGEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVGPDDPQYDGGQFNVGPVYLTAHAT-PGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSPNALADLRHSFETLEKL--PCDVLISAHPEASQ------LWQRLEASATGGSDAFVDPQACRAYVAA 256
38 -31.5005aeb_A mol:protein length:272 LRA-12  ali model follow..  11  18...SKPYRPFRIAGNLYYI---------GTYDLACYLITTKQGNIIVNTG-LAASALQIKNNIKALGTDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGIIADRLLHDKDTIQLGDTKLVMLHH-PGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEGIAKDYAYTLQAMKNL--SFDIWVASHASQFS.................................. 232
39 -31.4002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  13  6...........HRPDLYSWSTFNPARN---IDFNGFAWIRPEGNILIDPV---ALSNHDWKHLESLG-GVVWIVLTN--SDHVRSAKEIADQYTKIAGPVAEKENFPIY----CDRWLSDGDELVPG--LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYRAGGLE-MNKQKVVASVRRLAAL-EKVEAVLVGDGWSVFRDGRDRLKELVATL.................... 200
40 -31.4004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  19  1SMAAVLQRVERLSNRVVRVLG-CNPGPMTLQGTNTYLVGTGPRRILIDTPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKS-IKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCILGEGTTVFED--LYDYMNSLKELLKI--KADIIYPGHGPVIHEAKIQQYISHRNIREQQILTLFRENFEKSFTVME 241
41 -30.7001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  16  9..............................LKDNYAYILHDEDVGVVDPS----EAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAMDKDRIPGIDMALK----DGDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSL-PDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLP... 205
42 -30.2001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  15  9..............................LTDNYMYLVIDDEAAIVD----PVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGGDDRIGALTHK-------ITHLSTLQVGSLNVKCLAT-PCHTSGHICYFVSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGE.... 208
43 -28.7002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  17  11..............................FSQNCSLIWCEQLAALVDPGGD---AEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQQPLTPDRWLNDGDRVSVGNVTLQVLHC-PGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD..................... 210
44 -27.6001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  14  2.GSDKIMELKILVTG----GNVFVPGRLNAHFSTVVYLEHKDRRIIIDPG-NLSSMDELEEKFSELGDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRL--SYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHD...................................... 206
45 -27.3004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  16  40....ADGSVTLVLPQTRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPWAR-EALLGALAGQGGDVTLVVGTHGHSDHIGNLGLFPGAALLV-----SHDFCLPGGRYLPHGLGEGQPLRLGPG-LEVWAT-PGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVVADVVVPGHGPP.................................... 234
46 -26.1005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  13  23.......DTFEVAPGVRWLR----PLPFSLDHINLWLL-GQAGWTIVDCGISSEAIRTHWEQIFDDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTAAAADHFARHGLTDPAAL-EGDAVKIGARTWRVVT-GYGHSPEHCALHSEADGVLISGDMVLPRISTNVSANPLALYLESLGRYETM-APDTLVLPSHGKP--AQLRAHHDARLEEVRVACAEKPMSAAGIVPIM.. 314
47 -25.4002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  13  31..............................LKDNFSYLINDHTLAAVDVNADYKPILTYIEENADVTYTFSTILSTHKHWDHSGGNAKLKAEPVVVVGGANDSIPAVTKPVR------EGDRVQVGDLSVEVIDA-PCHTRGHVLYKVQHPQALFTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHDKVTFIFPGHRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQN. 274
48 -25.2004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  20  28.......................................ESREAVLIDP--VLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSL-----LPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRAS-PGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDQGCAKTLYHSVHEKIFTLPGDCLIYPAHD...................................... 180
49 -24.5003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  17  2RISMTVKKLYFIPAGRCSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVLLYTPGHSPGHQSLFIETEQVLLTIDASYTKE----AGFDPELALSSIKRLKEVVKKEKIIFFGHDI..................................... 241
50 -24.3002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  18  35..............................LPVWCYLLETEEGPILVDTGMPESAVNNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVLLYTPGHSPGHQSLFIKTEQVLLTIDASYTKE----AGFDPELALSSIKRLKEVVKKEKIIFFGHDI..................................... 239
51 -24.3002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  13  23............NSTFVTPQKPTVSSRLIDIPVSAYLIQCTDATVLYDTGCHPESECNLPERLRQLGDDISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATEAWLATPRNWDLVGRDERERELAP--VNLLNFGTGHASGMLGLAVRLEKFLLVSDACYPPARRAGVLHDTIGYDRTVSHIRQYAESRSLVLFGHDR..................................... 261
52 -23.3004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  20  22.......................................ATRQAVLIDP--VLEQVDRDLQMVAELDLTLTHVFDTHVHADHITASGALRERTQATVVGS------VNGASCANVQVRHGDEVRVGQLVFQVLAT-PGHTDDSISYLLGDR--VFTGDALLVRGNGRTDNGNASQLYDSLTRVLFTLPDETLVYPGHD...................................... 171
53 -23.3002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  20  27........................................DKPALLIDP--VDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTK-----LPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRAT-PGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTDEGSSDQLYESVHSQIFTLPKDTLIYPAHD...................................... 184
54 -23.1003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  18  2....SDTKVYLLDGGSLHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMK-LGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRILFTIDAAYTQK-----HIDPVAGVNSMRKVKKLAEDHGALMYSHDM..................................... 254
55 -22.0004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  13  3DSKPRDVQVLPIATNTKVLRAEIEYALERGTTSNSYVIEGDK-TAIIDPP-VESFMKIYLEALQQTLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRADDNLNILPMRGKETLDLGGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFAHICGDDVFDDNWESFEAALEKISDL--QVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLE.............. 256
56 -21.0002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  17  16..............................FQDNYIWVLTNDECVIVD----PGEAAPVLKAIAEHKWMPEAIFLT----DHVGGVKELLQHQMTVYGPAETQDKGATHLVG------DGDTIRVLGEKFTLFAT-PGHTLGHVCYFSRP--YLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSL-PDDTLICCAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQM... 204
57 -20.2003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  20  30................................SQASYLIGCQKAMIIDP---IRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDDTLGYKNMPNHTHFVHNDDIYVGNIKLKVLHT-PGHTPESISFLLTDEGGLFSGDFIFVGDIG-SSEIGAKQMFKSIESIKDL-PDYIQIWPGHGA..................................... 215
58 -20.1003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  22  15................................AHASYLVGCQEACVIDP---ARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAICVSDEGPPEWKSEYVKPHRLLKDGDELHFGNVRIVVMHT-PGHTPEHVSYLLYDGKALFSGDFVFVGDVG-SSEALARQMFRSLRKFEAL-PDHVQVLPAHGA..................................... 201
59 -19.8003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  11  5.....DISIHYLNGGLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGEESHIIADLANYNKDIDYVLMTHMHFDHAAGLTDQAGHNAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNK-IKMQHSG-GHSFGHTIITIESDKAVHMGDIFPTTAVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGENID...................... 268
60 -19.7002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  18  2.....KAAAKRISDGVY--LRNYHGYTLQGTTYNAYLVCGDEGVALIDN-SYPGTFDELMARVEDAMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREAEFTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFQHLCCPQRLDREIPE-LKKFDEVKELLERIQMIAPSHGQI.................................... 236
61 -19.4004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  14  13.....DVQITALLDGTILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASSHLGSVLSNLKASGEQVDTILLTHLHPDHVCGIANFPNATVYVSNDEKIKQAIAPYQAKQRFKTYKLGDDIQGFKVINT----AGHTPGHFSYELKTESIVFIGDIVHSHTVQF--DIDPKKAVETRLKQFANFAKNGQTIPGIGHTYSAD................................ 278
62 -18.9002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  14  2SSKPKYVQDQEMIPGVYIFHGYHTDEG---SSYNSYFID-DECPTVIDS-VKYPFAEEWLSRIAACLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKI------LIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTAEIKYILSAHGVSWRGDAMGLAIAEYDRWSK.................. 251
63 -18.7001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  15  1......MQATKIIDGFHSRDFHGYTLSPMGTTYNAYLVE-DEKTTLFDT-VKAEYKGELLCGIASVPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESHFHYKDQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVI.................................... 229
64 -18.2001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  16  2.......QPVAITDGIYIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDT-VYEPFKEELIAKLKQIPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKAHYSHIDTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIAANILMPFSNLITKKLDEIQKINLAIKTIAPSHGII.................................... 230
65 -18.1004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  18  13.....ELELFILTDGYIILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGHDITDIFLSHAHPDHIGGVLVFPNASIFISKIENNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNPGHTPGLTVTTISSEKLMYVADLIHSDVILF--DTDLDIATASRKKFLKQLADTKARAPGLGFT.................................... 278
66 -18.1004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  16  44.....DFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGEQVDTVLLTHLHPDHACGLVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEPGHTPGHTSYLFKSQSLLVWGDILLNHAVQF--DVDSDQARQSRQRILAEAATDKLWVPGLGHV.................................... 303
67 -18.1001vme_A mol:protein length:410 Flavoprotein  ali model follow..  21  44..............................ISYNAYLVKLNGANVLIDG-WKGNYAKEFIDALSKIPKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEGFYGIKDVTVVDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSGGYLLPEILDDSNESVVERYLEGAEKLSSL--KIKALLPGHGLI.................................... 237
68 -18.0004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  16  44.....DFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGEQVDTVLLTHLHPDHACGLVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTESGHTPGHTSYLFKSQSLLVWGDILINHAVQF--DVDSDQARQSRQRILAEAATDKLWVPGLGHV.................................... 303
69 -17.6004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  11  4..........VVKNNIHVRDFHGTEYKTLRGSSYNSYLIREEKNVLIDT-VDHKFSREFVQNLRNELADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPEWNFNVVK-TGDTLDIGGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQEDRI............ 250
70 -17.3001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  14  54.....DFEITALSDGTQSALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAGPTLGRLAANLKAAGEQVDEIYITHMHPDHVGGLMRADQKEADFWLSQTNLDKAPDMASLNPYVKAGKFKPFSGNTDLVKALASHGHTPGHTTYVVESQKLALLGDLILVAAVQF--DSDSKSVAVERKKAFADAAKGGYLIPGIGHI.................................... 311
71 -16.5004nur_A mol:protein length:633 PSdsA  ali model follow..  14  89........LFEVTDGIYQVRNYD---------SNMTIVEGKDGITIFDPLISQETAKAALDLYYKHKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAETLIPPTDIIKETTHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTNTYSLRGAKIRDWSKYLNEALKLWGDDVQVMPVWGNKEVREQLSLQRDMYRYINDETLRLANKGYTMTEIAEQ 370
72 -16.4002cfu_A mol:protein length:658 SDSA1  ali model follow..  16  107........LFEVAEGIYQVRGFD---------ANITFIRGDSGWIVVDTLTTPATARAAYELVSREERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKESLLAPTRLIEGEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTNLYTLRGAEVRDWSKYINQALHRFGRQAEVMPRWGNAEIVEVLEKQRDLYGYLHDQTLHLANQGVTIGQVHNR 388
73 -16.3004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  12  28.......................................ETRQCALIDSRTCSASADRLVERVNELNASVRWVLETHVHADHLSAAAYLKEKGAHITQVQKVFGALARDGSQFDVLLEDEEGFRIGNLQARALHT-PGHTPACMSFMIEDEIAVFVGDTLFMPDYGTA-GADARTLYRSIRRLLAFPDQTRLFMGGRDMQYVTTVAEQRASNIHIHQGIDEDSFVAMREARDK... 255
74 -16.2004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  11  89........LFKVTDKMYQVRGQD---------SNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQHQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISESIIAPTKTIVRTKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENATHTNFYTLRGAKTRDWTEYLNETLDMWGNDAEVLPVWGNKHINDYIGKYRDTIKYIHDQTLHLANQGYTMNEIGDM 370
75 -16.1002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  15  117........LFEVMPKLYQVRGLD---------ANMTIIEGDSGLVLIDTLTTAETARAALDLYFQHKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSETLVAPNVLIEKPRHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPANLLTPRGAEVRDWAGYIDASLEKYGDRTDVLPVWGGDKVRTYLADQRDMYAFLNNRALNLMNKGLTLHEIAAE 399

FFAS is supported by the NIH grant R01-GM087218-01
1 0 8 9 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.