current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4fek_A mol:protein length:262 Putative diflavin flavoprotein A 5, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MSDSKPRDVQVLPIATNTKVLRARSWSRLRFEIEYALERGTTSNSYVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAGDLRAAFPDDNLNILPMRGKETLDLGKGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDNWESFKEDQRYYFNCLMAPHAIHVEAALEKISDLQVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLELast
1 -122.0004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model  100  1MSDSKPRDVQVLPIATNTKVLRARSWSRLRFEIEYALERGTTSNSYVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAGDLRAAFPDDNLNILPMRGKETLDLGKGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDNWESFKEDQRYYFNCLMAPHAIHVEAALEKISDLQVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLE 256
2 -91.6002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  24  2..SSKPKYVQDQEMIPGVYWVGIVDWMVRIFHG-YHTDEGSSYNSYFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKATWLIVDDKYTLKIGK-RTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDHVMHLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDMGLAIAEYDRWSKGQHCQ 256
3 -89.2001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  27  2.........QPVAITDGIYWVGAVDWNIRYFHGAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGK-RSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDLIMDEAAKYYANILMPFSNLITKKLDEIQNLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKA 252
4 -89.2001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  20  1........MQATKIIDGFHLVGAIDWNSRDFHGYTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHYKDWPVQVVKHGETLSLGK-RTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPTLERAMREYYANIVNPYAPQTLKAIETLVGVAPEFICPDHGVIFRDQCTFAVQKYVEYAEQKPTN 253
5 -86.8004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  23  1.........MSIVVKNNIHWVGQRDWEVRDFHGEYKTLRGSSYNSYLIREEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGPE----WNFNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDELFEQCQRYYANILTPFSRLVTPKITEILNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQED 248
6 -84.5001vme_A mol:protein length:410 Flavoprotein  ali model follow..  19  12........TERIFDDPEIYVLRIDDDRIRYFEAVWEIPEGISYNAYLVKNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIHDVEIIASNFGKRLLEGFYGIK--DVTVVKDGEEREIGG-KKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGGGYLLPEILDDSNVERYLPHVTKYIVTVIGHYKNYILEGAEKLSSLKIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPKK 259
7 -81.9002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  20  1......MKAAAKRISDGVYWTGVLDWDLRNYHGY--TLQGTTYNAYLVCDEGVALIDNSYPGTFDELMARVEDAVGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLKHYPLREAEFMTVKTGDVLDLGG-KTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPILMDAARKFYANLITPLSKLVLKKFDEVKELRIQMIAPSHGQIWT-DPMKIIEAYTGWATGMVDE 257
8 -39.2002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  14  5.........SSGLVPRGSHMLRLS-----QLDDDLCLLGDVQVPVFLLREASWALVEGGISRDAELVWADLCRWADPSQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAWKEACAWDALPVRAVADGEWLELGPRHRLQVIEAH--HSDDHVVFYDVRRRRLFCGDALGEFDEAEGVWRPLVFDDMEA---------------YLESLERLQRLPLLQLIPGHGGLLRGR.................. 242
9 -26.8003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  21  21...........................................TVYVMCGEKTVMIDAGVSN-------SIADFSFLDKLDYIVLTHLHIDHIGLLPELLQV-YKAKVLVKSGFKKYLTSEKKLDQDKVIEVEGNEEFDLG-GYRMRLIYTP--HARHHMSVLV--DDFLFTGDSAGA---------------------YFNGVVIPTTKMYMESLKRQIELKPKVVGFAHGGLVSPK.................. 214
10 -25.6004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  10  7.HVDLPYNLTATKIDSDVF--------------VVTDRDFYSSNVLVAKMLDVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKM--GAETWSSDLTKQLRLEENKKDRIKAFDLKQGKVFSFS-NELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMI-KPKELGYLGDANVKAW-------------------PDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMR. 249
11 -24.6001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  12  19......QPMAPLQIADHTWQIGTED-----------------LTALLVQPDGAVLLDGGMPQMASHLLDNMKARVTPRDLRLILLSHAHADHAGPVAELKRRT-GAKVAANAESAVLLARGGSDDLH--RIVMDGEVITVG-GIVFTAHFMA--HTPGSTAWTWTDTRNGKPVRIYADSLSAPGYQLQGNPRYPHLIEDY------------RRSFATVRALPCDVLLTPHPGASNWDYAAGARAGAKALTCKA.. 248
12 -24.4003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  10  1...QVKDFVIEPPIKNNLHIYKT--------FGVFGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNK--GIKTYATAKTNEFLKK--DGKATSTEIIKTGKPYRIG-GEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLV-----------------KSNSATDLGYIKEANVEQWPKTINKLKAKKATLIIPGHDEWKGGGHVEHTLELLN........ 217
13 -24.4002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  13  3VIKNETGTISISQLNKNVWVHTELG------------GEAVPSNGLVLNTSKLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFG-NMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLV-----------------KSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEVGDKGLLLHTLDLLK........ 222
14 -24.4001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  10  1.......DVKIEKLKDNLYVYTTYN------------GTKYAANAYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKI--GAKTYSTKMTDSILAK--ENKPRAQYTFDNNKSFKVG-KSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCII-----------------KSADSKDLGYIGEAYVNDWTQSVHNIQQKGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKA 221
15 -24.4001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  14  4.SVKISDDISITQLSDKVYTYVS--------LAEIEGWGMVPSNGIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKK--GVQSYANQMTIDLAKE--KGLPVPEHGFTDSLTVSLD-GMPLQCYYLGGGHATDNIVVWLPTENILFGGCML-----------------KDNQATSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSK 231
16 -24.3001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  14  4.SVKISDDISITQLSDKVYTYVS--------LAEIEGWGMVPSNGIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRK--GVQSYANQMTIDLAKE--KGLPVPEHGFTDSLTVSLD-GMPLQCYYLGGGHATDNIVVWLPTENILFGGCML-----------------KDNQTTSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGNYGGTELIEHTKQIVNQYIESTSK 231
17 -24.3004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  11  41........AMPQKVYGNTWYVGT-----------------CGISALLVTDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVLSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRT-NIVTLADDGVVSVGPL-ALTAVASP--HTPGGTSWTGDDCRQMVYADSLTAISDDVYRYSDDAA-------------HPGYLAAFRNTLARVAALDCDILVTPHP........................ 251
18 -23.9004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  10  41........AMPLKVYGNTWYVGT-----------------CGISALLVTDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVFSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRTDPQVTLADDGVVSVGPL-ALTAVASP--HTPGGTSCEGDDCRQMVYADSLTAISDDVFRYSDDAA-------------HPGYLAAFRNTLARVAALDCDILVTPHP........................ 251
19 -23.8002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  14  10.IKNETGTISISQLNKNVWVHTELG------------GEAVPSNGLVLNTSKLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFG-NMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLV-----------------KSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEVGDKGLLLHTLDLLK........ 228
20 -23.8001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  8........FPPFRIAGNLYYVGTDD-----------------LASYLIVTPRNILINSDLEANVPMIKASIKKLFKFSDTKILLISHAHFDHAAGSELIKQQT-KAKYMVMDEDVSVILSGGKSDFHYAKVLHDGERVELG-GTVLTAHLTP--HTRGCTTWTMKLKDHGKQYQAVGSIGVNPGYKLVDNITYPKIAEDY------------KHSIKVLESMRCDIFLGSHAGM...................... 218
21 -23.7005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  13  19.NEIPVGEVRLYQIADGVWSHIATQ------------GAVYPSNGLIVRGDELLLIDTAGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRKA--GVATYASPSTRRLAEAEGNEIPTHSGLSSSGDAVRFGP---VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLSRTSAGNVADADLAEW-------------------PTSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVA 247
22 -23.7003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  38........FEPFQLIDNIYYVGTDG-----------------IAVYVIKSQGLILMDTAMPQSTGMIKDNIAKLFKVADIKLILNTHAHLDHTGGFAEIKKET-GAQLVAGERDKPLLEGGYYPGDEKNRAVKEGDRVTLG-DTTLTAHATP--HSPGCTWEMTVKDGKEDREVLFFCSGTVALNRLVGQPTYAGIVDDY------------RATFAKAKAMKIDVLLGPHPE....................... 244
23 -23.5003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  13  3VIKNETGTISISQLNKNVWVHTELG------------GEAVPSSGLVLNTSKLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKER--GIKAHSTALTAELAKK--NGYEEPLGDLQTVTNLKFG-NMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLV-----------------KSTSAKDLGNVADAYVNEWSTSIENVSKRNINAVVPSHGEVGDKGLLLHTLDLLK........ 222
24 -23.4004tyf_A mol:protein length:231 NDM-4  ali model follow..  11  3.GDQRFGDLVFRQLAPNVWQHTS--------YLDMPGFGAVASNGIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGLVAAQHSGWVEPATAPNFGP---LKVFYPGPGHTSDNITVGIDGTDIAFGGCL-----------------IKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR..... 231
25 -23.4003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  11  16.GDQRFGDLVFRQLAPNVWQHTS--------YLDMPGFGAVASNGIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGP---LKVFYPGPGHTSDNITVGIDGTDIAFGGCL-----------------IKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRKLVPR 249
26 -23.4005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  12  14........QAPFRLFGNTYYVGMKG-----------------LSSVLVTPQGHVLIDGGLPESAPKIIANIGALFRIEDVKLILNSHGHIDHAGGLAELQRRS-NALVAASPSAALDLASGEVGPDDPQRLARDGGQFNVGP--YLTAHATP--HTPGGLSWTWQSCDGPRCLNMV----YADSINAVSRPGFKFSASSEYPNALADL----RHSFETLEKLPCDVLISAHPEA...................... 226
27 -23.2003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  12  2....SEKNLTLTHFKGPLYIVEDKE--------------YVQENSVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTL--GAKIVATQMTYDLQKS-YPNLEKSLPDTVFPGDFNLQNG-SIRAMYLGEAHTKDGIFVYFPAERVLYGNCIL--KENLGNMSFANRTEYPKTLEK-------------LKGLIEQGELKVDSIIAGHDTPIHD--VGLIDHYLTLLEKAPK. 233
28 -23.2005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  11  15.GDQRFGDLVFRQLAPNVWQHTS--------YLDMPGFGAVASNGIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGP---LKVFYPGPGHTSDNITVGIDGTDIAFGGCL-----------------IKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRLE... 245
29 -23.1003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  10  9.GDQRFGDLVFRQLAPNVWQHTS--------YLDMPGFGAVASNGLIVRDGGVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGP---LKVFYPGPGHTSDNITVGIDGTDIAFGGCL-----------------IKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR..... 237
30 -23.1004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  12  15.GDQRFGDLVFRQLAPNVWQHTS--------YLDMPGFGAVASNGIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGP---LKVFYPGPGHTSDNITVGIDGTDIAFGGCL-----------------IKDSKAKSLGNLGAADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR..... 243
31 -22.8003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  13  9........QQPFTIYGNTHYVGTGG-----------------ISAVLLSPQGHILVDGTTEKGAQVVAANIRAMFKLSDVKYILSTHSHEDHAGGISAMQKLT-GATVLAGAANVDTLRTGVSPKSDPQRAVADGELVKLGP--AVKAHATP--HTEGGIWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASL------------RGSFEAVEKLSCDIAIAAHPEV...................... 218
32 -22.8004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  11  18.GDQRFGDLVFRQLAPNVWQHTS--------YLDMPGFGAVASNGIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGP---LKVFYPGPGHTSDNITVGIDGTDIAFGGCL-----------------IKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR..... 246
33 -22.6004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  13  37.NEIPVGEVRLYQIADGVWSHIATQ------------GAVYPSNGLIVRDDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEAEGNEIPTHSGLSSSGDAVRFGP---VELFYPGAAHSTDNLVVYVPSANVLYGGCA-----------------VLELSSTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVA 265
34 -22.6004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  12  1..NDEVPELRIEKVKENIFLHTS--------YSRVNGFGLVSSNGLVVIDKGNAFI--VDTPWSDRDTETLVHWIRGYELLGSVSTHWHEDRTAGIKWLNDQ--SISTYATTSTNHLLKE---NKKEPAKYTLKGNESTLV-DGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAH-------------IDQWSRSAQNALSRYS--EAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQ 225
35 -22.4004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  11  42.GDQRFGDLVFRQLAPNVWQHTS--------YLDMPGFGAVASNGIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSGWVEPATAPNFGP---LKVFYPGPGHTSDNITVGIDGTDIAFGGCL-----------------IKDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR..... 270
36 -22.4005aeb_A mol:protein length:272 LRA-12  ali model follow..  10  21........YRPFRIAGNLYYIGTYD-----------------LACYLITTKQNIIVNTGLAASALQIKNNIKALFKLTDTKILLTTQAHYDHLGAMAEIKKIT-GAKLMADEGDATVMADGGSSDYAFGRLLHDKDTIQLG-DTKLVMLHHP--HTKGSCSFLFDTKDILIANMP----------------TIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHAS....................... 229
37 -22.4002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  14  35VDDIPVGEVRLYKIGDGVWSHIATQ------------DTVYSSNGLIVRDDELLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAA--GVATYTSPLTRQLAEAAGNEVPAHSALSSSGDVVRFGP---VEVFYPGAAHSGDNLVVYVPAVRVLFGGCA-----------------VHEASRESAGNVADANLAEWPATIKRIQQREAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVA 264
38 -22.3004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  11  1.AGARLPDLKIEKLEEGVYVHTS--------FEEVNGWGVVSKHGLVVLVNTAYLIDTPTATDTEKLVNWFVER--GYKIKGTISSHFHSDSTGGIEWLNSQ--SIPTYASELTNELLKK---DGKVQAKNSFSGVSYWLV-KNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFV----------------KPDGLGNLGDANLEAWPKSAKILMSKY--VKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKK 223
39 -22.2002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  13  37.SEIPVGEVRLYQIADGVWHIATQSFD----------GAVYPSNGLIVRDDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEVEGNEIPTHSGLSSSGDAVRFGP---VELFYPGAAHSTDNLVVYVPSASVLYGGCAILSRTSAGNVADADLAEW-------------------PTSIERIQQHEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVV 265
40 -22.0004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  13  1..AESLPDLKIEKLDEGVYVHTS--------FEEVNGWGVVPKHGLVVLVNAAYLIDTPTAKDTEKLVTWFVER--GYKIKGSISSHFHSDSTGGIEWLNSR--SIPTYASELTNELLKK---DGKVQATNSFSGVNYWLV-KNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFI-KPYGLGNLGDANIEAW-------------------PKSAKLLKSKKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK 222
41 -21.9002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  13  1..SQGHKPLEVIKIEDGVYLHTS--------FKNIEGYGLVDSNGLVVLDNNAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLAR---EGKPVPTHYFKDDEFTLG-NGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLV-------------RSHEWEALGYVGDASISSWADSIKNIVSKK--YPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQ 225
42 -21.7005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  12  16ALAQGHKPLEVIKIEDGVYLHTS-------FKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLAR---EGKPVPTHYFKDDEFTLG-NGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDAS-------------ISSWADSIKNIVSKK--YPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQ 242
43 -21.3004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  12  8.........RVERLSNRVVRVLGCNPGPMTLQ-------GT--NTYLVGTGPRRILIDTGEPAIPEYISCLKQALTNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTIKKLPRNPQREEIIGNGEQQYVYLKDGDVIK-TEGATLRVLYTP--HTDDHMALLLEEENAIFSGDCILGEGTT----------VFEDLYDY------------MNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQ. 224
44 -21.1001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  13  2.......GMSLTQVSGPVY--------------VVEDNYYVQENSVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSI--GAKVVSTRQTRDLMKSDWAE-VLPNVVHDGDFTLQEGK---VRAFYAGPAHTPDGIFVYFPDEQVLYGGCIL--KEKLGNLSFADVKAYPQTLERL-----------------KAMKLPIKTVIGGHDSPLHG--PELIDHYEALIKAAPQS 227
45 -21.0002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  13  1..........MKALLPGLYLLP------------VPIPYPLKTNLYLLQGGEVALVDT-TRAARGALELHLAELLCFQDVKTILLTHHHPDHYGLSGFFEGL--GARVFLHEEEFARGHRFWREPEANPLPLRDGEALEVA-GKRLRVLWTP--HADGHAAFYLEEEGVLLAGDAL-------------LEKVSPNVGLWAYTRENPLKDFLRS-LDRLADLGARVAYAGHFGPIAQRAEELKAHHQA........ 253
46 -20.2002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  14  16..................................FNPARNIDFNGFAWRPEGNILIDPVALS------HDWKHLESLGGVVWIVLTNS--DHVRSAKEIADQT-YTKIAGPVAEKENFPIYCD------RWLSDGDELVPG----LKVMELQGSKTPGELALL-LEETTLITGDLVRAYRAGGLEILPDEKLMNKQ--------------KVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKELVA........ 198
47 -18.8004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  16  66........................................GGAEAALEEARGPILVDTGGPWAREALLGALAGQVAPGDVTLVVGTHGHSDHIGNLG----LFPGAALLVSHDFCLPGGRYLPHG------LGEGQPLRLGPG--LEVWATP--HGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDP-----------------AAQERSRKRVLVV-ADVVVPGHGPPFR.................... 236
48 -18.4001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  14  27........................................HFSTVVYLEKDRRIIIDPGNLSSMDELEEKFSELISPDDITDVLFTHVHLDHIFNSV----LFENATFYVHEVYKTKNYLSFGTSSWKNVVLLKGEESLFDEK--VKVFHTP--HAREFLLDTENAGRVLITGDIT------------------PNRLSYYDIIKGYGSVQVKNFLDRVGRIDL--LVFPHDAPLKPEVKK............... 215
49 -17.2005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  12  14FADTLPAAGDTFEVAPGVRWLR------------MPLPFSLDHNLWLLRDAGWTIVDC-SEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGDNVRLWMTLGEYMFGCLMAAGNGSNYRRLREGDAVKIG-ARTWRVVTGY--HSPEHCALHSEADGVLISGDMV-------------LPRISTNVSVFDLEPEANPLALYLESLGRYETMAPDLVLPSHGK-VRTRIAQLRAHHDA........ 291
50 -16.4002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  17  11........................................LQENAYLVTGEGPVLIDPGDEP------EKLLALFQTTIPLAILLTHAHFDHVGAVAPLVEAL-DLPVYLHPLDLPLYEGAIPKPPLPVRPLEEGMRL-----FGFQVLHLP--HSPGHVAFYDPEGAQVFSGDL---------LFRGSVGR---------YDLPGADPKALFASLKRLLSLPPETVHPGHGPGTTLGLEARTNPFLTGLEWEA.. 207
51 -15.5001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  14  34.......................................GEATSGYLFEHDGFRLLVDCGSGV----LAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGP---FSISFLKTVH---AMRITAGNDIVVYSADSSYIPEFIP--FTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKANVKELLLTHLPHTGNPADLVTEAKQIFS...... 248
52 -14.8002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  11  41........................................IPVSAYLIQTDATVLYDTYIGASECNLPERLRQLLSPDDISTVVLSHLHNDHAGCVEYF----GKSRLIAHEDEFATAVRYFATGDHSSPYIVKERERELAPGVNL-LNFGT--HASGLAVRLEKQPGFLLVSDACYTA-----------TNYGPPARRAGVLHDTIGYDRTVSHIRQYAESRSLTVLFGHDREQFASLIKSTDGFYE........ 276
53 -14.8002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  14  6.......SVEVQVLIENVV-----------FARNFVAEHGLSL--LLKKGNKEIVVDT---GQSENFIKNCGLMIDVGRIKKVVLTHGHYDHIGGLKGLLERNPEVKIYTHKEILNFDLSFYEKYKNNFVLIDKDAEIEEGFTTKNFFVEKEGKRIPDFVVVKEEDGINVVTG----SHAGILNILETARNRFGVSYIKSL-HLRGMEEEKVKDIARKIEEYGVKKVLTGH......................... 249
54 -14.4002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  17  12.........................................SQNCSLIWCEQTALVDPGGD------AEKIKQEVDASTLMQILLTHGHLDHVGAASELAQHY-GVPVIGPEKEDEFWLQGLPAQSRMFRWLNDGDRVSVGN-VTLQVLHCP--HTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPR-----------------GDHTQLIDAIKRKLLPLGDDVFIPGHGPLSTLGYERLHNPF.......... 207
55 -14.4004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  16  14.....................................EPVSCTFTYLLGDRESVLIDPV-LETAPRDAQLIKEL--GLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQAD----------LHIEDGDSIRFGR--ALETRASP--HTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQG------CAKTLYHSVH-----------EKIFTLPGDCIYPAH......................... 179
56 -14.0003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  16  33........................................FPVYSILIEAEGRFLIDTPIQEKHQTIPGALGLLLEPRDIDVVVNSHFHFDHCGGNKYF----PHAKKICHRSEVPQACN-TTRANSTFEGIDGDVDLARG----VKLISTP--HSIGLLVEFPRRKPILFTIDAA---YTQKSLETLCQAAFHIDPVAGVNSM---------RKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFY.......... 267
57 -13.7001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  16  14............................................MYLVIDDETAIVDPVQPQKVVDAARKHG------KLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALTH----------KITHLSTLQVG-SLNVKCLATP--HTSGHICYFGSEPPAVFTGDTLGTADEMCKALLEVLGRLPPDTRVYFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEE................... 218
58 -13.4003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  12  37........................................LPVWCYLLEEEGPILVDTPKMTEEDRIVNILKRVYEPDDLLYIISSHLHFDHAGGNGAF----TNTPIIVQRTEYEAALH-CILPHLNYKIIEGDYEVVPG----VQLLYTP--HSPGLFIETEQSGSVLLTIDAS-----TKENFEDEVPFAGFDPELALSSI---------KRLKEVVKKEKPIIFFGHDI....................... 241
59 -13.3002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  12  35........................................LPVWCYLLEEEGPILVDTPKMTEEDRIVNILKRVYEPDDLLYIISSHLHFDHAGGNGAF----TNTPIIVQRTEYEAALH-CILPHLNYKIIEGDYEVVPG----VQLLYTP--HSPGLFIKTEQSGSVLLTIDAS-----TKENFEDEVPFAGFDPELALSSI---------KRLKEVVKKEKPIIFFGHDI....................... 239
60 -13.0001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  15  14............................................AYILHDEDTGTVGVVDPSEAEPIIDSLKRS----NLTYILNTHHHYDHTGGNLELKDRYG-AKVIGSAMDKDRIPGI--------MALKDGDKWMFA-GHEVHVMDTP--HTKGHISLYFPGSRAIFTGDTMFSLSCGK--------------------LFEGTPKQMLASLQKITSLPDDTIYCGH......................... 169
61 -12.8003bv6_A mol:protein length:379 Metal-dependent hydrolase  ali model follow..  11  49.TVVEPNTFSMWWLGCTGIWLKSAGNTNLSIDFWCGTGKKTQKNRLMNTQHQMMRMGGVEALQPNLRTSIFPDPFAIKEIDAVLASHDHADHINVAAAVLQNCGEHVKFIGPQACVDLWLGWGVPQERCIVAKVGDVLEIGD---VKIRVLDSFDRTALVTLPKGVSNYLIETSGGSVYHSGDSHYSNYYAKHGNDYQ--IDVALLSYGENSSDVLRAAESLDCQVVVPFHHDIWANFQNDPREIEVLWNMKKDR. 324
62 -12.8003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  10  29........................................IKHGSLMLTDNHSIQVDP---------VSEYADYTTFPKADIILITHEHGDHLDPKAIQAVEKSDTEIIANENSQKKLGK-------GKVLKNGDTDTSISYMKIEAVPAYNTTPGRDKYHPRHRDNGYILTFDGLRVYIAGDTEDIPEMKDL-KDIDIAFLPVNQPYTMTVSQAAKAARMFSPKILYPYH......................... 203
63 -12.6002wyl_A mol:protein length:360 L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG  ali model follow..  31.EQVAPGTFAMWWLGCTGIWLKSEGGTNVCVDFWCGTGKQSHGNPLMKQGHQMQRMAGVKKLQPNLRTTPFVDPFAIRQIDAVLATHDHNDHINVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKD-DRTALITLPADQKAAGVLPDGMDDNYLFKTPGGSLYHSGDSHYSNYYAKHGNEHQ--IDVALGSYGENSADMLRMGEALNAKVVIPFHHDIWS.................... 286
64 -12.4002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  14  10.....................................ENESSTFTYLLADKPALLIDPVDKT-VDRDLKLIDEL--GLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKASGSKAD----------LFLEPGDKVSIGD--YLEVRATP--HTAGCVTADQPQPRMAFTGDAVLIRGCGRTDFQEG------SSDQLYESVH-----------SQIFTLPKDTIYPAH......................... 183
65 -12.1004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  17  8.....................................DSESSTYTYLIGDEATVLIDPVLEQ-VDRDLQMVAEL--DLTLTHVFDTHVHADHITASGALRERTQATVVGSVNGASCA------------VQVRHGDEVRVGQ--VFQVLATP--HTDDSI-SYLLGDRV-FTGDALLVRGNGRTDFQNG------NASQLYDSLT-----------RVLFTLPDETVYPGH......................... 170
66 -12.0004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  12  57........................................MAINILLVKKEKLILMDTGMGIFADERTGFLLKSLSAHDITDIFLSHAHPDHIGGVVD--LVFPNASIFISKIEHDFLQNILKAIQPKLKFYDLNKTLYSH----FNFQLAP--HTPGVTTISSGNEKLMYVADLIHSDVILGFSGDTDLDIATASRKKFLKQL----------ADTKARAFTSHLPWPGLGFTKVKA.................. 282
67 -11.8003x2x_A mol:protein length:227 UPF0173 metal-dependent hydrolase TM_1162  ali model follow..  13  9..........................................HAVVLIEGKKNIIIDP----FISGNPVCPVKLEGLPKIDYILVTAGHGDHLGDAVEIAKKN-DATVISNYE----ICHYLGKKGVKTHAMHIGGSFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMH-ELIFADVELFKKKVEE........ 211
68 -11.7004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  14  56........................................TSINAFLVNGKSLILIDSGAASCFGSHLGSVLSNLQPEQVDTILLTHLHPDHVCGISK-VANFPNATVYVSNDEASFYLGTVEKIKQAIAPYQAKQRFKTYKLGDFKVINTA--HTPGSYELKTKGESIVFIGDIVHSHTVQAIEYDIDPKKAVETRLKQFANF----------AKNGQTIAAPHLPFPGIGHTYSADGKSYQWIPIHFKD..... 291
69 -11.6003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  12  12......................................EGLAHASYLVGCQEACVIDPARD--VEPYLLTAKR--EGLRIVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEW--KSEYVKAYPHRLLKDGDELHFGN--RIVVMHTP--HTPEHV-SYLLYDGKTSPDVPMALFSGDFVFVGDVGRPDLLERVAGESGSSEALARQMFRSLRKFEALPDHVVLPAHG........................ 200
70 -11.5003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  14  27......................................KHLSQASYLIGCQKTMIIDPIRD--LSSYIRVADE--EGLTITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTL----YKNMPNHTHFVQHNDDIYVGN--KLKVLHTP--HTPESI-SFLLTDEGAGAQVPMGLFSGDFIFVGDIGRPDLLEKAVKVEGSSEIGAKQMFKSIESIKDLPDYIIWPGHG........................ 214
71 -11.3001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  12  54.......DFEITALSDGTVALPVDKTQSALAKSFQKAPLETSVTGYLVNGSKLVLVDTGAAGLFGPTLGRLAANLQPEQVDEIYITHMHPDHVGGLMV--LAFPNAVVRADQKEADFSKGFFKGAMASLNPYVKAGKFKPFSGNTIKALASH--HTPGTYVVESQGQKLALLGDLILVAAVQTTQLDSDSKSVAVERKKAFADA----------AKGGYLIAASHLSFPGIGHIRAEG.................. 315
72 -11.2004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  16  87........................................TAVNAYLINGDNLVLIDTGAAQCFGPTLGVVQTNLQPEQVDTVLLTHLHPDHACGLVN--PAYPNATVEVPQAEAEFMQGMFKMARQAVAPYAKMNKLKPYKTEGVSLVASS--HTPGSYLFKSGGQSLLVWGDILINHAVQVWEFDVDSDQARQSRQRILAEA----------ATDKLWVAGAHLPFPGLGHVREEA.................. 307
73 -11.1004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  17  87........................................TAVNAYLINGDNLVLIDTGAAQCFGPTLGVVQTNLQPEQVDTVLLTHLHPDHACGLVN-SPAYPNATVEVPQAEAEFMQGMFKMAQQAVAPYAKMNKLKPYKTEGVSLVASP--HTPGSYLFKSGGQSLLVWGDILLNHAVQVFEFDVDSDQARQSRQRILAEA----------ATDKLWVAGAHLPFPGLGHVRKEA.................. 307
74 -10.9002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  12  36............................................SYLINDHTTAAVDVNADY--KPILTYIEEHLKQQTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVVGGANDSIPAVT---KPVREGDRVQVG-DLSVEVIDAP--HTRGHVLYKVQHPQALFTGDTMFIAGI-GAFFEGDEKDMCRAMEKV-----------YHIHKGNDYALDKVTIFPGH......................... 220
75 -10.8003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  11  46........................................LPTHPILIQAQYNLIIDALSEKQLRNFIADLANYLTPKDIDYVLMTHMHFDHAAGLTD--AIFENAIHVVQQSKSTYWDKNKGDYSNKLILFEKHFEPVPG----IKMQHSG--HSFGHTIITIESDKAVHMGDIFPTTAHKN--YDDYPMQSIREKERMIPYFIQQ................................................. 243

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 4 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Robinson-Rechavi M, Alibes A, Godzik A. Contribution of electrostatic interactions, compactness and quaternary structure to protein thermostability: lessons from structural genomics of Thermotoga maritima. J Mol Biol. 2006 Feb 17;356(2):547-57. Epub 2005 Dec 7.