current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4le6_A mol:protein length:324 Organophosphorus hydrolase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MRLFSLSTALSSAMIALVSLPLQAAAPAQQKTQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEGELLPGVSLVASPGHTPGHTSYLFKSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVPVEFSPIRSDRLast
1 -114.0004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model  100  1MRLFSLSTALSSAMIALVSLPLQAAAPAQQKTQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEGELLPGVSLVASPGHTPGHTSYLFKSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVPVEFSPIRSDR 324
2 -113.0004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  98  1MRLFSLSTALSSAMIALVSLPLQAAAPAQQKTQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGELLPGVSLVASSGHTPGHTSYLFKSGGQSLLVWGDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVREEAQGYAWVPVEFSPIRSDR 324
3 -104.0001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  44  10.RLSCVAAVVAATAAVAPLTSTAHAAAPQVRTSAPGYYRMLLGDFEITALSDGTVALPVDKRLNQPAPKTQSALAKSFQKAP--LETSVTGYLVNTGSKLVLVDTGAAGLFGPTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMV-GEQLAFPNAVVRADQKEADFWLSQTNLDKAPDDSKGFFKGAMASLNPYVKAGKFKPFSGNTDLVPGIKALASHGHTPGHTTYVVESQGQKLALLGDLILVAAVQFDDPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIAASHLSFPGIGHIRAEGKGYRFVPVNYSVVNPK. 331
4 -103.0004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  45  1...............................KQVAGYYQYQAGDVQITALLDGTNFMSPNLFKDIPQQQVHEILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASCFGSHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISK-DGVANFPNATVYVSNDEASFWLDPKQAAKLPKEKQANYEKIKQAIAPYQAKQRFKTYKLG-DDIQGFKVINTAGHTPGHFSYELKTKGESIVFIGDIVHSHTVQFDRPETAIEYDIDPKKAVETRLKQFANFAKNGQTIAAPHLPFPGIGHTYSDGKSYQWIPIHFK...... 290
5 -101.0004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  28  1...............................DDLSGFKKIKLGELELFILTDGYIHEENLFAPRGNVAELKTILKDNFRADHY-IDMAINILLVKTKEKLILMDTGMGIFADERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLVFPNASIFISKIEHDFWINASILKAHPERLNQIIPALQNILKAI--QPKLKFYDLNKTLYSHFNFQLAPGHTPGLTVTTISSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKVKAPGFEWIPESFM...... 293
6 -73.6003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  21  1.......................................MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNA--NERNQINLPTHPILIQTAQYNLIIDAGIGNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKST--------YWDKNKGDY--SNKLILFEKHFEPVPGIKMQHSGGHSFGHTIITIESQGDKAVHMGDIF--PTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAYILRETLVDNN. 280
7 -50.4001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  18  1.............................................................MGSDKIMELKILVTGGNVFVPGLNAHFSTVVYLEHKDRRIIIDPGNL----SSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNS------VLFENATFYVHEVYKTKNYLSFGTIVGRIYSK-----------VISSWKNVVLLKGEESLFEKVKVFHTPWHAREHLSFLLDTENARVLITGDITPNRLSY---------YDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPL........................... 209
8 -48.6004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  19  3............................TEPLCGASPLLVPGDPYSVVVLLQGYAEPEGV--GSVTLVLPQTRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPW----AREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNL------GLFPGAALLVSHDFCLPGGRYLPHGLGEG--------------------------QPLRLGPGLEVWATPGHGGQRDVSVVVAGTALVVVAGDVFERDG----DEDSWQALSEDPAAQERSRKRVLVVAD----VVVPGHGP-----RVLREASQPETEGGGNSQQEP.. 256
9 -43.7003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  18  1.........................................MSDTKVYLLDGGSLVLDGYHVFWNRGPG-------------GEVRFPVYSILIEHAEGRFLIDTGYDY-IQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGN------KYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGA-RANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEPRRKPILFTIDAAYTQK----ETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDM---FKTYRTGTQFYG............. 268
10 -40.3002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  24  1.......................................MDMTVKKLYFIPAGRCMLDHSSVNSAL-------------TPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLIVNILKRVGYEPDDLLYIISSHLHFDHAGGN------GAFTNTPIIVQRTEYEAALHREEYMKE-----------------ILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKEQSGSVLLTIDASYTKEFEDEVP----FAGFDPELALSSIKRLKEVVKKEKPIIFFGH.............................. 237
11 -40.2003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  23  2......................................RISMTVKKLYFIPAGRCMLDHSSVNSAL-------------TPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLIVNILKRVGYEPDDLLYIISSHLHFDHAGGN------GAFTNTPIIVQRTEYEAALHREEYMKE-----------------ILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIEEQSGSVLLTIDASYTKEFEDEVP----FAGFDPELALSSIKRLKEVVKKEKPIIFFGH.............................. 239
12 -40.1002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  19  2...........................................GNKLFVLDLGEIRVDENFII----ANSTFVTPQKPTVSSRLIDIPVSAYLIQCTDATVLYDTGCHPECMGTNGRLPERLRQLGLSPDDISTVVLSHLHNDHAGCV------EYFGKSRLIAHEDEFATAVRYFATGDHSSPY--IVKDIEAWLATPRNWDLVGRDERERELAPGVNLLFGTGHASGMLGLAVREKQPGFLLVSDACYTAT-NYGPPARRAGVLHDTIGYDRTVSHIRQYAESRSLTVLFGHDR---FASLIKSTDGF.............. 274
13 -28.8004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  18  1MKRRFTLLGSVVALALSSTALASDAPASRGCADDAGWND----PAMPQKVYGNTWYVGTC---------------------------GISALLVTSDAGHILVDAATPQ----AGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKAT---GAPVYARAPAIDTLKRGLPDRTDPQFEVA---------EPVAPVANIVTLADDGVVSVGLTAVASPGHTPGGTSWTWEGDDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARVAALDCD---ILVTPHPSASGLWNRIGPRAAAPLM........... 269
14 -28.7002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  18  1.........................................MGSSSSGLVPRGSHMLRLSAPGQLDDD-----------------DVQVPVFLLRLGEAWALVEGGISR----DAELVWADLCRWVADPSQVHYWLITHKHYDHCGLL-----CPRLPNVQVLASERTCQAWKSESAVRVVERLNRQLLRAEQRLPEACADALPVRAVADGEWLELGLQVIEAHGHSDDHVVFY--DVRRRRLFCGDALGEFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLL----QLIPGH.............................. 235
15 -28.3004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  18  1MKRRFTLLGSVVALALSSTALASDAPASRGCADDAGWND----PAMPLKVYGNTWYVGTC---------------------------GISALLVTSDAGHILVDAATPQ----AGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKAT---GAPVYARAPAIDTLKRGLPDRTDPQFEVA---------EPVAPVANIVTLADDGVVSVGLTAVASPGHTPGGTSWTWEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCD---ILVTPH.............................. 250
16 -27.8005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  20  30.......................................................................................GLSSVLVTSPQGHVLIDGGLPE----SAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRS---NALVAASPSAALDLASGEVGPDDPQ---------YHALPKYPPVKDMRLARDGGQFNVGLTAHATPGHTPGGLSWTWQSCDGNMVYADSI------AVSRPGFKFSASSEYPNALADLRHSFETLEKLPCVLISAHPEASQLWQRLEASATGGSDA.......... 243
17 -27.3003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  20  20........................................................................................ATVYVMCGEKLTVMIDAGVSNSI---------------SFLDKLDYIVLTHLHIDHIGLLPE----LQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDLYYVYGG-LDQDKVIEVEGNEEFDLGMRLIYTPGHARHHMSVLVDD----FLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKV-----VGFAHGGLVSPKIMEE................... 218
18 -27.3003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  18  25.......................................................................................GISAVLLSSPQGHILVDGTTEK----GAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLT---GATVLAGAANVDTLRTGVSPKSDPQ----------GSLSNFPGSAKVRAVADGELVKLGVKAHATPGHTEGGITWTWQSCEQDVVFADSLTAVSADSYRFSDH-------PEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSA.......... 235
19 -27.2005aeb_A mol:protein length:272 LRA-12  ali model follow..  18  35.....................................................................................TYDLACYLITTKQGNIIVNTGLAA----SALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKIT---GAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIAD----------RLLHDKDTIQLGLVMLHHPGHTKGSCSFLFDTKDERILIANMPTIVIEKKFSE------VSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKS.......... 247
20 -27.2001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  20  37.......................................................................................DLTALLVQTPDGAVLLDGGMPQ----MASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRT---GAKVAANAESAVLLARGGSDDL-----------HFGDGITYPPANADRIVMDGEVITVGFTAHFMAGHTPGSTAWTWTDTRNRIAYADSLSAPGYQLQGNPR----YPHLIEDYRRSFATVRALPCD---VLLTPH.............................. 225
21 -27.0001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  15  24.......................................................................................DLASYLIVTPRGNILINSDLEA----NVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQT---KAKYMVMDEDVSVILSGGKSDFHYANDSS---------TYFTQSTVDKVLHDGERVELGLTAHLTPGHTRGCTTWTMKLKDHGKQ--YQAVIIGSIGVNPGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVLLSKGQNNP.......... 235
22 -26.7003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  17  1MRRLTAALCALTLLSTGAQAQTIKDFLAVAMKK----------PFEPFQLIDNIYYVGTD---------------------------GIAVYVIKTSQGLILMDTAMPQ----STGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKET---GAQLVAGERDKPLLEGGYYPGDEKNED-----------LAFPAVKVDRAVKEGDRVTLGLTAHATPGHSPGCTSWEMTVKDGEVLFFCSGTVALNRLVGQPT----YAGIVDDYRATFAKAKAMKID---VLLGPH.............................. 242
23 -22.9002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  21  2...................................................................KALLPGLYLLPVPIPYPLK-TVNLYLLQGAGEVALVDTALGT--RAARGALELHLAELGLCFQDVKTILLTHHHPDHYGGFFEGLGARVFLHEEEFAAEASWRLFLDHGTPEGALQGIRETVEKTRERVHP---PQNPLPLRDGEALEVALRVLWTPGHADGHAAFYLEE--EGVLLAGDAL----LEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGH.............................. 233
24 -22.5002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  26  10.....................................................................................PLQENAYLVETGEGPVLIDPGD------EPEKLLALFQTTGLIPLAI---LLTHAHFDHVGAVAPLVEALDLP---VYLHPLDLPLYEGADLAARA----------------AIPKPPLPVRPLEEGMRLFGFQVLHLPGHSPGHVAFYDPE--GAQVFSGDLLFRGSVRYDLPG-------DPKALFASLKRLLS--LPPETRVHPGHGPGTTLGLEARTNTGLEW............ 205
25 -22.1004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  18  1MLKVISSLLVYMTAS-VMAVASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADG-------------------VWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA---KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGVLRAAGVATYASPSTR--------------------------RLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGHSTDNLVVYVPS--ANVLYGGCAVLELSS----TSAGNVADADLAEWPTSVERIQKHYPEAEVVI-------PGHGLP..................... 243
26 -21.5002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  16  1MFQ--IRSFLVGISAFVMAVLGSAAYSAQPGGEYPTVDDIPVGEVRLYKIGDG-------------------VWSHIATQKLGDTVYSSNGLIVRDADELLLIDTAWGA---KNTVALLAEIEKQIGLP--VTRSISTHFHDDRVGGV------DVLRAAGVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVV----RFGPVEVFYPG------------AAHSGDNLVVYVPA--VRVLFGGCAVHEASR----ESAGNVADANLAEWPATIKRIQQRYPEAEVVI-------PGHGLP..................... 242
27 -21.3002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  17  2..FKLLSKLLVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADG-------------------VWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA---KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGV---------------------DVLRAAGVATYASPSTRRLAEVEGNEIPTHSLE---GLSSSGDAVRFGPVELFYPGHSTDNLVVYVPS--ASVLYGGCAIY----ELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVI-------PGHGLP..................... 243
28 -20.5005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  18  1...................GPSPLAHSGEPSGEYPTVNEIPVGEVRLYQIADG-------------------VWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA---KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGVLRKAGVATYASPSTR--------------------------RLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGHSTDNLVVYVPS--ANVLYGGCAV----LALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVI-------PGHGLP..................... 225
29 -20.3004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  14  7MHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETG--DQRFGDLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGM--------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP..................... 253
30 -19.8004tyf_A mol:protein length:231 NDM-4  ali model follow..  14  1...................................GPGDQRFGDLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD-------------ALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP..................... 214
31 -19.7002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  18  1..................................KTVIKNETGTISISQLNKN-------------------VWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDD---KLTKELIEMVEKKFQKR--VTDVIITHAHADHIGGI------KTLKERGIKAHSTA----------------------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETKGHTEDNIVVWLPQ--YNILVGGSLVKSTSA----KDLGNVADAYVNEWSTSIENVLKRYRNINAVV-------PGHGEV..................... 208
32 -19.6004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  14  1.......................SNAIRPTIGQQMETGDQRFGDLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGM--------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGAADTEHYAASARAFGAAFPKASMIV-------MSHSAP..................... 226
33 -19.4004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  13  1....................GSHMGEIRPTIGQQMETGDQRFGDLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD-------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP..................... 229
34 -19.4003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  14  1.............................SNANYMETGDQRFGDLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD-------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP..................... 220
35 -19.3004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  13  6...........................................ELRIEKVKENI------------------FLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSD---RDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIK-------------WLNDQSISTYATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIEVFYPG------------GGHTIDNVVVWLPK--SKILFGGCFVRSLDS----EGLGYTGEAHIDQWSRSAQNALSRYSEAQIVI-------PGHGKI..................... 203
36 -19.3003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  15  1..................................KTVIKNETGTISISQLNKN-------------------VWVHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDD---KLTKELIEMVEKKFQKR--VTDAIITHAHADRIGGI------KTLKERGIKAHSTA----------------------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETKGHTEDNIVVWLPQ--YNILVGGCLVKSTSA----KDLGNVADAYVNEWSTSIENVSKRYRNINAVV-------PSHGEV..................... 208
37 -19.2005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  14  21...........................................DLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD-------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP..................... 226
38 -19.2002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  16  1............................ASQKVEKTVIKNETGTISISQLNKN-------------------VWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDD---KLTKELIEMVEKKFQKR--VTDVIITHAHASRIGGI------KTLKERGIKAHSTA----------------------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETKGHTEDNIVVWLPQ--YNILVGGCLVKSTSA----KDLGNVADAYVNEWSTSIENVLKRYRNINAVV-------PGHGEV..................... 214
39 -18.9003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  14  2.......................PGEIRPTIGQQMETGDQRFGDLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD-------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP..................... 227
40 -18.5002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  22  9..................................................................................TAFSQNCSLIWCEQTRLAALVDPGG------DAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHYGVP---VIGPEKEDEFWLQ-----GLPAQSRMFGLDECQPLTP-------RWLNDGDRVSVGLQVLHCPGHTPGHVVFF--DEQSQLLISGDVIFKGGVG----RSDFPRGDHTQLIDAIKRKLLP--LGDDVTFIPGHGPLSTLGYERLHN................. 205
41 -18.4003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  18  32.........................................................................................NSMYLVTKKGVVLFDVPWEKVQYQ---SLMDTIKKRHNLP--VVAVFATHSHDDRAGDL---------------------SFFNNKGIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFV---VDFLGEGHTADNVVVWFPK--YNVLDGGCLVKSNSA----TDLGYIKEANVEQWPKTINKLKAKYSKATLII-------PGHDEW..................... 203
42 -18.2002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  19  21.....................................................................................NIDFNGFAWIRPEGNILIDPV------ALSNHDWKHLESLG----GVVWIVLTN--SDHVRSAKEIADQ----YTKIAGPVAEKENFPIYCD----------------------------RWLSDGDELVPGLKVMELQGKTPGELALLLEET---TLITGDLVRAYRAGGLEILPDEKL-MNKQKVVASVRRLAALEKVEAV--------LVGDG....................... 182
43 -18.1004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  16  6...........................................DLKIEKLDEGV------------------YVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTA---KDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGIE-------------WLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPG------------PGHTPDNVVVWLPE--RKILFGGGFIKPYGLGN---------DANIEAWPKSAKLLKSKYGKAKLVV-------PSHSEV..................... 200
44 -18.0001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  17  10...........................................DISITQLSDKV------------------YTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPIND---AQTEMLVNWVTDSLHAK--VTTFIPNHWHGDCIGGL---------------------GYLQRKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPL----CYYLGGGHATDNIVVWLPT--ENILFGGCMLKDNQT----TSIGNISDADVTAWPKTLDKVKAKFPSARYVV-------PGHGNY..................... 209
45 -18.0001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  19  1...........................................DVKIEKLKDN-------------------LYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGE---DKFKSFTDEIYKKHGKK--VIMNIATHSHDDRAGGL---------------------EYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQ---VYYPGKGHTADNVVVWFPK--EKVLVGGCIIKSADS----KDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVV-------AGHDDW..................... 199
46 -17.9001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  13  4....................................................................SLTQVSGPVYVVEDNYYVQE-NSMVYFGAKGVTVVGATWTPDTAR---ELHKLIKRVSRKP--VLEVINTNYHTDRAGGYWKSIGAKVVSTRQTRDLMKS-----DWAEIVAFTRKGLPEYPDLPLVLPNVVHDGDFTLQEGKVRAF-----YAGPAHTPDGIFVYFPD--EQVLYGGCILKEKLGNLS--------FADVKAYPQTLERLKAMKLPIKTVI-------GGHDSPLHGPELIDHYEALIKAAPQS. 227
47 -17.9001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  17  10...........................................DISITQLSDKV------------------YTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPIND---AQTETLVNWVADSLHAK--VTTFIPNHWHGDCIGGL---------------------GYLQKKGVQSYANQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPL----CYYLGGGHATDNIVVWLPT--ENILFGGCMLKDNQA----TSIGNISDADVTAWPKTLDKVKAKFPSARYVV-------PGHGDY..................... 209
48 -17.9005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  15  23.................................................................DTFEVAPGVRWLRMPLPFSLD-HINLWLLRGQAGWTIVDCGISS---EAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGNWLCEGGDQGRWNVRLWMTLGEYMF-AAGNGSNAGGAAAADHFARHGLTDPAALDKPRYRRLREGDAVKIG-RVVTGYGHSPEHCAL---SEADGVLISGDMV----LPRISTNVSV--EANPLALYLESLGRYETMAPDTLVLPSHGKPFRGV........................ 278
49 -17.8005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  18  1MKNVLVFLILLVALPALAQGHK---------------------PLEVIKIEDGV------------------YLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLL------LSWATDRGYQVMASISTHSHEDRTAGI---------------------KLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIEL----YYPGAGHTEDNIVAWLPK--SKILFGGCLVRSHER----EGLGYVGDASISSWADSIKNIVSKKYPIQMVV-------PGHGKVGSSD................. 224
50 -17.8004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  15  7...........................................DLKIEKLEEGV------------------YVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTA---TDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIE-------------WLNSQSIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPG------------PGHTQDNVVVWLPE--KKILFGGCFVKPDGLGN---------DANLEAWPKSAKILMSKYVKAKLVV-------SSHSEI..................... 201
51 -17.5002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  18  6...........................................PLEVIKIEDGV------------------YLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLL------LSWATDRGYQVMASISTHSHEDRTAGIK-------------LLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPG------------AGHTEDNIVAWLPK--SKILFGGCLVRSHEW----EALGYVGDASISSWADSIKNIVSKKYPIQMVV-------PGHGKV..................... 203
52 -17.3003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  10  27.........................................................................................NSMVYIGTDGITIIGATWTPETAE---TLYKEIRKVSPLP--INEVINTNYHTDRAGGYWKTLGAKIVATQMTYDLQKS-----QWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAM-----YLGEAHTKDGIFVYFPA--ERVLYGNCILKENLGNMS--------FANRTEYPKTLEKLKGLIEQGEL---KVDSIIAGHDTPIHDVGLID............. 222
53 -17.1004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  14  15....................................................................TATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQ---TLMDWVAKTMKPK--KVVAINTHFHLDGTGGIYKKMGAETWSSDLTKQLRLE----ENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVPAHSPDNVVVYFPK--KKLLFGGCMIKPKELGY---------DANVKAWPDSARRLKKFDAK---------IVIPGHGEW..................... 228
54 -16.9002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  13  1.............................................................MRGSGSVEVQVLIENVVFARNFVAEHGLS-LLLKKGNKEIVVDTGQSEN-------FIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPEVKIYTHKEILNKKYAMRKGGQFEEIGFDLSFYE---------KYKNNFVLIDKDAEIEEGFYVITTYDNEFTTKNFFVEKEGKRI---DKFLDEVFVVVKEEDGINVVTGCSHAGILNILETARNRFGVSSLIGGFHLRGMEEEKVKDIARKIE............. 238
55 -16.6004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  18  8.................................................................RVERLSNRVVRVLGCNPGPMTLGTNTYLVGTGPRRILIDTG-EPAIPEYISCLKQALTEFN---TAIQEIVVTHWHRDHSGGICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGAT----------------------LRVLYTPGHTDDHMALLLEE--ENAIFSGDCI----------GEGTTVFEDLYDYMNSLKELLKIKAD---------IIYPGHGPVIHNAEAKIQQYISHRNIREQQ 224
56 -15.5001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  17  34.....................................................................................GEATSGYLFEHDGFRLLVDCGSGVL-----AQLQKYI-----TPSDIDAVVLSHYHHDHV--------------ADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISF--HPVTCFAMRITAGNDIVVYSADSSYIPEF------IPFTKDADLFICECN-------MYAHQEAAKAGHMNSTEVASIAKDANVKELL........... 226
57 -14.6001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  19  16....................................................................................................LVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK---VKLESGLKVYGGDDRIG--------------------------------ALTHKITHLSTLQVGVKCLATPCHTSGHICYFVGGSEPPAVFTGDTLFVAGCG---------YEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKY 204
58 -13.9002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  15  22.....................................................................................EVGRSCIILEFKGRKIMLDCGI-----PGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDFLMAAEIPNIKPDILITYGTHIHEKREEREARFCNTVHDIVNRGGR-IPVFALGRAQE................... 248
59 -13.9003g1p_A mol:protein length:258 Protein phnP  ali model follow..  13  2...........................................SLTLTLTGTGGAQGVPAWGCECAACARAR--------RSPQYRRQPCSGVVKFNDAITLIDAGL-------------HDLADRWSPGSFQQFLLTHYHMDHVQGLFP------------WGVGDPIPVYGPPDEQGCDDLFKHPGLLDFSHTVEPFVVFD-----------LQGLQVTPLP-HSKLTFGYLLETAHSRVAWLSDTAGLPEKTLKRNHCDLNTVLALNQVIRSPRVILTHISMENALPSGFEVGFDGM........................ 247
60 -13.8003h3e_A mol:protein length:267 uncharacterized protein Tm1679  ali model follow..  14  10.......................................................................HVLCDDSSQNGFESEHGFSVLV-----DSVLFDTGKSDV-------FLKNARKLGIDL--PKDVLISHGHYDHAGGLLYLSGKRVWLRKEALDQKYSGERYAGADWNEVL------------------YYNTGKFVIERITEIGKNMFLLGPANLRGKVPTGDFFVERNGERRKDLFEDEQTLVVRTKEGLVVITGCSHRGIDNILLDIAETFNERIVVGGFHLLKSSDDEIEKIVKAFN............. 219
61 -13.7002ycb_A mol:protein length:636 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  14  59.KRIIIRSDRSVLMDPEKAIRKIHEIVPEEAKITNISFDDVTCEVIIEARKPGLVPISSEIIERIRRQQLGNRIHQKPKYDNDWARLTASCLYLQTPNSRVLLDCGV-NVAGGDDKNSYPYLNVPEFTLDSLDAVIITHAHLDHS-GFLPYLYHYGYDGPVYCTAPTRDLMTLLQLDHIDIAHREDEPLPFNVKHVKKSVKHTITLDYGEVTDIAPDIRLLHNAGHILGSAMAHLGDGQHNMVYTGDFKYEQSRLLEAAESTYGGHEDVQPSRNRAEKELVKTIYSTLRRGGK-IPVFAVGRAQE................... 423
62 -13.7003af5_A mol:protein length:651 Putative uncharacterized protein PH1404  ali model follow..  15  68.KRISVRPDPEVLLPPEEAEKLIFEIVPKEAEITNIAFDPSVGEVLIEAKKPGLVPLQSQTIYSIRQRQVGRNIYRKPEYKSRWIRITGSALLVQTDESFVLVDFGVNVAMLNDPYKAFPHFDAPELREGLLDAIIITHAHLDHCGMLPYLFRYNLFDGPIYTTPPTRDLMVLLQKDFIEIQQSNGQDPLYRPRDIKEVIKHTITLDYGEVRDISPDIRLLHNAGHILGSAIVHLGNGLHNIAITGDFLEPANAKFPRLETLVMESTDIQMPREEAEKRLIEVIHNTIKRGGK-IPAMAVGRAQE................... 438
63 -13.5002i7x_A mol:protein length:717 Protein CFT2  ali model follow..  14  12.....................................................................................SGTTVGSVVRFDNVTLLIDPG----WNPSKVSYEQCIKYWEKVIPEIDVIILSQPTIECLGALYYNFTSHFISRIQVYATLPVINL-IDSYASAGVIGPYDTNKLDLEDIEISFDHIVPLK-YSQLVDLRSGLTLLANAGVCPGGSIWCISTYSEKLVYAKRWNHTRDNILNAASITTLDRFGSSQPFKKRSKIFKDTLKKGLSSDGS-IPVDMSGKFLD................... 256
64 -13.4002dkf_A mol:protein length:431 metallo-beta-lactamase superfamily protein  ali model follow..  21  11.....................................................................................EVTGSAHLLLAGGRRVLLDCGM------QGKEEARNHAPFGFDPKEVDAVLLTHAHLDHVGRLLFREG-----RGPVYATRATVLL-EDALKVMDEPFFGPEDVEEALGHLRPLEYGEWLR--------LGALSLFGQAGHLPGSAFVVAQGEGRTLVYSGDLGNREKDVLPDPSLPPLADAEGTYGDRPHRPYRETVREEKTLSQGGKVLIPTFAVERAQEILY.............. 233
65 -12.9001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  22  14..........................................................................................AYILHDTGTVGVVDPS-------EAEPIIDSLKRSGR---NLTYILNTHHHYDHTGGNLELKDR----GAKVIGSAMDKD--------------------RIPGIDMALKDGDKWMFAGHEVHV------MDTPGHTKGHISLYFPGSR--AIFTGDTMFSLSCG---------FEGTPKQMLASLQKI--TSLPDDTSIYCGH.............................. 169
66 -12.9002xr1_A mol:protein length:640 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  16  63.TRIAMRPDPRVLATPEDSISIIEEVVPKESVISSYYFDPDSGEVIIEAEKPGLVPIKSRTVKNIREKTVGRKIHRECTSKDQWVRVTASCFLLSTPESRILIDCGVNV--GSDENMTPYLYVPEVFPLNQIDAVIVTHAHLDHQGLVLFKYG-----EGPVYCTPPTRDL-QLDYIDVAAKEGKKIPY--ESGMVAKTLKHTIPLDYEEVTDIAPDIKLFHNAGHILGSAIFHIGDGLHNVVFTGDYKYEKTRLFDPAEATYGNANAFQPALKDAEKHLQMVVKNTIERGGI-IPAFAVGRSQE................... 426
67 -12.8002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  18  36..........................................................................................SYLIHTTHTLAAVDVNADY--KPILTYIEEHLKQQGNADVTFSTILSTHKHWDHSGGNAK-----------------------------------------LKAELEAMNSTVPVVVVGGANDSIPAVTVIDAPCHTRGHVLYKVQHNDGVALFTGDTMFIAGI----------FEGDEKDMCRAMEKVYHIALDKVTFIFPGH.............................. 220
68 -12.5004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  19  36.................................................................................................DSVLDYDPKSGRTCSASADRLVERVNELNA---SVRWVLETHVHADHL-------------SAAAYLKEKLGGHTAIGAHITQVQKVFGALFNAEPGFARDGSQFDVL--LEDEEGFRIGARALHTPGHTPACMSFMIEDAGEIAVFVGDTLFMPDYGTARCDFP-----DARTLYRSIRRLLAFPDQTRLFMCHDYLP............................ 216
69 -12.1003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  15  32.........................................................................................GSLMLTYDNHSIQVDPVSEY--------------ADYTTFPKADIILITHEHGDHLD---PKAIQAVEKSDTEIIANENSQKKLGKGKVLKNGDTDTSISYMKIEAVPAYNTTPGRDKY-----------------HPRHRNGYILTFDGLRVYIAGDTEDIPEMKLKDIDIAFPYTMTVSQAAKAARMFSPKI------LYPYHY............................. 204
70 -11.7001ww1_A mol:protein length:280 tRNase Z  ali model follow..  15  5...................................................................................GFSKALFSTWIYYSPERILFDAGEGV-------------TTLGSKVYAFKYVFLTHGHVDHIAGLWGVVNIRNNPEGFIKRANPDLRFSFNVHPLKEGERVFLRNAGGFKRYVQPFRTKHVSSEVSFGYHIFEGLDSKEISRKEKGRDFVTEEYHKKVLTISGDSLALDPEEIRGTELLIH--LDARDRRYKNHAAIDEVMEGVKKVILYHIS............................ 246
71 -11.7002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  12  17.....................................................................................TIGGTVIEVAYKDAHIFFDFGTERPELDLPDDHIETLINNRLVPEQHTAVFLSHAHLDHSRMI-----------------DPAVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGVEIVPVDHDAYGASALLIRTPDHFITYTGD-----------------LRLHGHNREETLAFCEKAKHTELLMMEGVSISFP.......................... 223
72 -11.7003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  21  14......................................................................................LAHASYLVQETGEACVIDP-----------DVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRA---GAAICVSDEGPPEWKSE-----------------------YVKAYPHRLLKDGDELHFGIVVMHTPGHTPEHVSYLLYDGKTS-LFSGDFVFVGDV--GRPDLLERVAGESGSSEALARQMFRSLRK--EALPDHVQVLPAHGAGSACGKALGAVPSS........ 215
73 -11.6004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  21  16.....................................................................................VSCTFTYLLRESREAVLIDP-------ETAPRDAQLIKELGLR---LLYAVNTHCHADHITG----------------------------------SGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGLETRASPGHTPGCVTFVL--NDHSMAFTGDALLIRGCG--------RTDFQQGCAKTLYHSVHEKIFTGDCLIYPAH.............................. 179
74 -11.5002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  18  2.......................................................................KLLFRQLFENESSTFTYLLADVSHPDKPALLIDP-------KTVDRDLKLIDELGLK---LIYAMNTHVHADHVTG----------------------------------TGLLKTKLPGVKSVISKASGSKADLFLEPGDKVSIGLEVRATPGHTAGCVTYVTGEGADRMAFTGDAVLIRGCG--------RTDFQEGSSDQLYESVHSQIFTKDTLIYPAH.............................. 183
75 -11.3001y44_A mol:protein length:320 Ribonuclease Z  ali model follow..  16  2....................................................................ELLFLGTGAGIPAKARNVTSVALKLLEERRSVWLFDCGEAT---------QHQMLHTTIKPRKIEKIFITHMHGDHVYGLYGPKGIKAFIETSLAVTKTHLTYPLAIQEIEEGIVFEDDQFIVTAVSVIHGVEAFGYRVQEKDVPGSLKADVLKEMNIPPGPVYQKIKKGETVTLEDGRIINGNDFLEPPKKVVFSGDTRVSDKLKELARDCDVMVHEATFAKEYHSTTEQAAVTAKEARAKQLILTHISA..... 272

FFAS is supported by the NIH grant R01-GM087218-01
1 0 9 9 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.