current user: public

anford Burnham Prebys Medical Discovery Institute
Please be advised that due to the planned maintenance our websites might be temporarily unavailable on December 17-18, 2018. We apologise for the inconvenience that this may cause.

Query: 4p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
# Score Template Links and tools%idFirst MKRRFTLLGSVVALALSSTALASDAPASRGCADDAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAALast
1 -115.0004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model  100  1MKRRFTLLGSVVALALSSTALASDAPASRGCADDAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAA 295
2 -112.0004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  98  1MKRRFTLLGSVVALALSSTALASDAPASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAT 295
3 -99.7005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  44  1...........................TPGCEVCATWNADQAPFRLFGNTYYVGMKGLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGEVGPDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGFKFSASSEYPNALADLRHSFETLEKLPCDVLISAHPEASQLWQRLETGGSDAFVDPQACRAYVAAARTLLDSRLDQEKQ. 270
4 -97.6003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  45  1................................QDRDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSD---HPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQKEGNSAYVDNGACRAIAAAGRKRLETRLASEKR. 262
5 -96.5001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  24  1.................................AYPMPNPFPPFRIAGNLYYVGTDDLASYLIVTPRGNILINSDLEANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYANDSSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVN--PGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVKGQNNPFVDPTGCKNYIEQKANDFYTELKKQETG 263
6 -95.0003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  28  1MRRLTAALCALTLLSTGAQAQTIKDFLA---VAMKKWTAPFEPFQLIDNIYYVGTDGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKN--EDLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRLV---GQPTYAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGMQAKRADGAPNPFIKPGELVTYATSLSEDFDKQLAKQTAA 290
7 -94.3005aeb_A mol:protein length:272 LRA-12  ali model follow..  23  1....................HMASQKVKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSS-DYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKK--FSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN... 272
8 -90.7001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  36  1....................AEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARG--GSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSA---PGYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGA---RAGAKALTCKAYADAAEQKFDGQLAKETAG 267
9 -48.6002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  15  21..........................................PGQLDDDLCLLGDVQVPVFLLRLGESWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLNVQVLASERTCQAWKSESAVRVVERLNRQLL-WDALPVRAVADGEWLELGPRRLQVIEAHGHSDDHVVFY-----DVRRRRLFCGDALGEFDEAEGVWRPLVFDD--MEAYLESLERLQRLPTLQLIPGHGGLLRGRLAADLRLCRRLLWRQSMGESLDELSEELHRAWGGQSVD 289
10 -47.4003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  13  5................................................GLHSIPAEIATVYVMCGEKLTVMIDAGVSNSIADFSF--------LDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVD-------DFLFTGDSAGAYFNGV--VIPTTPPVIDYKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKINVDIGGVAGEILRKQIEVNLRGLRESKKS. 260
11 -44.5001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  15  29.........................................................STVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFEN---ATFYVHEVYKTKNYLSFGTIVGRIY--SKVISSWKNVVLLKGEESL---DEKVKVFHTPWHAREHLSFLLDTENAGR--VLITGDITPNRLS-----YYDIIKGYGSVQVKNFLDRVGRI--DLLVFPHDAPLKPEVKK................................... 215
12 -42.8002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  18  3............................................ALLPGLYLLPLKTVNLYLLQGAGEVALVDTALRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEG-LGARVFLHEEEFARGHGALQGIRETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLE-----EEGVLLAGDALLEKVSPNVGLWAYT-RENPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQRA----------EELKAHHQARLEALLALLDGPKTA 268
13 -41.8002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  20  8....................................................LGPLQENAYLVETGEGPVLIDPG--DEPEKLLALFQTTGLI---PLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLP---VRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVG----------RYDLPGADPKALFASLKRLLSLPPETVHPGHGPGTTLGLEART---NPFLTGLEWEA................... 207
14 -38.5003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  19  35.........................................................VYSILIEHAEGRFLIDTGYDEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFP---HAKKICHRSEVPQACNPQPFEHEGTTRANSTFEGIDGDVDLARG---------VKLISTPGHSIGHYSLLVEFPRRKP--ILFTIDAAYT--QKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDELMYSH............................................. 252
15 -38.5002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  14  43.........................................................VSAYLIQCTDATVLYDTGCHPEECNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDEFATAVRYFATGDHSSPYIVKDIEARNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVRLEKQP---GFLLVSDACYTATNYGPPARRAGVLHDTIGYDRTVSHIRQYAESTVLFGH-------------------DREQFASLIKSTDGFYE......... 276
16 -38.4003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  17  39.........................................................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKE-CILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIETEQSGS--VLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGH............................................. 239
17 -38.3002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  17  37.........................................................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKE-CILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIKTEQSGS--VLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGH............................................. 237
18 -37.1002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  18  23........................................................DFNGFAWIRPEGNILIDP--VALSNHDWKHLESLG----GVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENF-------------------PIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLE------ETTLITGDLVRAYRAGGLEILPDEKLMNK-QKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKE............................... 195
19 -36.5004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  24  68.........................................................AEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPG---AALLVSHDFCLPGGRYLPHG-------------------LGEGQPLRLGP-GLEVWATPGHGGQRDVSVV-VAGTALGTVVVAGDVFERDGDEDSW----QALSEDPAAQERSRKRVLVV-ADVVVPGHGPPFRVLREASQPETEG............................ 248
20 -35.7004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  14  1MLKVILVYMTASVMAVASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEAE-----------GNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVP-----SANVLYGGCAVLELSSTSAGNVAD----ADLAEWPTSVERIQKHEAEVVIPGHGLPGG-------------------LDLLQHTANVVKAHKNRSVA. 265
21 -35.1002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  16  1MFQIFLVGISAFVMAVLGSAAYSAQPGGEYPTVDDIPVGEVRLYKIGDGVWSHTVYSSNGLIVRDADELLLIDTAWAKNTVALLAEIEKQ--IGLPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAEAA-----------GNEVPAHSLKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVP-----AVRVLFGGCAVHEASRESAGNVAD----ANLAEWPATIKRIQQREAEVVIPGHGLPGG-------------------LELLQHTTNVVKTHKVRPVA. 264
22 -34.9002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  13  1MFKLLLVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEVE-----------GNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVP-----SASVLYGGCAIYELSRTSAGNVAD----ADLAEWPTSIERIQQHEAQFVIPGHGLPGG-------------------LDLLKHTTNVVKAHTNRSVV. 265
23 -34.5005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  15  1...............GPSPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWAKNTAALLAEIEKQ--IGLPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEAE-----------GNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVP-----SANVLYGGCAVLALSRTSAGNVAD----ADLAEWPTSVERIQKHEAEVVIPGHGLPGGLDL-------------QHTANVVTAHKNRSVAE....... 248
24 -34.1003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  14  3.....................................EKNLTLTHFKGPLYIVEYVQENSMVYIGTDGITIIGATTPETAETLYKEIRKVSPLP--INEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLDTVFPGDFNLQNGSIRAMYLEAHTKDGIFVYFPAER------VLYGNCILKENLGNMSFANRTEYPKTLEKL-KGLIEQGELKVDSIIAGHDTPIHDVGLID.................................. 222
25 -33.9004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  15  7MHPVAKLALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 255
26 -33.8005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  16  1MKNVLVFLILLVALPALAQG-----------------HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPWEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGKPVPTHYF----------------KDDEFTLGNGLIELYYPAGHTEDNIVAWLP-----KSKILFGGCLVRSHEREGLGYVGD----ASISSWADSIKNIVSYPIQMVVPGHGKVGSSDI-------------DHTIDLAESASNKLMQPTAEASA. 249
27 -33.3004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  13  4.....................................VPELRIEKVKENIFLHGLVSSNGLVVIDKGNAFIVDTPWDRDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIKWLNDQ-SISTYATTSTNHLLKENKKEPA----------------KYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLP-----KSKILFGGCFVRSLDSEGLGYTGE----AHIDQWSRSAQNALSREAQIVIPGHGKIGDIAL-------------KHTKSLAETASNKSIQPNANASA. 232
28 -33.0004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  12  2............................PKSSDHVDLPYNLTATKIDSDVFVVDFYSSNVLVAKMLDGVVIVSSPFENLTQTLMDWVAKT--MKPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRLEENKKDRIKAAELSSHPVPADNVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKK------LLFGGCMIKPKELGY------LGDANVKAWPDSARRLKKFDAKIVIPGHGEWGG........................................ 230
29 -32.7003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  16  2...................PGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDSRAA-------------THTARMADKLRKLVPRGSAAAAL. 256
30 -32.6002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  14  8.....................................TGTISISQLNKNVWVHEAVPSNGLVLNTSKGLVLVDSSWDKLTKELIEMVEKK--FQKRVTDVIITHAHADHIGGIKTLKER-GIKAHSTALTAELAKKNGYEEPL---------------GDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLP-----QYNILVGGSLVKSTSAKDLGNVAD----AYVNEWSTSIENVLKRNINAVVPGHGEVGD........................................ 210
31 -32.5002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  21  7.......................................PVTAFS----------QNCSLIWCEQTRLAALVDPG--GDAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMF--GLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSD-----------PRGDHTQLIDAIRKLLPLGDDVFIPGHGPLSTLGYERLH---NPFLQD........................ 210
32 -32.5005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  15  20......................................AAGDTFEVAPGVRWLSLDHINLWLLRDQAGWTIVDCGISEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCERWNVRLWMTLGEYMFGCLMAAGNGSNAGGAAAA-AVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALH-----SEADGVLISGDMVLPRISTNVSVFDLEPEANPLALYLESLGRYETMAPDLVLPSHGKPF-----------------RGVRTRIAQLRAHHDARLEEVRVA 299
33 -32.5003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  14  3.....................................KDFVIEPPIKNNLHIYKEYSANSMYLVTKKGVVLFDVPEKVQYQSLMDTIKKR--HNLPVVAVFATHSHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKDGKATST---------------EIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFP-----KYNVLDGGCLVKSNSATDLGYIKE----ANVEQWPKTINKLKAKKATLIIPGHDEWKG........................................ 205
34 -32.4004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  14  5.....................................LPDLKIEKLEEGVYVHGVVSKHGLVVLVNTDAYLIDTPTATDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIEWLNSQ-SIPTYASELTNELLKKDGKVQAKNSF----------------SGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKK------ILFGGCFVKPDGLGN--------DANLEAWPKSAKILMSKKAKLVVSSHS---------------EIGDASLLKRTWEQAVKGLNESKKPSQPS 228
35 -32.3004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  14  4.....................................LPDLKIEKLDEGVYVHGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKKDGKVQATNSF----------------SGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERK------ILFGGGFIKPYGLGN--------DANIEAWPKSAKLLKSKKAKLVVPSHS---------------EVGDASLLKLTLEQAVKGLNESKKPSKPS 227
36 -32.2004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  16  1...................SNAIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGA----ADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 228
37 -32.2002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  13  1........................ASQKVEKTVIKNETGTISISQLNKNVWVHTELGSNGLVLNTSKGLVLVDSSWDKLTKELIEMVEKK--FQKRVTDVIITHAHASRIGGIKTLKER-GIKAHSTALTAELAKKNGYEEPL---------------GDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLP-----QYNILVGGCLVKSTSAKDLGNVAD----AYVNEWSTSIENVLKRNINAVVPGHGEVGD........................................ 216
38 -32.2001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  14  2........................................VKIEKLKDNLYVYTKYAANAVYLVTDKGVVVIDCPWEDKFKSFTDEIYKK--HGKKVIMNIATHSHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKENK---------------PRAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFP-----KEKVLVGGCIIKSADSKDLGYIGE----AYVNDWTQSVHNIQQKGAQYVVAGHDDWKD-------------------QRSIQHTLDLINEYQQKQKAS 222
39 -32.0003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  14  8.....................................TGTISISQLNKNVWVHTELG-SGLVLNTSKGLVLVDSSWDKLTKELIEMVEKK--FQKRVTDAIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKNGYEEPL---------------GDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLP-----QYNILVGGCLVKSTSAKDLGNVAD----AYVNEWSTSIENVSKRNINAVVPSHGEVGD........................................ 210
40 -31.9003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  16  1.........................SNANYMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 222
41 -31.8004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  16  1................GSHMGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 231
42 -31.8005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  17  19.....................................FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 228
43 -31.8002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  14  4.....................................HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPWEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGKPVPTHYF----------------KDDEFTLGNGLIELYYPAGHTEDNIVAWLP-----KSKILFGGCLVRSHEWEALGYVGD----ASISSWADSIKNIVSKPIQMVVPGHGKVGSSDI-------------DHTIDLAESASNKLMQPTAEASA. 232
44 -31.6004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  17  20.............................................LGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGE----------QQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLE-----EENAIFSGDCILGEGTTVF---------EDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAK-----------QQYISHRNIREQQILTLFRENFEK 235
45 -31.6001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  17  8.....................................SDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPIDAQTETLVNWVADS--LHAKVTTFIPNHWHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEKGL---------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLP-----TENILFGGCMLKDNQATSIGNISD----ADVTAWPKTLDKVKAKSARYVVPGHGDYGG........................................ 211
46 -31.6001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  17  8.....................................SDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPIDAQTEMLVNWVTDS--LHAKVTTFIPNHWHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKGL---------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLP-----TENILFGGCMLKDNQTTSIGNISD----ADVTAWPKTLDKVKAKSARYVVPGHGNYGG........................................ 211
47 -31.5004tyf_A mol:protein length:231 NDM-4  ali model follow..  17  7.....................................FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGLVAAQHSL-------TFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGID-----GTDIAFGGCLIKDSKAKSLGNLGD----ADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 216
48 -31.4001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  19  1......................................AGMSLTQVSGPVYVVYYVQENSMVYFGAKGVTVVGATTPDTARELHKLIKRVSRKP--VLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPLNVVHDGDFTLQEGKVRA-FYAGPAHTPDGIFVYFPDEQ------VLYGGCILKEKLGNLSFAD-------VKAYPQTLERLKALPIKTVIGGHDSPLHGPELID.................................. 215
49 -30.8001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  18  14...........................................................AYILHDEDTVGVVD---PSEAEPIIDSLKRSGRN---LTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPG--------------------IDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFP-----GSRAIFTGDTMFSLS---------KLFEGTPKQMLASLQKITSLPDDTSICGHEYTLSNSKSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKAC 217
50 -30.8003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  12  48.........................................................THPILIQTAQYNLIIDAGIGNEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHANAIHVVQQDEWHEFIAPNIRSKSTYWDKNKG-DYSNKLILFEKHFEPVPG---IKMQHSGGHSFGHTIITI---ESQGDKAVHMGDIFPTTAHKNPLWVAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGE............................... 265
51 -30.4002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  15  1...........................................MKLLFRQLFENESSTFTYLLADDKPALLIDPVD-KTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKA----------------------SGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTEGADQPQPRMAFTGDAVLIRGCGRTDFQE-----SSDQLYESVHSQIFTLPKDTLIPAHGFEVSTVGEEMQHNPRLTKDKETFKTIMSNLNLSYPKMIDVAVPA 231
52 -30.3004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  16  1.............................................MIFRQLFDSESSTYTYLIGDEATAVLIDPVL-EQVDRDLQMVAELDLT---LTHVFDTHVHADHITASGALRERTQATVVGSVNGASCA-----------------------NVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLGD-------RVFTGDALLVRGNGRTDFQN-----NASQLYDSLTRVLFTLPDETLVPGHDYKGRTVTSIAEEKRNPRVAGKSREEFIHIMEN............ 204
53 -29.9001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  19  3........................................VEVLPALTDNY--------MYLVIDDETAAIVD---PVQPQKVVDAARKHGVK---LTTVLTTHHHWDHAGGNEKLVKLEGLKVYGGDDRIGAL-----------------------THKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAG---------KFYEGTADEMCKALEVLGRLPPDTRVCGH-TINNLKFARHVEPGNAAIREAWAKEKYSIGEPTVPSTLAEEFT. 220
54 -29.9004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  20  58.........................................................INAFLVNIGKSLILIDSGAASHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISKDGVANNATVYVSNDEASFWLDPKQAAKLPKEKQAAPYQAKQRFKTYKLGDDIQ----GFKVINTAGHTPGHFSYEL---KTKGESIVFIGDIVHSHTVQFDRPETAIEYDIDPKKAVETRLKQFANFAKTIAAPH............................................. 265
55 -29.7004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  15  1......................................GPVDAPILLRQMFEPVSCTFT-YLLGDRESAVLIDPVL-ETAPRDAQLIKELGLR---LLYAVNTHCHADHITGSGLLRSLLPGCQSVISR----------------------LSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVL-----NDHSMAFTGDALLIRGCGRTDFQQ-----CAKTLYHSVHEKIFTLPGDCLIPAHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPA 227
56 -28.9004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  20  59.........................................................INILLVKTKEKLILMDTGMGIRTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLNASIFISKIEHDFWINASIKDFNNSALKAHP-AIQPKLKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTI---SSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADRAFTSH............................................. 269
57 -28.8004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  18  1MRLFSLSTALSSAMIALVSLPLQAAAPAQQKTQVPGYYRDFEVTALYDGYVDLPASAVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPEGMQGAPYAKMNKLKPYKTEGELLPG---VSLVASPGHTPGHTSYLF---KSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATWVAGAHLPFPGLGHVRKEAQGYAWV.......................... 313
58 -28.7004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  18  1MRLFSLSTALSSAMIALVSLPLQAAAPAQQKTQVPGYYRDFEVTALYDGYVDLPASAVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPEGMQGAPYAKMNKLKPYKTEGELLPG---VSLVASSGHTPGHTSYLF---KSGGQSLLVWGDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAATWVAGAHLPFPGLGHVREEAQGYAWV.......................... 313
59 -27.2001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  20  97.........................................................VTGYLVNTGSKLVLVDTGAAGTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMVGEQLANAVVRADQKEADFWLSQTNLDKAPDMASLNPYVKAGKFKPFSGNTDLVPG---IKALASHGHTPGHTTYVV---ESQGQKLALLGDLILVAAVQFDDPSVTTQLDSDSKSVAVERKKAFADAAKLIAASH............................................. 302
60 -26.3002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  14  25........................................VTVVPTLKDNF--------SYLINDHTTLAAVDV--NADYKPILTYIEEHLKQQGTFSTILSTHKHWDHSGGNAKLKAELEAVVVGGAND----------------------SIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHNDGVALFTGDTMFIAGGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIPGH-TSGFMTFSEKTFPDRASDDLAFIQAQRAKYAASVPSSLAEEKRQ 273
61 -25.7002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  13  8........................................VQDQEMIPGVYWVGISSYNSYFID-DECPTVIDSVKYPFAEEWLSRIAAC-CPLDKIKYVVMNHAEGDHASSLKDHYHKFNATFVCTKKCQEHLKILYGMEK-------------ATWLIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCP-----EDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEALEVASTVEIKYILSAHGAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARST... 284
62 -25.6002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  17  3........................................AAAKRISDGVYWTGVTTYNAYLVCGDEGVALIDNSYPGTFDELMARVEDAQVGMERVDYIIQNHVEKDHSGVLVELHRRFEAPIYCTEVAVKGLLKHYPSLREAEF------------MTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLD-----EDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKKFDEVKELRIQMIAPSHGQIWTDPMKTGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSE... 284
63 -25.2001vme_A mol:protein length:410 Flavoprotein  ali model follow..  11  12........................................TERIFDDPEIYVLRIDSYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKI-VDPKEITHIIVNHTEPDHSGSLPATLKTIDVEIIASNFGKRLLEG---------------FYGIKDVTVVKDGEEREIGGKKFKFVMTP-HWPDTMVTYLD-------GILFSCDVGGGYLLPEILDDSNESVVEYKNYILEGAEKLSSLKIKALLPGHGNHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKEK... 287
64 -25.1003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  13  14.............................................LAHASYLVGCQ--------ETGEACVIDP-----ARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEWKSEYVKAYPH--------------RLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKTSPDMALFSGDFVFVGDVGRPDLLERVASEALARQMFRSLRKFEALPDHVQVPAHGAGSACGKALGAVPSSTVGYEKLVNWALQHKEDAFVQALLAGQPE 245
65 -24.5004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  15  10..................................................FFDPATCTISYLLFDSGSCALIDSVLDASADQLIARVAALGAR---VRWLLETHVHADHLSAAPYLKTRVGGEIAIGR---HVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVHAAHDARDAAAFVGDTLFMPDYGTARCD----PGGDARSLYRSIRKVLSLPPATRLMCHDYQPNGRAIQDELRENVHIREGVTEDDFVAMRTARDATLDMPV.. 265
66 -24.3004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  11  9........................................VQVLPIATNTKVLRATTSNSYVIE-GDKTAIIDPPVESFMKIYLEALQQT-VNLKKLDYVILGHFSPNRIPTFKALLELAQITFVCSLPAAGDLRAAFPDDN--------------NILPMRGKETLDLGKGVLKFLPIP-RWPAGLCTY-----DVQTQILYTDKIFGAHICGDDVFDDNWEMAPHAIHVEAALEKISDLQVRLYAVGHG............................................ 232
67 -24.1004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  17  12..................................................FYDEATSTISYLVMDRETCALIDSVLDASADRLVERVNELNAS---VRWVLETHVHADHLSAAAYLKEKLGGHTAIGA---HITQVQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMI---EDAGEIAVFVGDTLFMPDYGTARCD----PGADARTLYRSIRRLLAFPDQTRLMCHDYLPGGRDMQEQRASNIHIHQGIDEDSFVAMREARDKTLEMPV.. 261
68 -23.9001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  15  1........................................MQATKIIDGFHLVGATTYNAYLVE-DEKTTLFDTVKAEYKGELLCGIASV-IDPKKIDYLVIQHLELDHAGALPALIEACPEKIFTSSLGQKAMESHFHYKD--------------PVQVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFA-----DEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIAGVAPEFICPDHGVIFRGADQEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDE... 280
69 -23.8003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  13  29.............................................LSQASYLIGCQ--------KTGEAMIIDP-----IRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLGYKNMPNHT---------------HFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGAQMGLFSGDFIFVGDIGRPDLLEKAVSEIGAKQMFKSIESIKDLPDYIQIPGHGAGSPCGKSLGAIPTSTLGYEKQTNWAFSENEATFIDKLISDQPA 259
70 -23.3001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  16  2.........................................QPVAITDGIYWVGATTYNAYLIV-DDKTALVDTVYEPFKEELIAKLKQI-KDPVKLDYLVVNHTESDHAGAFPAIMELCDAHVLCTQRAFDSLKAHYSHID--------------NYTIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVP-----EEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANIINLAIKTIAPSHGIIWRKD-AEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAG... 279
71 -23.2002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  19  10........................................LNSIPAFQDNY--------IWVLTNDEGCVIVD---PGEAAPVLKAIAEHKWM---PEAIFLT----DHVGGVKELLQHFQMTVYGPAET----------------------QDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSRP-------YLFCGDTLFSGG---------RLFEGTPSQMYQSLMKINSLPDDTLICAHETLANIKFALSILPHDSFINERKVKELRVKKQMTLPVILKNERKI 216
72 -21.4002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  13  5......................................GSVEVQVLIENVNFVAEHGLSLL-LKKGNKEIVVDTG---QSENFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLLERNPVKIYTHKE-ITNTDITYDNEFTTKNFFVEKEGKRIPDKFLDEVFVVVKEEDGINVVTGCSHA-GILNILETARN-GVSYIKSLIGGFHLRGMEE-------------EKVKDIARKIEEYGVKKVLTGHCTGIDEYGFLKSVLKDKI........................... 267
73 -20.9004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  16  2..........................................SIVVKNNIHWVGQSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNE-IDLADIDYIVINHAEEDHAGALTELMAQIDTPIYCTANAIDSINGPEWN------------------NVVKTGDTLDIGNGQLIFVETP-HWPDSMMTYLT-----GDAVLFSNDAFGQHYCDEHLFNDEVDQTELFEQCQRYYANIFNLPVDMIATSHGVVWR---AADYQEDRITIFYDTMSNNTRMMADAIAQGIAET... 275
74 -20.6002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  13  3.....................................SKAKTTVTFHSGILTIGG---TVIEVAYKDAHIFFDFGTEFRPELLVPELKDL--KDYQHTAVFLSHAHLDHSRMINYLDP--AVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDAYGASALLIRTPDH----FITYTGDL-------------RLHGHNREETLAFCEKAK--HTELLMMEGVSISFPEREPDPAQIAVVSEEDLVQHLVRLELENPNRQI...... 256
75 -18.4002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  14  13................................................LIRPLGAGQ-SCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSGRTFMTHATKAIYR-SNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHA-GHVLGAAMFMIEIAG----VKLLYTGDFSLIIESTYGTHIHEKREEREARFCNTVHDIVNRGGRGLIPVFA............................................ 242

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 3 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13.