current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4tyf_A mol:protein length:231 NDM-4, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst GPGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRLast
1 -108.0004tyf_A mol:protein length:231 NDM-4  ali model  100  1GPGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR 231
2 -105.0003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  99  9..GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR 237
3 -103.0005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  99  15..GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR 243
4 -102.0004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  99  15..GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR 243
5 -102.0004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  99  18..GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR 246
6 -100.0003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  99  16..GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR 244
7 -100.0004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  99  42..GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR 270
8 -94.8001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  28  2QKSVKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKG--------LPVPEHGFTDSLTVSLDGLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQYI 226
9 -94.3001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  29  2QKSVKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKG--------LPVPEHGFTDSLTVSLDGLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQYI 226
10 -92.5003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  24  1....QVKDFVIEPPIKNNLHIYKTFGVFGGKE-YSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKA--------TSTEIIKTGKPYRIGGFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNK.. 218
11 -92.0002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  30  10..IKNETGTISISQLNKNVWVHTELGSFNGEA-VPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNGYE--------EPLGDLQTVTNLKFGNVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK... 228
12 -92.0001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  25  1........DVKIEKLKDNLYVYTTYNTFNGTK-YAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKP--------RAQYTFDNNKSFKVGKFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQ 216
13 -92.0002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  30  4..IKNETGTISISQLNKNVWVHTELGSFNGEA-VPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNGYE--------EPLGDLQTVTNLKFGNVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK... 222
14 -90.8003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  31  2TVIKNETGTISISQLNKNVWVHTELGSFNGEA-VPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYE--------EPLGDLQTVTNLKFGNVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK... 222
15 -90.7005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  35  17TVNEIPVGEVRLYQIADGVWSHIATQSFDG-AVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEG----NEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTAHK 242
16 -90.3004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  30  1...NDEVPELRIEKVKENIFLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRK-NGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKE---------PAKYTLKGNESTLVDIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETAS 220
17 -89.2002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  29  1...SQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKP--------VPTHYFKDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESAS 220
18 -88.4002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  33  36..DDIPVGEVRLYKIGDGVWSHIATQKLGDTV-YSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPAHS----LKALSSSGDVVRFGPVEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVKTHK 259
19 -88.3002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  36  37..SEIPVGEVRLYQIADGVWSHIATQSFDG-AVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEG----NEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHT 260
20 -88.2004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  36  35TVNEIPVGEVRLYQIADGVWSHIATQSFDG-AVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHS----LEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHK 260
21 -87.6004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  32  1..AGARLPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVE-RGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSF---------SGVSYWLVKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG---DANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGL 218
22 -87.2005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  29  17..LAQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKP--------VPTHYFKDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESAS 237
23 -85.6004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  30  1...AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVE-RGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDG--------KVQATNSFSGNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG---DANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGL 217
24 -84.7001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  21  1.......AGMSLTQVSGPVYVV------EDNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWAEIVADLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK----LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPHGPELIDHYEALIKAAP 225
25 -84.5003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  17  2.....SEKNLTLTHFKGPLYIVED------KEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN----LGNMSFANRTEYPKTLEKLKGLIEKVDSIIAGHDTPHDVGLIDHYLTLLEKAP 232
26 -81.2004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  22  1GPKSSDPYNLTATKIDSDVFVVT------DRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRSHPVPADNVFDLKQGKVFSFSNVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLG---DANVKAWPDSARRLKKF--DAKIVIPGHGEWGGPEMVNKTIKVAEKAV 245
27 -33.7002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  18  9...............................GPLQENAYLVETGEGPVLIDPGDE---PEKLLALFQTT-GLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLAARAIPKPPLPVRPLEEGMRL---GFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYD-LPGADPKALFASLKRLLSL-PPETRVHPGHGPGTTLGLEARTNPFLTGLE 204
28 -33.6001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  17  18......LQPMAPLQIADHTWQI---------GTEDLTALLVQTPDGAVLLDGG-MPQMASHLLDNMKARTPRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSDDLHTYPPANADRIVMDGEVITVGGIVFAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGY--PHLIEDYRRSFATVRAL--PCDVLLTPHPGASNWDYAAGARAGAK... 242
29 -33.5002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  12  6..............HRPDLYSWSTFNPARN---IDFNGFAWIRPEGNILIDPV---ALSNHDWKHLESLGG--VVWIVLTN--SDHVRSAKEIADQYTKIAGPVAEKENFPIY------------CDRWLSDGDELVPG-LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVRRLLEKVEAVLVGDGWSVFRDGRDRLKELVATL. 200
30 -33.3002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  16  5..........SSGLVPRGSHMLR-DDDLCLLGDVQVPVFLLRGEASWALVEGGISRD-AELVWADLCRADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAVRVVERLNRLPVRAVADGEWLELGPRHRLQVAHGHSDDHVVFYDVRRRRLFCGDALFDEAEGVWRPLVFDDMEAYLESLERLQRL-PTLLQLIPGHGGLLRGRLAADGAE...... 249
31 -33.2002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  14  1...........MKALLPGLYLLPVPIPYP-------NLYLLQGAGEVALVDTALGTRAARGALELHLAELGQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEGALQGIRETVEKTRERVHPPQNPLPLRDGEALEVAGKRLVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAENPLKDFLRSLDRLADL--GARVAYAGHFGP--EELKAHHQARLEALL 259
32 -32.4003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  16  6......SSPQQPFTIYGNTHYV---------GTGGISAVLLSSPQGHILVDGT-TEKGAQVVAANIRAMKLSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPKSDPQFGSAKVRAVADGELVKLGPLAVAHATPGHTEGGITWTWQSCEVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKL--SCDIAIAAHPEVND............... 220
33 -32.3001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  11  1..AYPMPNPFPPFRIAGNLYYV---------GTDDLASYLIVTPRGNILINSDLEAN-VPMIKASIKKLKFSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKSDFHYFTQSTVDKVLHDGERVELGGTVLAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKPKIAEDYKHSIKVLESM--RCDIFLGSHAGMFD............... 220
34 -32.2003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  15  35......TAPFEPFQLIDNIYYV---------GTDGIAVYVIKTSQGLILMDTA-MPQSTGMIKDNIAKLKVADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYPGDEAFPAVKVDRAVKEGDRVTLGDTTLAHATPGHSPGCTSWEMTVKDVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAM--KIDVLLGPHPEVYG............... 247
35 -31.5004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  17  38......NDPAMPQKVYGNTWYV---------GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALRPEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFPVANIVTLADDGVVSVGPLALAVASPGHTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASG............... 255
36 -31.4004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  17  38......NDPAMPLKVYGNTWYV---------GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALRPEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFPVANIVTLADDGVVSVGPLALAVASPGHTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASG............... 255
37 -31.2005aeb_A mol:protein length:272 LRA-12  ali model follow..  16  18......SKPYRPFRIAGNLYYI---------GTYDLACYLITTKQGNIIVNTGLAAS-ALQIKNNIKALKLTDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSSDYSMFEPIIADRLLHDKDTIQLGDTKLMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKPGIAKDYAYTLQAMKNL--SFDIWVASHASQFS............... 232
38 -31.0005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  13  11......NADQAPFRLFGNTYYV---------GMKGLSSVLVTSPQGHVLIDGG-LPESAPKIIANIGALRIEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVGPDDPQYPVKDMRLARDGGQFNVGPVYLAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGPNALADLRHSFETLEKL--PCDVLISAHPEASQ............... 228
39 -29.7003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  13  20...................................ATVYVMCGEKLTVMIDAGVSNSIADFSFL-------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDGLKLEKKLDQDKVIEVEGNEEFDLGGYRMRLI-PGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIPTPVIDYKMYMESLKRQIELKP--KVVGFAHGGLVSPKIMEEHLKQMLS.. 225
40 -27.9001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  12  29...................................STVVYLEHKDRRIIIDPGNLSS-MDELEEKFSELGISPITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRL-----SYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAP................. 208
41 -27.3004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  16  33GVGDAVRADGSVTLVLPQTRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPWAR-EALLGALAGQGVAPVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGP-------------GLEVWAT-PGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV---ADVVVPGHGPP................. 234
42 -26.6004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  17  8..........RVERLSNRVVRVLG-CNPGPMTLQGTNTYLVGTGPRRILIDTGEIPEYISCLKQALTEF-NTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCILGEGTTVF-----EDLYDYMNSLKELLKI--KADIIYPGHGPV-----IHNAEAKIQQY. 214
43 -26.0005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  13  15..ADTLPAAGDTFEVAPGVRWLRMPLPFS-------NLWLL-GQAGWTIVDCGISSEAIRTHWEQIRHLDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTPAALDKLRSRRSYYSDLVPAVPPRYRLREGDAVKIGART-VVTGYGHSPEHCALHSEADGVLISGDMVLPRISTNVSVFDLEPLALYLESLGRYETM-APDTLVLPSHGKP--AQLRAHHDARLEEVR 297
44 -25.3002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  23...............NSTFVTPQKPTVSSRLIDIPVSAYLIQCTDATVLYDTGCHPESECNLPERLRQLGLSPISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRNWDLPGVNLLNFGTGHASGMLGLAVRLEKFLLVSDACYTATNPARRAGVLHDTIGYDRTVSHIRQYAESRSLVLFGHDREQFASLIKSTDGFYE... 276
45 -25.2002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  11  11.................................FSQNCSLIWCEQLAALVDPGGD---AEKIKQEVDAS-GVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQGLPAQSRECQPLTPDRWLNDGDRVSVGNVTLVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSD-FPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQ... 209
46 -24.1003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  13  1..GRISMTVKKLYFIPAGRCSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEV-VPGVQLLYT-PGHSPGHQSLFIETEQVLLTIDASYKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKIIFFGH-DIEQEKSCRVFPEYI.... 254
47 -23.9002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  12  2DMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVDRIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEV-VPGVQLLYT-PGHSPGHQSLFIKTEQVLLTIDASYKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKIIFFGH-DIEQEKSCRVFPEYI.... 252
48 -23.5001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  19  9.................................LKDNYAYILHDEDVGVVDPS----EAEPIIDSLKRS-GRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAMDKDRIPGIDMALKDG-----------DKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSLSC---GKLFEGTPKQMLASLQKITSL-PDDTSIYCGHEYTLSNSKFALSLE...... 183
49 -23.4004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  11  2..SDSKPRDVQVLPIATNTKVLRAEIEYALERGTTSNS-YVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRAAFPDDNLNI------LPMRGKETLDLGKLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFKEDQRYYFNCLMAPHAIHVEAALEKISDL--QVRLYAVGHGPLVRTSLIALTQAYADWSK 251
50 -23.3001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  15  9.................................LTDNYMYLVIDDEAAIVD----PVQPQKVVDAARKH-GVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGGDDRIGAL----------------THKITHLSTLQVGSLNVKCLAPCHTSGHICYFVSEPPAVFTGDTLFVAGC---GKFYEGTADEMCKALLEVLGRLPPDTRVYCGH---------EYTINNLK... 181
51 -22.7003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  13  2..SDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYEKHQTIPGALGLLGLEPIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLIST-PGHSIGHYSLLVEFPRILFTIDAAYTQKSTLCQAAFHIDPVAGVNSMRKVKKLAEDHGALMYSHDMDNFKTYRTGTQFY..... 267
52 -20.9004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  18  28..........................................ESREAVLIDP----ETAPRDAQLIKEL-GLRLLYAVNTHCHADHITGSGLLRSL--------------LPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRAPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTL-PGDCLIYPAHD................... 180
53 -20.7002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  15  31.................................LKDNFSYLINDHTLAAVDVNAD---YKPILTYIEEHLKQTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVV--------GANDSIPAVTKPVREGDRVQVGDLSVEVIDPCHTRGHVLYKVQHPQALFTGDTMFIAGI---GAFFEGDEKDMCRAMEKVYHIHDKVTFIFPGH---------EYTSGFMT... 228
54 -20.5002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  15  2........KAAAKRISDGVY-WTGVLDWD--QGTTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREAEFMTVKT---GDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDALMDAARKFYANLITPLSKLVLKKFDEVKELLERIQMIAPSHGQI................. 236
55 -20.1003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  27..............VPKPLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGKESHIIADLANLTPKDIDYVLMTHMHFDHAAGLTDQAGHNAIHVVQQDEWHEFIAPNIRS-KSTYWDKNKGDYSNKLILFEKHFEPMQHSGGHSFGHTIITIESDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAY. 270
56 -20.0004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  16  5GYYQYQAGDVQITALLDGTILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASCFGSSVLSNLKASGYQPVDTILLTHLHPDHVCGISYVSNDEASFWLDPKQAAKLPKEKQANYLGTVEKIKQAIYQAKQRFKTYKLGDDIQGAGHTPGHFSYELKTESIVFIGDIVHSHTVPETAIEYDIDPKKAVETRLKQFANFAKNGQTIPGIGHTYSAD............. 278
57 -19.8004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  14  36GYYRMALGDFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPVVQTNLKASGYQPVDTVLLTHLHPDHACGLVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEGELLVASPGHTPGHTSYLFKSQSLLVWGDILLNHAVPEVVFEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV................. 303
58 -19.8001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  10  1.........MQATKIIDGFHDFHGYTLSPMGTTYNA---YLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESHFHYKDWPV------QVVKHGETLSLGKRTVTFYET-HWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLLKAIETLVGAGVAPEFICPDHGVI................. 229
59 -19.7004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  14  36GYYRMALGDFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPVVQTNLKASGYQPVDTVLLTHLHPDHACGLVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTEGELLVASSGHTPGHTSYLFKSQSLLVWGDILINHAVPEVVWEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV................. 303
60 -19.6002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  10  2...SSKPKYVQDQEMIPGVY-VRIFHGYHTDEGSSYNSYFID-DECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKILYGMEKATW------LIVDDKYTLKIGKRTLKFIPV-HWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMKALEVASTV--EIKYILSAHGVSWRGDAMGLAIAEYDR.. 248
61 -19.5004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  18  22..........................................ATRQAVLIDP----EQVDRDLQMVAEL-DLTLTHVFDTHVHADHITASGALRERQATVVGSVNGASCA----------------NVQVRHGDEVRVGQLVFQVL-PGHTDDSISYLLGDR--VFTGDALLVRGNGRTDFQNGNASQLYDSLTRVLFTL-PDETLVYPGHD................... 171
62 -19.3001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  2..........QPVAITDGIYIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKAHYSHIDFNY------TIVKTGTSVSLGKRSLTFIEA-HWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAE 247
63 -18.8002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  17  27...........................................DKPALLIDP----KTVDRDLKLIDEL-GLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKASGSKA--------------DLFLEPGDKVSIGDIYLEVRAPGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTL-PKDTLIYPAHD................... 184
64 -18.7004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  16  5GFKKIKLGELELFILTDGYIILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGFSAITDIFLSHAHPDHIGGVVFISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQIQPKLKFYDLNKTLYQLAPGHTPGLTVTTISSEKLMYVADLIHSDVIPDWGFSGDTDLDIATASRKKFLKQLADTKARAPGLGFT................. 278
65 -18.7001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  17  46GYYRMLLGDFEITALSDGTQSALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAGLFGPRLAANLKAAGYQPVDEIYITHMHPDHVGGLDFWLSQTNLDKAPDDESKGFFKGAMASLNPYVKAGKFKPFSGNTDLVPGIKALASHG--HTPGHTTYVVESQKLALLGDLILVAAVPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIPGIGHI................. 311
66 -18.7004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  12  3............IVVKNNIH-WVGQRDWEKTLRGSSYNSYLIREEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPEWNF----------NVVKTGDTLDIGNLIFVETPMLHWPDSMMTYLTGDAVLFSNDALFEQCQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLKWAA 243
67 -18.0003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  13  15...................................AHASYLVGCQEACVID----PARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAICVSD-------EGPPEWKSEYVKAYPHRLLKDGDELHFGNVRIVVM-PGHTPEHVSYLLYDGKALFSGDFVFVGRVAGESGSSEALARQMFRSLRKFEAL-PDHVQVLPAHGSACGKALGAVPSSTVGYEK 221
68 -17.9003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  15  30...................................SQASYLIGCQKAMIID----PIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIY--------VSGESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVL-PGHTPESISFLLTDEGGLFSGDFIFVGKAVKVEGSSEIGAKQMFKSIESIKDL-PDYIQIWPGHGSPCGKSLGAIPTSTLGYEK 235
69 -17.4001vme_A mol:protein length:410 Flavoprotein  ali model follow..  12  12.........TERIFDDPEIYIRYFEAVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEG---------YGIKDVTVVKDGEEREIGGKKFKFVMT-HWPDTMVTYL--DGILFSCDVGGYLLPEILDDSNESVVERYLEGAEKLSSL--KIKALLPGHGLIWKKDPQRLLNHYVSVAK 254
70 -15.7004nur_A mol:protein length:633 PSdsA  ali model follow..  12  89...........LFEVTDGIYQVRNYD--------LSNMTIVEGKDGITIFDPLISQETAKAALDLYYKHRKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAENTTSAGTVTLIPPTDIIKETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTNTYSLRGAKIRDPLAWSKYLNEALKLWGDDVQVMPVWGNKEVREQLSLQRDMYRYIN 351
71 -15.7002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  10  13............................SGILTIGGTVIEVAYKDAHIFFDFGTETLINNRLVPELKDLYDPRLGYVFLSHAHLDHS-RMINYLDPAVPLYTLKETKMILNSLNRSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDAYGLLIRTPDHFITYTGDLRLHGHNRE-------ETLAFCEKAKHTELLMMEGVSISFPEREPDPAQIAVVSEEDLVQ.. 242
72 -15.6002cfu_A mol:protein length:658 SDSA1  ali model follow..  13  107...........LFEVAEGIYQVRGFD--------LANITFIRGDSGWIVVDTLTTPATARAAYELVSRELERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKENGLARGPLSLLAPTRLIEEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTNLYTLRGAEVRDALGWSKYINQALHRFGRQAEVMPRWGNAEIVEVLEKQRDLYGYLH 369
73 -15.5004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  12  89...........LFKVTDKMYQVRGQD--------ISNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQHRQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISENTLATGDPSIIAPTKTIVEKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENATHTNFYTLRGAKTRDTSKWTEYLNETLDMWGNDAEVLPVWGNKHINDYIGKYRDTIKYIH 351
74 -15.3002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  13  117...........LFEVMPKLYQVRGLD--------PANMTIIEGDSGLVLIDTLTTAETARAALDLYFQHRKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSENTATNATNTLVAPNVLIEERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPANLLTPRGAEVRDAKAWAGYIDASLEKYGDRTDVLPVWGGDKVRTYLADQRDMYAFLN 380
75 -15.2003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  14  29.................................IKHGSLMLTYDNHSIQVDPVSEYADYTTF---------PKADIILITHEHGDHLDAIQAVEKSDTEIIANENSQKKLGKGKVLKNGDTDTSISYMKIEAVPAYNTTPGRDKYHPRHRDNG-YILTFDGLRVYIAGDTEDIPEMKDLKDVNQPYTMTVSQAAKAARMFSP--KILYPYHYGDTKIGELKDALK...... 217

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 5 7 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.