current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4ubq_A mol:protein length:229 Beta-lactamase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst AGARLPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKPSQPSNLast
1 -104.0004ubq_A mol:protein length:229 Beta-lactamase  ali model  100  1AGARLPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKPSQPSN 229
2 -99.9004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  88  1.AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN 228
3 -95.8002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  43  1.SQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEA. 230
4 -95.2004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  47  1.NDEVPELRIEKVKENIFLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQPNANA. 230
5 -94.3005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  43  17LAQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHELGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEA. 247
6 -92.1001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  33  4SVKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKGLPVPEHGFTDLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQYIESTSKP..... 232
7 -92.1001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  33  4SVKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKGLPVPEHGFTDLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSKP..... 232
8 -89.2002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  32  4IKNETGTISISQLNKNVWVHTELGSFNGEA-VPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGDAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK.............. 222
9 -89.0002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  32  10IKNETGTISISQLNKNVWVHTELGSFNGEA-VPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGDAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK.............. 228
10 -88.8003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  33  4IKNETGTISISQLNKNVWVHTELGSFNGEA-VPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEEPLGDLQTTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGDAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK.............. 222
11 -88.6001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  30  1......DVKIEKLKDNLYVYTTYNTFNGTK-YAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKAS..... 222
12 -88.0003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  29  1..QVKDFVIEPPIKNNLHIYKTFGVFGGKE-YSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKATSTEIITGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNK............. 218
13 -87.6004tyf_A mol:protein length:231 NDM-4  ali model follow..  32  3GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR........... 231
14 -87.4003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  32  9GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR........... 237
15 -86.8005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  32  15GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRLE......... 245
16 -86.6003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  31  16GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRKLVPRGSAAAA 255
17 -85.7004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  32  15GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR........... 243
18 -85.0004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  32  18GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR........... 246
19 -84.1004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  32  42GDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRL.......... 271
20 -81.8005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  30  19NEIPVGEVRLYQIADGVWSHIATQSFDGAV-YPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNEIPTHSLSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVA...... 247
21 -80.8002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  30  36DDIPVGEVRLYKIGDGVWSHIATQKLGDTV-YSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPAHSLSGDVVRFGP--VEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGDANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVA...... 264
22 -80.0004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  29  37NEIPVGEVRLYQIADGVWSHIATQSFDGAV-YPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGDADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVA...... 265
23 -79.6004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  32  7HVDLPYNLTATKIDSDVFVVT------DRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKADNVFDLKQKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGDANVKAWPDSARRLKKF--DAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMR....... 249
24 -79.5002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  29  37SEIPVGEVRLYQIADGVWSHIATQSFDGAV-YPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGDAVRFGP--VELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVV...... 265
25 -78.3003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  22  2...SEKNLTLTHFKGPLYIVE------DKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWKSLPDTVFPG-DFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN-LGNMSFANRTEYPKTLEKLKGLILKVDSIIAGHDTIHDVGLIDHYLTLLEKAPK.......... 233
26 -76.1001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  22  1.....AGMSLTQVSGPVYVVE------DNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWLVLPNVVHDG-DFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK-LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPHGPELIDHYEALIKAAPQSS........ 228
27 -35.9002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  22  11...............................LQENAYLVETGEGPVLIDPGDE---PEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLPVRGFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVG-LPGADPKALFASLKRLLSL-PPETRVHPGHGPGTTLGLEARTNPFLTGLEWEA........ 207
28 -34.2001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  13  18....LQPMAPLQIADHTWQI---------GTEDLTALLVQTPDGAVLLDGG-MPQMASHLLDNMKARGRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSDDLHFG-DGEVITVGGIVFTAHFM-AGHTPGSTAWTWTDTRNGKPVRIAYADSLSAPGPHLIEDYRRSFATVRAL--PCDVLLTPHPGASNKAYADAAEQKFDGQLAKETAGAR... 269
29 -33.9002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  14  5........SSGLVPRGSHMLR-DDDLCLLGDVQVPVFLLRGEASWALVEGGISRD-AELVWADLCRWVSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESAVRVVERLDGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALAEGVWRPLVFDDMEAYLESLERLQRL-PTLLQLIPGHGGLRGRLAADGAESAYTECLRLCRRLLWRQS 267
30 -33.7001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  16  1AYPMPNPFPPFRIAGNLYYV---------GTDDLASYLIVTPRGNILINSD-LEANVPMIKASIKKLGSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKSDFHYA-DGERVELGGTVLTAHLT-PGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGKIAEDYKHSIKVLESM--RCDIFLGSHAPFVDPTGCKNYIEQKANDFYTELKKQETG. 263
31 -33.2002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  15  1.........MKALLPGLYLLP----PIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEASWRLFLDHGTPEGALQ-DGEALEVAGKRLRVLW-TPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGENPLKDFLRSLDRLADL--GARVAYAGHFGP--EELKAHHQARLEALLALLDGPKTAWE 270
32 -32.7003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  14  6....SSPQQPFTIYGNTHYV---------GTGGISAVLLSSPQGHILVDGT-TEKGAQVVAANIRAMGSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPKSDPQFDGELVKLGPLAVKAHAT-PGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSPEVVASLRGSFEAVEKL--SCDIAIAAHPEVND.......................... 220
33 -32.4004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  14  38....NDPAMPLKVYGNTWYV---------GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALGEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFDDGVVSVGPLALTAVAS-PGHTPGGTSWTWRSCEMVYADSLTAISDDVF--PGYLAAFRNTLARVAAL--DCDILVTPHPSASGRRYAQGARQRLEKRLAEEAATSPSSG 300
34 -32.4004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  14  38....NDPAMPQKVYGNTWYV---------GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALGEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTDPQFDDGVVSVGPLALTAVAS-PGHTPGGTSWTWRSCEMVYADSLTAISDDVY--PGYLAAFRNTLARVAAL--DCDILVTPHPPLMDTTACRRYAQGARQRLEKRLAEEAAA. 295
35 -32.4003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  15  35....TAPFEPFQLIDNIYYV---------GTDGIAVYVIKTSQGLILMDTA-MPQSTGMIKDNIAKLGADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYPGDEKN-EGDRVTLGDTTLTAHAT-PGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNGIVDDYRATFAKAKAM--KIDVLLGPHPEVYG.......................... 247
36 -32.2003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  14  20.................................ATVYVMCGEKLTVMIDAGVSNSIADFSFL------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDGLKKLNE-GNEEFDLGGYRMRLIYT-PGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIVIDYKMYMESLKRQIEL--KPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGG. 237
37 -31.8005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  17  11....NADQAPFRLFGNTYYV---------GMKGLSSVLVTSPQGHVLIDGG-LPESAPKIIANIGALGEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVGPDDPQYDGGQFNVGPVYLTAHAT-PGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSPNALADLRHSFETLEKL--PCDVLISAHPEASQ.......................... 228
38 -31.6005aeb_A mol:protein length:272 LRA-12  ali model follow..  11  18....SKPYRPFRIAGNLYYI---------GTYDLACYLITTKQGNIIVNTG-LAASALQIKNNIKALGTDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSIADRLLHDKDTIQLGDTKLVMLHH-PGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEGIAKDYAYTLQAMKNL--SFDIWVASHASQFS.......................... 232
39 -31.0002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  14  6............HRPDLYSWSTFNPARN---IDFNGFAWIRPEGNILIDPV---ALSNHDWKHLESLG-GVVWIVLT--NSDHVRSAKEIADQYTKIAGPVAEKENFPIY----CDRWLSDGDELVPG--LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYRAGGLE-MNKQKVVASVRRLAAL-EKVEAVLVGDGWSVFRDGRDRLKELVATL............ 200
40 -30.9004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  19  8........RVERLSNRVVRVLG-CNPGPMTLQGTNTYLVGTGPRRILIDTPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKS-IKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCILGEGTTVFED--LYDYMNSLKELLKI--KADIIYPGHGPVIHEAKIQQYISHRNIREQQILTLFRENF 233
41 -29.7001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  14  9...............................LTDNYMYLVIDDEAAIVD----PVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGGDDRIGALTHK-------ITHLSTLQVGSLNVKCLAT-PCHTSGHICYFVSKPGAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHNNLKFARHVEPGNAAIREKLAWAKEKYSIG. 207
42 -29.7001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  15  9...............................LKDNYAYILHDEDVGVVDPS----EAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAMDKDRIPGIDMALK----DGDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSL-PDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAE.. 198
43 -28.5002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  15  11...............................FSQNCSLIWCEQLAALVDPGGD---AEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQQPLTPDRWLNDGDRVSVGNVTLQVLHC-PGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD............. 210
44 -26.7001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  15  29.................................STVVYLEHKDRRIIIDPG-NLSSMDELEEKFSELGDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRL--SYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHD.............................. 206
45 -26.3004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  16  40.....ADGSVTLVLPQTRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPWAR-EALLGALAGQGGDVTLVVGTHGHSDHIGNLGLFPGAALLV-----SHDFCLPGGRYLPHGLGEGQPLRLGPG-LEVWAT-PGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVVADVVVPGHGPP............................ 234
46 -25.5005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  13  15ADTLPAAGDTFEVAPGVRWLR----PLPFSLDHINLWLL-GQAGWTIVDCGISSEAIRTHWEQIFDDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTAAAADHFARHGLTDPAAL-EGDAVKIGARTWRVVT-GYGHSPEHCALHSEADGVLISGDMVLPRISTNVSANPLALYLESLGRYETMAPD-TLVLPSHGKP--AQLRAHHDARLEEVRVACAEKPMSA. 307
47 -25.0002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  12  31...............................LKDNFSYLINDHTLAAVDVNADYKPILTYIEENADVTYTFSTILSTHKHWDHSGGNAKLKAE-LEAMNSTVPVVVVGGANDSIPAVT-EGDRVQVGDLSVEVIDA-PCHTRGHVLYKVQHPQALFTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDGHSEKTFPDRASDDLAFIQAQRAKYAAAVKTGD 260
48 -24.7004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  18  28........................................ESREAVLIDP----ETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSL-----LPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRAS-PGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDQGCAKTLYHSVHEKIFTLPGDCLIYPAHD.............................. 180
49 -23.6003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  16  1GRISMTVKKLYFIPAGRCSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVDRIVNILKRVGDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVLLYTPGHSPGHQSLFIETEQVLLTIDASYTKE-----GFDPELALSSIKRLKEVVKKEKIIFFGHDI............................. 241
50 -23.2002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  14  23.............NSTFVTPQKPTVSSRLIDIPVSAYLIQCTDATVLYDTGCHPESECNLPERLRQLGDDISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATEAWLATPRNWDLVGRDERERELAP--VNLLNFGTGHASGMLGLAVRLEKFLLVSDACYPPARRAGVLHDTIGYDRTVSHIRQYAESRSLVLFGHDREQFASLIKSTDGFYE.............. 276
51 -23.1004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  18  22........................................ATRQAVLIDP--VLEQVDRDLQMVAELDLTLTHVFDTHVHADHITASGALRERTQATVVGS------VNGASCANVQVRHGDEVRVGQLVFQVLAT-PGHTDDSISYLLGDR--VFTGDALLVRGNGRTDNGNASQLYDSLTRVLFTLPDETLVYPGHD.............................. 171
52 -23.1002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  17  35...............................LPVWCYLLETEEGPILVDTGMPESAVDRIVNILKRVGDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVLLYTPGHSPGHQSLFIKTEQVLLTIDASYTKE----AGFDPELALSSIKRLKEVVKKEKIIFFGHDI............................. 239
53 -23.0002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  20  27.........................................DKPALLIDP--VDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTK-----LPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRAT-PGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTDEGSSDQLYESVHSQIFTLPKDTLIYPAHD.............................. 184
54 -22.3004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  11  2SDSKPRDVQVLPIATNTKVLRAEIEYALERGTTSNSYVIEGDK-TAIIDPP-VESFMKIYLEALQQTLKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRADDNLNILPMRGKETLDLGGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFFKEDQRYYFNCLMAPHAIHVEAALEKILQVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLE...... 256
55 -21.8003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  17  2.....SDTKVYLLDGGSLHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYEKHQTIPGALGLLGRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRILFTIDAAYTQK-----HIDPVAGVNSMRKVKKLAEDHGALMYSHDM............................. 254
56 -19.7002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  17  16...............................FQDNYIWVLTNDECVIVD----PGEAAPVLKAIAEHKWMPEAIFLT----DHVGGVKELLQHQMTVYGPAETQDKGATHLVG------DGDTIRVLGEKFTLFAT-PGHTLGHVCYFSRP--YLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSL-PDDTLICCAHANIKFALSILPHDSFINEYYRKVKELRVKK. 202
57 -19.3002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  17  2......KAAAKRISDGVY-WTGVLDWD----TTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREAEFTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFFYANLITPLSKLVLKKFDEVKEL-GLLERIQMIAPSHGQI............................ 236
58 -19.2003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  17  30.................................SQASYLIGCQKAMIIDP---IRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDDTLGYKNMPNHTHFVHNDDIYVGNIKLKVLHT-PGHTPESISFLLTDEGGLFSGDFIFVGDIG-SSEIGAKQMFKSIESIKDL-PDYIQIWPGHGA............................. 215
59 -19.2003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  11  5......DISIHYLNGGLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGEESHIIADLANYNKDIDYVLMTHMHFDHAAGLTDQAGHNAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNK-IKMQHSG-GHSFGHTIITIESDKAVHMGDIFPTTAHKNPLDDYPMQSIREKERMIPYFIQQQYWF--HDENYFAVKYSDDGENIDAY............ 270
60 -19.1003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  20  15.................................AHASYLVGCQEACVIDP---ARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAICVSDEGPPEWKSEYVKPHRLLKDGDELHFGNVRIVVMHT-PGHTPEHVSYLLYDGKALFSGDFVFVGDVG-SSEALARQMFRSLRKFEAL-PDHVQVLPAHGA............................. 201
61 -18.9004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  14  13......DVQITALLDGTILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASSHLGSVLSNLKASGEQVDTILLTHLHPDHVCGIANFPNATVYVSNDEKIKQAIAPYQAKQRFKTYKLGDDIQGFKVINT----AGHTPGHFSYELKTESIVFIGDIVHSHTVQF--DIDPKKAVETRLKQFANFAKNGQTIPGIGHTYSAD........................ 278
62 -18.7001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  15  1.......MQATKIIDGFHDFHGYTLSPMGTTYNA---YLVEDEKTTLFDT-VKAEYKGELLCGIASVPKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESHFHYKDQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVI............................ 229
63 -18.6002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  13  2.SSKPKYVQDQEMIPGVYIFHGYHTDEG---SSYNSYFID-DECPTVIDS-VKYPFAEEWLSRIAACLDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKI------LIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYA-WADECDVSHVMHLFKEYVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSK.......... 251
64 -18.1001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  14  2........QPVAITDGIYIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDT-VYEPFKEELIAKLKQIPVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKAHYSHIDTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKA.... 254
65 -17.8001vme_A mol:protein length:410 Flavoprotein  ali model follow..  19  44...............................ISYNAYLVKLNGANVLIDG-WKGNYAKEFIDALSKIPKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEG-GIKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSGGYLLPEILDDSNESVVERYLPHVTKYKLSSLKIKALLPGHGLI............................ 237
66 -17.8004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  15  44......DFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGEQVDTVLLTHLHPDHACGLVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEPGHTPGHTSYLFKSQSLLVWGDILLNHAVQF--DVDSDQARQSRQRILAEAATDKLWVPGLGHV............................ 303
67 -17.7004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  14  44......DFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGEQVDTVLLTHLHPDHACGLVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTESGHTPGHTSYLFKSQSLLVWGDILINHAVQF--DVDSDQARQSRQRILAEAATDKLWVPGLGHV............................ 303
68 -17.6004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  17  13......ELELFILTDGYIILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGHDITDIFLSHAHPDHIGGVLVFPNASIFISKIENNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNPGHTPGLTVTTISSEKLMYVADLIHSDVILF--DTDLDIATASRKKFLKQLADTKARAPGLGFT............................ 278
69 -17.6004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  10  3..........IVVKNNIH-WVGQRDWE----SSYNSYLIR-EEKNVLIDT-VDHKFSREFVQNLRNELADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPEWNFNVVK-TGDTLDIGNKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFCQRYYANILTPFSRLVTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQEDRI.... 250
70 -16.8001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  13  54......DFEITALSDGTQSALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAGPTLGRLAANLKAAGEQVDEIYITHMHPDHVGGLMRADQKEADFWLSQTNLDKAPDMASLNPYVKAGKFKPFSGNTDLVKALASHGHTPGHTTYVVESQKLALLGDLILVAAVQF--DSDSKSVAVERKKAFADAAKGGYLIPGIGHI............................ 311
71 -16.0004nur_A mol:protein length:633 PSdsA  ali model follow..  11  89.........LFEVTDGIYQVRNYD---------SNMTIVEGKDGITIFDPLISQETAKAALDLYYKHKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAETLIPPTDIIKETTHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTNTYSLRGAKIRDWSKYLNEALKLWGDDVQVMPVWGNKEVREQLSLQRDMYRYINDETLRLANKG. 361
72 -16.0002cfu_A mol:protein length:658 SDSA1  ali model follow..  15  107.........LFEVAEGIYQVRGFD---------ANITFIRGDSGWIVVDTLTTPATARAAYELVSREERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKESLLAPTRLIEGEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTNLYTLRGAEVRDWSKYINQALHRFGRQAEVMPRWGNAEIVEVLEKQRDLYGYLHDQTLHLANQG. 379
73 -15.9004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  15  28........................................ETRQCALIDSRTCSASADRLVERVNELNASVRWVLETHVHADHLSAAAYLKEKGAHITQVQKVFGALARDGSQFDVLLEDEEGFRIGNLQARALHT-PGHTPACMSFMIEDEIAVFVGDTLFMPDYGTFPGADARTLYRSIRRLLAFPDQTRLFM.................................. 210
74 -15.8004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  10  89.........LFKVTDKMYQVRGQD---------SNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQHQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISESIIAPTKTIVRTKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENATHTNFYTLRGAKTRDWTEYLNETLDMWGNDAEVLPVWGNKHINDYIGKYRDTIKYIHDQTLHLANQG. 361
75 -15.5002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  14  117.........LFEVMPKLYQVRGLD---------ANMTIIEGDSGLVLIDTLTTAETARAALDLYFQHKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSETLVAPNVLIEKPRHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPANLLTPRGAEVRDWAGYIDASLEKYGDRTDVLPVWGGDKVRTYLADQRDMYAFLNNRALNLMNKG. 390

FFAS is supported by the NIH grant R01-GM087218-01
1 1 8 0 3 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.