current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4wd6_A mol:protein length:233 Metallo-beta-lactamase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst NDEVPELRIEKVKENIFLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQPNANASADLast
1 -106.0004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model  100  1NDEVPELRIEKVKENIFLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQPNANASAD 233
2 -100.0002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  51  1SQGHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEASAD 233
3 -97.1005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  52  20..GHKPLEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEASAD 250
4 -95.2004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  47  2GARLPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLG---DANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKPSQPS... 228
5 -93.7004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  45  1AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLG---DANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSNW. 229
6 -92.9001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  29  5VKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKGLPPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQYIESTSKP....... 232
7 -92.5001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  30  5VKISDDISITQLSDKVYTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKGLPPEHGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSKP....... 232
8 -91.2001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  32  1.....DVKIEKLKDNLYVYTTYNTFNGTK-YAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKAS....... 222
9 -90.9003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  29  17DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRKLVPRGSAAAALE 257
10 -90.6002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  36  5KNETGTISISQLNKNVWVHTELGSFNGEA-VPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNGYEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK................ 222
11 -90.5002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  36  11KNETGTISISQLNKNVWVHTELGSFNGEA-VPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNGYEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK................ 228
12 -90.3004tyf_A mol:protein length:231 NDM-4  ali model follow..  30  4DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR............. 231
13 -90.2003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  30  10DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR............. 237
14 -90.0003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  30  2..VKDFVIEPPIKNNLHIYKTFGVFGGKE-YSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKASTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNK............... 218
15 -89.4003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  35  5KNETGTISISQLNKNVWVHTELGSFNGEA-VPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNGYEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK................ 222
16 -88.6005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  29  16DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRLE........... 245
17 -87.8004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  30  16DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR............. 243
18 -87.1004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  30  19DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR............. 246
19 -86.1004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  29  43DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVANGWVEPATAPNFGP--LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRL............ 271
20 -84.2005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  32  20EIPVGEVRLYQIADGVWSHIATQSFDGAV-YPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNELEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVA........ 247
21 -82.5002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  32  37DIPVGEVRLYKIGDGVWSHIATQKLGDTV-YSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNELKALSSSGDVVRFGP--VEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVA........ 264
22 -81.8004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  32  38EIPVGEVRLYQIADGVWSHIATQSFDGAV-YPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNELEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVA........ 265
23 -81.1002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  32  38EIPVGEVRLYQIADGVWSHIATQSFDGAV-YPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNELEGLSSSGDAVRFGP--VELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVV........ 265
24 -76.5004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  30  10..LPYNLTATKIDSDVFVVTD------RDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYL---GDANVKAWPDSARRLKKF--DAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMR......... 249
25 -76.0003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  23  1.MSEKNLTLTHFKGPLYIVED------KEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSPDTVFPG--DFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN----LGNMSFANRTEYPKTLEKLKGLIEKVDSIIAGHDTIHDVGLIDHYLTLLEKAPK............ 233
26 -74.5001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  20  1....AGMSLTQVSGPVYVVED------NYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWAEPNVVHDGDFTLQEGK--VRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK----LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSLHGPELIDHYEALIKAAPQSS.......... 228
27 -36.4002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  17  11..............................LQENAYLVETGEGPVLIDPG---DEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLPVRPLE-VLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDL-PGADPKALFASLKRLLSL-PPETRVHPGHGPGTTLGLEARTNPFLTGLEWEA.......... 207
28 -35.2002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  13  5.......SSGLVPRGSHMLR-DDDLCLLGDVQVPVFLLRGEASWALVEGGISRD-AELVWADLCRWVSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDALFDEAEGVWRPLVFDDMEAYLESLERLQR-LPTLLQLIPGHGGLLRADGAESAYTECLRLCRRLLWRQSMGES. 271
29 -34.7001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  13  18...LQPMAPLQIADHTWQI---------GTEDLTALLVQTPDGAVLLDGG-MPQMASHLLDNMKARGRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSNADRIVMDGEVITVGGIVFTAHFM-AGHTPGSTAWTWTDTRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRAL--PCDVLLTPHPGASNWDY-LTCKAYADAAEQKFDGQLAKETAG 267
30 -34.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  13  20................................ATVYVMCGEKLTVMIDAGVSNSIADFSFL------DKLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDQDKVIEVEGNEEFDLGGYRMRLIYT-PGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIPTTVIDYKMYMESLKRQIEL--KPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAG 240
31 -34.0002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  15  1........MKALLPGLYLLP----PIPYPLKTVNLYLLQGAGEVALVDTALGTRAAELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEASWRLFLDHGTPEGALLRDGEALEVAGKRLRVLW-TPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGYTRENPLKDFLRSLDRLADL--GARVAYAGHFGP--EELKAHHQARLEALLALLDGPKTA.... 268
32 -33.8002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  15  6...........HRPDLYSWSTFNPARN---IDFNGFAWIRPEGNILIDPV---ALSNHDWKHLESLG-GVVWIVLT--NSDHVRSAKEIADQYTKIAGPVAEKENFPIY---CDRWLSDGDELVPG---LKVMELQGSKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVLAALEKVEAVLVGDGWSVFRDGRDRLKELVATL.............. 200
33 -33.8003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  15  35...TAPFEPFQLIDNIYYV---------GTDGIAVYVIKTSQGLILMDTA-MPQSTGMIKDNIAKLGADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGYYKVDRAVKEGDRVTLGDTTLTAHAT-PGHSPGCTSWEMTVKDVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAM--KIDVLLGPHPEVYGMQA-GELVTYATSLSEDFDKQLAKQTAA 290
34 -33.4001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  11  5...PNPFPPFRIAGNLYYV---------GTDDLASYLIVTPRGNILINSD-LEANVPMIKASIKKLGSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKTVDKVLHDGERVELGGTVLTAHLT-PGHTRGCTTWTMKLKDAVIIGSIGVNPGYKLVDNITPKIAEDYKHSIKVLESM--RCDIFLGSHAGMFDLKN-TGCKNYIEQKANDFYTELKKQET. 262
35 -33.3004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  13  38...NDPAMPQKVYGNTWYV---------GTCGISALLVTSDAGHILVDAAT-PQAGPQILANIRALGEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASGLWN-TACRRYAQGARQRLEKRLAEEAA. 294
36 -33.3003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  13  6...SSPQQPFTIYGNTHYV---------GTGGISAVLLSSPQGHILVDGT-TEKGAQVVAANIRAMGSDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSAKVRAVADGELVKLGPLAVKAHAT-PGHTEGGITWTWQSCEVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKL--SCDIAIAAHPEVNDMWT-GACRAIAAAGRKRLETRLASEKR. 262
37 -33.0004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  12  38...NDPAMPLKVYGNTWYV---------GTCGISALLVTSDAGHILVDAA-TPQAGPQILANIRALGEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGLPDRTVTLADDGVVSVGPLALTAVAS-PGHTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASGRRYAQGARQRLEKRLAEEAATSPSSGAR 302
38 -32.6005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  10  11...NADQAPFRLFGNTYYV---------GMKGLSSVLVTSPQGHVLIDGG-LPESAPKIIANIGALGEDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVKDMRLARDGGQFNVGPVYLTAHAT-PGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGPNALADLRHSFETLEKL--PCDVLISAHPEASQLWQ-QACRAYVAAARTLLDSRLDQEKQQ 271
39 -32.6004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  17  8.......RVERLSNRVVRVLG-CNPGPMTLQGTNTYLVGTGPRRILIDTPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKS-IKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYT-PGHTDDHMALLLEEENAIFSGDCILGEGTTVF-----EDLYDYMNSLKELLKI--KADIIYPGHGPVNAEAKIQQYISHRNIREQQILTLFRENFEK 235
40 -32.2005aeb_A mol:protein length:272 LRA-12  ali model follow..  18...SKPYRPFRIAGNLYYI---------GTYDLACYLITTKQGNIIVNTG-LAASALQIKNNIKALGTDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADGGSIADRLLHDKDTIQLGDTKLVMLHH-PGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKPGIAKDYAYTLQAMKNL--SFDIWVASHASQFSMHS-KGYDESLDKLQKEYEKHLNE.... 271
41 -30.5002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  16  11..............................FSQNCSLIWCEQLAALVDPGGD---AEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQQPLTPDRWLNDGDRVSVGNVTLQVLHC-PGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDF-PRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD............... 210
42 -29.5001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  15  9..............................LTDNYMYLVETKEAAIVD----PVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLGLKVYGGDDRIGAL-------THKITHLSTLQVGSLNVKCLAT-PCHTSGHICYFVSKPGAVFTGDTLFVAG---CGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHNNLKFARHVEPGNAAIREKLAWAKEKYSIGEP. 209
43 -28.7001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  18  9..............................LKDNYAYILDTGTVGVVDPS----EAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAMDKDRIPG-----DMALKDGDKWMFAGHEVHVMDT-PGHTKGHISLYFPGSRAIFTGDTMFSLS---CGKLFEGTPKQMLASLQKITSL-PDDTSIYCGHSNSKFALSLEPNNEVLQSYAAHVAELRSKKLP. 205
44 -27.8004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  17  40....ADGSVTLVLPQTRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPWAR-EALLGALAGQGGDVTLVVGTHGHSDHIGNLGLFPGAALLV-----SHDFCLPGGRYLPHGLGEGQPLRLGPG-LEVWAT-PGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV---ADVVVPGHGP............................... 233
45 -27.6001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  13  3..SDKIMELKILVTG----GNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSS-MDELEEKFSELGDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHT-PWHAREHLSFLLDTENVLITGDITPNRLSYY-----DIIKGYGSVQVKNFLDRVGRIDLLVFPHD................................ 206
46 -26.5004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  16  28.......................................ESREAVLIDPVL--ETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSL-----LPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRAS-PGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDF-QQGCAKTLYHSVHEKIFTLPGDCLIYPAHD................................ 180
47 -26.2005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  16  16DTLPAAGDTFEVAPGVRWLR----PLPFSLDHINLWLL-GQAGWTIVDCGISSEAIRTHWEQIFDDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTAAAADHFARHGLTDPAALREGDAVKIGARTWRVVT-GYGHSPEHCALHSEADGVLISGDMVLPRISTNVSVFDLEPLALYLESLGRYET-MAPDTLVLPSHGKP--AQLRAHHDARLEEVRVACAEKPMSAAG. 309
48 -25.3004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  17  22.......................................ATRQAVLIDPVL--EQVDRDLQMVAELDLTLTHVFDTHVHADHITASGALRERTQATVVGS------VNGASCANVQVRHGDEVRVGQLVFQVLAT-PGHTDDSISYLLGDR--VFTGDALLVRGNGRTDF-QNGNASQLYDSLTRVLFTLPDETLVYPGHD................................ 171
49 -25.1002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  16  31..............................LKDNFSYLITTHTLAAVDVNADYKPILTYIEENADVTYTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVVGGANDSIPAVTVREGDRVQVGDLSVEVIDA-PCHTRGHVLYKVQHPQALFTGDTMFIAG---IGAFFEGDEKDMCRAMEKVYYALDKVTFIFPGHSEKTFPDRASDDLAFIQAQRAKYAAAVKTGD.. 260
50 -24.7002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  16  26.......................................PDKPALLIDPVD--KTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTK-----LPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRAT-PGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTDF-QEGSSDQLYESVHSQIFTLPKDTLIYPAHDYKGFEVSTVGEEMQHNPRLTKDKETFKTIMSN 216
51 -23.9003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  11  2RISMTVKKLYFIPAGRCSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVDRIVNILKRVGDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVLLYTPGHSPGHQSLFIETEQVLLTIDASYTKENFEDEVPFAGDPELALSSIKRLKEVVKKEKIIFFGHDI............................... 241
52 -23.9002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  12  23............NSTFVTPQKPTVSSRLIDIPVSAYLIQCTDATVLYDTGCHPESECNLPERLRQLGDDISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVWLATPRNWDLVGRDERERELAPG-VNLLNFGTGHASGMLGLAVRLEKFLLVSDACYNYGPPARRAGVLHDTIGYDRTVSHIRQYAESRSLVLFGHDREQFASLIKSTDGFYE................ 276
53 -23.8002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  11  1.MDMTVKKLYFIPAGRCSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVDRIVNILKRVGDDLLYIISSHLHFDHAGGNGAFT--NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVLLYTPGHSPGHQSLFIKTEQVLLTIDASYTKENFEDEVPFAGDPELALSSIKRLKEVVKKEKIIFFGHDI............................... 239
54 -22.6004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  12  3DSKPRDVQVLPIATNTKVLRAEIEYALERGTTSNSYVIEGDKTAIIPVESFMKIYLEALQQTVN--LKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRADDNLNILPMRGKETLDLGGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDNWEMAPHAIHVEAALEKISQVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLE........ 256
55 -22.5003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  12  2....SDTKVYLLDGGSLHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYEKHQTIPGALGLLGRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEEAAEARGATAQLLEGTTRANSTFEGIDGDVDLLISTPGHSIGHYSLLVEFPRILFTIDAAYTQKSTLCQAAFHIDPVAGVNSMRKVKKLAEDHGALMYSHDM............................... 254
56 -21.5003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  1.MKIGDISIHYLNGGLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGEESHIIADLANYNKDIDYVLMTHMHFDHAAGLTDQAGHNAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFMQHSGGHSFGHTIITIESDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAY.............. 270
57 -20.3003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  21  7....RRFYDEGLAHASYLVGCQ-----------------ETGEACVIDPA---RDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAICVSDEGPPEWKSEYVKPHRLLKDGDELHFGNVRIVVMHT-PGHTPEHVSYLLYDGKALFSGDFVFVGRVAGESGSSEALARQMFRSLRKFEAL-PDHVQVLPAHGA............................... 201
58 -20.2002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  12  2SSKPKYVQDQEMIPGVYIFHGYHTDEG---SSYNSYFIDDECPTVIVKYPFAEEWLSRIAACCP--LDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKIMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANI-EIKYILSAHGVSWRGDAMGLAIAEYDRWSK............ 251
59 -20.1004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  14  13.....DVQITALLDGTILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASSHLGSVLSNLKASGEQVDTILLTHLHPDHVCGIANFPNATVYVSNDEKIKQAIAPYQAKQRFKTYKLGDDIQGFKVINT----AGHTPGHFSYELKTESIVFIGDIVHSHTVPETAIEYDIDPKKAVETRLKQFANFAKNGQTIPGIGHTYSAD.......................... 278
60 -20.1003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  17  22....KQFYDKHLSQASYLIGCQ-----------------KTGEAMIIDPI---RDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKANIYVSGESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHT-PGHTPESISFLLTDEGGLFSGDFIFVGDAVKVEGSSEIGAKQMFKSIESIKDL-PDYIQIWPGHGA............................... 215
61 -20.0002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  14  2.....KAAAKRISDGVY-WTGVLDWD----TTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKLREAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDAARKFLGLLERIQMIAPSHGQI.............................. 236
62 -19.3004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  13  44.....DFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGEQVDTVLLTHLHPDHACGLVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAVAPYAKMNKLKPYKTEPGHTPGHTSYLFKSQSLLVWGDILLNHAVPEVVFEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV.............................. 303
63 -19.3004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  13  44.....DFEVTALYDGYLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGEQVDTVLLTHLHPDHACGLVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAVAPYAKMNKLKPYKTESGHTPGHTSYLFKSQSLLVWGDILIQFAKPEVVWEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV.............................. 303
64 -19.1004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  17  13.....ELELFILTDGYIILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGHDITDIFLSHAHPDHIGGVLVFPNASIFISKIEERLNQIIPALQNILKAIQPKLKFYDLNKTLYNFQLAPGHTPGLTVTTISSEKLMYVADLIHSDVIPDWGFSGDTDLDIATASRKKFLKQLADTKARAPGLGFTKVKA.......................... 282
65 -19.1002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  18  16..............................FQDNYIWVLDEGRCVIVD----PGEAAPVLKAIAEHKWMPEAIFLT----DHVGGVKELLQHQMTVYGPAETQ-------KGATHLVGDGDTIRVLGEKFTLFAT-PGHTLGHVCYFSRP--YLFCGDTLFSGG---CGRLFEGTPSQMYQSLMKINSL-PDDTLICCAHANIKFALSILPHDSFINEYYRKVKELRVKKQM. 204
66 -19.0001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  11  1......MQATKIIDGFHSRDFHGYTLSPMGTTYNAYLVEDEKTTLFVKAEYKGELLCGIASVID--PKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESHFHYKDQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLLKAIETLVGAGVAPEFICPDHGVI.............................. 229
67 -18.4001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  12  2.......QPVAITDGIYYFHGPAFSTHRG-TTYNAYLIVDDKTALVVYEPFKEELIAKLKQIKD--PVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKAHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKA...... 254
68 -18.4001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  15  54.....DFEITALSDGTQSALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAGPTLGRLAANLKAAGEQVDEIYITHMHPDHVGGLDFWLSQTNLDKAPDDESKGFFKGAMASLNPYVKAGKFKPFSGNTDLVLASHGHTPGHTTYVVESQKLALLGDLILVAAVPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIPGIGHI.............................. 311
69 -17.9001vme_A mol:protein length:410 Flavoprotein  ali model follow..  14  12......TERIFDDPEIYYFEAVWEIPEG--ISYNAYLVKLNGANVLIDG-WKGNYAKEFIDALSKIPKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEG-GIKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGGGYLLPEILDDSNESIGHYKNYILEGAEKLSKIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPKK........ 259
70 -17.7004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  14  4..........VVKNNIHWVGQRTEYKTLRGSSYNSYLIREEKNVLIVDHKFSREFVQNLRNEID--LADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGP---NFNVVKTGDTLDIGNKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQEDRI...... 250
71 -17.0004nur_A mol:protein length:633 PSdsA  ali model follow..  15  89........LFEVTDGIYQVRNYD---------SNMTIVEGKDGITIFDPLISQETAKAALDLYYKHKKPVVAVIYTHSHVDHYGGVRGVVDEAVKIYAPLGFLEHAVAENVPTDIIKETGETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTLHNTYSLRGA-DPLAWSKYLNEALKLWGDDVQVMPVWGNKEVREQLSLQRDMYRYINDETLRLANKGYT. 363
72 -16.8002cfu_A mol:protein length:658 SDSA1  ali model follow..  14  107........LFEVAEGIYQVRGF----------ANITFIRGDSGWIVVDTLTTPATARAAYELVSREERPIRTVIYSHAHADHFGGVRGLVEPQVQIIAPAGFMEAAIKENVPTRLIEGEGEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTLHNLYTLRGA-DALGWSKYINQALHRFGRQAEVMPRWGNAEIVEVLEKQRDLYGYLHDQTLHLANQGVT. 381
73 -16.8004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  11  28.......................................ETRQCALIDSRTCSASADRLVERVNELNASVRWVLETHVHADHLSAAAYLKEKGAHITQVQKVFGALARDGSQFDVLLEDEEGFRIGNLQARALHT-PGHTPACMSFMIEDEIAVFVGDTLFMPDYGTA---PGADARTLYRSIRRLLAF-PDQTRLFMCHDYLPGGRDMQYVTTVAEQRASNIH--IHQGIDE 243
74 -16.7004pdx_A mol:protein length:640 Putative alkyl/aryl-sulfatase YjcS  ali model follow..  10  89........LFKVTDKMYQVRGQD---------SNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQHQKPIVAVIYTHSHTDHYGGVKGIISEAVQVIAPAGFMDEAISENVPTKTIVRTGEKMIIDGLEFDFLMTPGSEAPAEMHFYIPALKALCTAENATHTLHNFYTLRGA-DTSKWTEYLNETLDMWGNDAEVLPVWGNKHINDYIGKYRDTIKYIHDQTLHLANQGYT. 363
75 -16.4002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  12  117........LFEVMPKLYQVRGL----------ANMTIIEGDSGLVLIDTLTTAETARAALDLYFQHKKPIVAVVYSHSHIDHFGGARGIIDEAVKVFAPSGFMEHAVSENIPNVLIEKPYERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPAMHNLLTPRGA-DAKAWAGYIDASLEKYGDRTDVLPVWGGDKVRTYLADQRDMYAFLNNRALNLMNKGLT. 392

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 0 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. VISSA: a program to visualize structural features from structure sequence alignment. Bioinformatics. 2006 Apr 1;22(7):887-8. Epub 2006 Jan 24.