current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4xuk_A mol:protein length:291 Putative hydrolase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst KQVAGYYQYQAGDVQITALLDGTNFMSPNLFKDIPQQQVHEILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASCFGSHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISKDGVANFPNATVYVSNDEASFWLDPKQAAKLPKEKQANYLGTVEKIKQAIAPYQAKQRFKTYKLGDDIQGFKVINTAGHTPGHFSYELKTKGESIVFIGDIVHSHTVQFDRPETAIEYDIDPKKAVETRLKQFANFAKNGQTIAAPHLPFPGIGHTYSADGKSYQWIPIHFKDLast
1 -122.0004xuk_A mol:protein length:291 Putative hydrolase  ali model  100  1KQVAGYYQYQAGDVQITALLDGTNFMSPNLFKDIPQQQVHEILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASCFGSHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISKDGVANFPNATVYVSNDEASFWLDPKQAAKLPKEKQANYLGTVEKIKQAIAPYQAKQRFKTYKLGDDIQGFKVINTAGHTPGHFSYELKTKGESIVFIGDIVHSHTVQFDRPETAIEYDIDPKKAVETRLKQFANFAKNGQTIAAPHLPFPGIGHTYSADGKSYQWIPIHFKD 291
2 -103.0004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  45  32TQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNDGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMF----KMAQQAVAPYAKMNKLKPYKTEELLPGVSLVASPGHTPGHTSYLFKSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRK-EAQGYAWVPVEFS. 318
3 -103.0004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  45  32TQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNDGSPAYPNATVEVPQAEAEFWLDEATMAKAPEGMQGMF----KMARQAVAPYAKMNKLKPYKTEELLPGVSLVASSGHTPGHTSYLFKSGGQSLLVWGDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRE-EAQGYAWVPVEFS. 318
4 -103.0004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  23  1DDLSGFKKIKLGELELFILTDGYIHEENSFAPRGNVAELKTILKDNFRADHY-IDMAINILLVKTKEKLILMDTGMGIFADERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDQNKLVFPNASIFISKIEHDFWINASIKDFNNSALKERLNQIIPALQNILKAI--QPKLKFYDLNTLYSHFNFQLAPGHTPGLTVTTISSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKV-KAPGFEWIPESFMN 294
5 -101.0001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  38  42TSAPGYYRMLLGDFEITALSDGTVALPVDKRLNQPAPKTQSALAKSFQKAP--LETSVTGYLVNTGSKLVLVDTGAAGLFGPTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMVGEQLAFPNAVVRADQKEADFWLSQTNLDKAPDDESKGF---FKGAMASLNPYVKAGKFKPFSGNDLVPGIKALASHGHTPGHTTYVVESQGQKLALLGDLILVAAVQFDDPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIAASHLSFPGIGHIRA-EGKGYRFVPVNYS. 326
6 -74.6003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  18  1........MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNA--NERNQINLPTHPILIQTAQYNLIIDAGIGNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDAGHAIFENAIHVVQQDEWHEFIAPNIRSKST------------YWDKNKGDY--SNKLILFEKHEPVPGIKMQHSGGHSFGHTIITIESQGDKAVHMGDIF--PTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSD-DGENIDAYI..... 271
7 -50.1001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  16  1..............................MGSDKIMELKILVTGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNL----SSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNS-----VLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKG-------------EESLFDEKVKVFHTPWHAREHLSFLLDTENARVLITGDITPNR---------LSYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPL....................... 209
8 -48.3004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  17  7.CGASPLLVPGDPYSVVVLLQGYAEPEGVVRADGSVTLVLPRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPW----AREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNL-----GLFPGAALLVSHDFCLPGGR-----------------------------YLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGTALVVVAGDVFERD----GDEDSWQALSEDPAAQERSRKRVLVVAD----VVVPGHGPPFRVLR.................. 239
9 -45.4003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  17  1..........MSDTKVYLLDGGSLVLDGYHVFWNR-------------GPGGEVRFPVYSILIEHAEGRFLIDTGYDY-IQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGN-----KYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTTFEGIDGDDLARGVKLISTPGHSIGHYSLLVEPRRKPILFTIDAAYTQK----ETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSH---------DMDNFKTYRTGTQFYG. 268
10 -40.3003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  18  2.......RISMTVKKLYFIPAGRCMLDHSSVNSAL-------------TPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLIVNILKRVGYEPDDLLYIISSHLHFDHAGGN-----GAFTNTPIIVQRTEYEAALHREEYMKE---------------------ILPHLNYKIIEGDEVVPGVQLLYTPGHSPGHQSLFIEEQSGSVLLTIDASYTKEFEDEVP----FAGFDPELALSSIKRLKEVVKKEKPIIFFGH.......................... 239
11 -40.1002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  18  1........MDMTVKKLYFIPAGRCMLDHSSVNSAL-------------TPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLIVNILKRVGYEPDDLLYIISSHLHFDHAGGN-----GAFTNTPIIVQRTEYEAALHREEYMKE---------------------ILPHLNYKIIEGDEVVPGVQLLYTPGHSPGHQSLFIKEQSGSVLLTIDASYTKEFEDEVP----FAGFDPELALSSIKRLKEVVKKEKPIIFFGH.......................... 237
12 -39.7002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  13  2............GNKLFVLDLGEIRVDENFII----ANSTFVTPQKPTVSSRLIDIPVSAYLIQCTDATVLYDTGCHPECMGTNGRLPERLRQLGLSPDDISTVVLSHLHNDHAGCV-----EYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRNWDLVGRDE-----RERELAPGVNLLFGTGHASGMLGLAVREKQPGFLLVSDACYTAT-NYGPPARRAGVLHDTIGYDRTVSHIRQYAESRSLTVLFGH---------DREQFASLIKSTDGFYE 276
13 -30.5002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  15  1..........MGSSSSGLVPRGSHMLRLSAPGQLDDD-----------------DVQVPVFLLRLGEAWALVEGGISR----DAELVWADLCRWVADPSQVHYWLITHKHYDHCGLL----CPRLPNVQVLASERTCQAWKSESAVRVVERLNRQLLRAEQRLPEACAWD---ALPVRAVADGEWLE-LQVIEAHGHSDDHVVFYDVR--RRRLFCGDALGEFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLL----QLIPGH.......................... 235
14 -30.3003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  16  20.........................................................ATVYVMCGEKLTVMIDAGVSNSI---------------SFLDKLDYIVLTHLHIDHIGLLPE---LQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGMRLIYTPGHARHHMSVLVDD----FLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKV-----VGFAHGGLVSPKIMEEHLKQMLSKEEI.... 229
15 -29.9004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  20  58.........................................................ISALLVTSDAGHILVDAATPQ----AGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKAT--GAPVYARAPAIDTLKRGLPDRTDPQFEVA-------------EPVAPVANIVTLADDGVVSALTAVASPGHTPGGTSWTWEGDDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARVAALDCD---ILVTPH.......................... 250
16 -29.5004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  20  58.........................................................ISALLVTSDAGHILVDAATPQ----AGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKAT--GAPVYARAPAIDTLKRGLPDRTDPQFEVA-------------EPVAPVANIVTLADDGVVSALTAVASPGHTPGGTSWTWEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCD---ILVTPH.......................... 250
17 -29.2005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  20  30........................................................GLSSVLVTSPQGHVLIDGGLPE----SAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRS--NALVAASPSAALDLASGEVGPDDPQ-------------YHALPKYPPVKDMRLARDGGQFNYLTAHATPGHTPGGLSWTWQSCDGNMVYADSI------AVSRPGFKFSASSEYPNALADLRHSFETLEKLPCVLISAHPEASQLWQRLEASATG.......... 239
18 -28.7003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  19  25........................................................GISAVLLSSPQGHILVDGTTEK----GAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLT--GATVLAGAANVDTLRTGVSPKSDPQ--------------GSLSNFPGSAKVRAVADGELVK-VKAHATPGHTEGGITWTWQSCEQDVVFADSLTAVSADSYRFSDH-------PEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKE.......... 231
19 -28.5001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  15  24........................................................DLASYLIVTPRGNILINSDLEA----NVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQT--KAKYMVMDEDVSVILSGGKSDFHYANDSS-------------TYFTQSTVDKVLHDGERVE-LTAHLTPGHTRGCTTWTMKLKDHGKQ--YQAVIIGSIGVNPGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVLLSKG.......... 231
20 -28.3003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  19  54........................................................GIAVYVIKTSQGLILMDTAMPQ----STGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKET--GAQLVAGERDKPLLEGGYYPGDEKNED---------------LAFPAVKVDRAVKEGDRVTTLTAHATPGHSPGCTSWEMTVKDGEVLFFCSGTVALNRLVGQPTY-------AGIVDDYRATFAKAKAMKIDVLLGPH.......................... 242
21 -28.0005aeb_A mol:protein length:272 LRA-12  ali model follow..  16  35......................................................TYDLACYLITTKQGNIIVNTGLAA----SALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKIT--GAKLMADEGDATVMADGGSSDYAFGGHG--------------SMFEPIIADRLLHDKDTIQKLVMLHHPGHTKGSCSFLFDTKDERILIANMPTIVIEKKFSE------VSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGY.......... 243
22 -27.8001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  20  37........................................................DLTALLVQTPDGAVLLDGGMPQ----MASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRT--GAKVAANAESAVLLARGGSD---------------DLHFGDGITYPPANADRIVMDGEVIT-FTAHFMAGHTPGSTAWTWTDTRNRIAYADSLSAPGYQLQGNPR----YPHLIEDYRRSFATVRALPCD---VLLTPH.......................... 225
23 -24.9002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  25  10......................................................PLQENAYLVETGEGPVLIDPGD------EPEKLLALFQTTGLIPLAI---LLTHAHFDHVGAVAPLVEAL--DLPVYLHPLDLPLYEGADLAARA-----------------GLAIPKPPLPVRPLEEGMRLFGFQVLHLPGHSPGHVAFYDPE--GAQVFSGDLLFRGSVRYDLPG-------DPKALFASLKRLLS--LPPETRVHPGHGPGTTLGLEARTN............. 197
24 -24.4002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  17  2....................................KALLPGLYLLPVPIPYPLK-TVNLYLLQGAGEVALVDTALGT--RAARGALELHLAELGLCFQDVKTILLTHHHPDHYG----SGFFEGLGARVFLHEEEFARGHRFWREPEAFAEASWRLFLDHGTPEGALQGIRETQNPLPLRDGEALERLRVLWTPGHADGHAAFYLEE--EGVLLAGDAL----LEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGH-PIADV.................... 240
25 -21.2005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  17  13GEYPTVNEIPVGEVRLYQIADG-------------------VWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA---KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGVD------------VLRKAGVATYASPSTRRLAEAEGNEIPTHSLEGL------SSSGDAVRFGPVELFYPG------AAHSTDNLVVYVPS--ANVLYGGCAV----LALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVI-------PGHGLPGGLD............. 229
26 -21.1004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  16  31GEYPTVNEIPVGEVRLYQIADG-------------------VWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA---KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGVD------------VLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGL------SSSGDAVRFGPVELFYPG------AAHSTDNLVVYVPS--ANVLYGGCAVLELSS----TSAGNVADADLAEWPTSVERIQKHYPEAEVVI-------PGHGLPGGLD............. 247
27 -20.5002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  17  31GEYPTVSEIPVGEVRLYQIADG-------------------VWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA---KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGVD------------VLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGL------SSSGDAVRFGPVELFYPG------AAHSTDNLVVYVPS--ASVLYGGCAIY----ELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVI-------PGHGLPGGLD............. 247
28 -20.4002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  15  30GEYPTVDDIPVGEVRLYKIGDG-------------------VWSHIATQKLGDTVYSSNGLIVRDADELLLIDTAWGA---KNTVALLAEIEKQIGLP--VTRSISTHFHDDRVGGV--------------------DVLRAAGVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVVRFGPVEV----FYPGAAHSGDNLVVYVPA--VRVLFGGCAVHEASR----ESAGNVADANLAEWPATIKRIQQRYPEAEVVI-------PGHGLPGGLE............. 246
29 -20.2002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  16  1...KTVIKNETGTISISQLNKN-------------------VWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDD---KLTKELIEMVEKKFQKR--VTDVIITHAHADHIGGI-----KTLKERGIKAHSTA----------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPG-----------KGHTEDNIVVWLPQ--YNILVGGSLVKSTSA----KDLGNVADAYVNEWSTSIENVLKRYRNINAVV-------PGHGEVGDKG............. 212
30 -20.1004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  14  6............ELRIEKVKENI------------------FLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSD---RDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGI-----KWLNDQSISTYATT--------------------------STNHLLKENKKEPAKYTLKGNESTLVDGLIEVGGHTIDNVVVWLPK--SKILFGGCFVRSLDS----EGLGYTGEAHIDQWSRSAQNALSRYSEAQIVI-------PGHGKIGDIA............. 207
31 -20.0004tyf_A mol:protein length:231 NDM-4  ali model follow..  16  1....GPGDQRFGDLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD------------ALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGW--VEPATAPNFGPLKVFYPG------PGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAPDSRA............. 218
32 -20.0004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  15  21............DLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW--VEPATAPNFGPLKVFYPG------PGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGAADTEHYAASARAFGAAFPKASMIV-------MSHSAPDSRA............. 230
33 -19.8003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  15  1...KTVIKNETGTISISQLNKN-------------------VWVHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDD---KLTKELIEMVEKKFQKR--VTDAIITHAHADRIGGI-----KTLKERGIKAHSTALTAELAKKNGYEEPL----------GDLQTVTNLKFGNMKVETFYPG-----------KGHTEDNIVVWLPQ--YNILVGGCLVKSTSA----KDLGNVADAYVNEWSTSIENVSKRYRNINAVV-------PSHGEVGDKG............. 212
34 -19.8004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  15  24............DLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW--VEPATAPNFGPLKVFYPG------PGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAPDSRA............. 233
35 -19.7002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  16  43..........................................................NGLVLNTSKGLVLVDSSWDD---KLTKELIEMVEKKFQKR--VTDVIITHAHASRIGGI-----KTLKERGIKAHSTA----------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPG-----------KGHTEDNIVVWLPQ--YNILVGGCLVKSTSA----KDLGNVADAYVNEWSTSIENVLKRYRNINAVV-------PGHGEVGDKG............. 218
36 -19.7002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  20  6............PLEVIKIEDGV------------------YLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLL------LSWATDRGYQVMASISTHSHEDRTAGI-----KLLNSKSIPTYTSE--------------------------LTKKLLAREGKPVPTHYFKDDEFTLGNGLIELAGHTEDNIVAWLPK--SKILFGGCLVRSHEW----EALGYVGDASISSWADSIKNIVSKKYPIQMVV-------PGHGKVGSSD............. 207
37 -19.6005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  15  21............DLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW--VEPATAPNFGPLKVFYPG------PGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAPDSRA............. 230
38 -19.6003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  15  15............DLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW--VEPATAPNFGPLKVFYPG------PGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAPDSRA............. 224
39 -19.5005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  20  23............PLEVIKIEDGV------------------YLHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLL------LSWATDRGYQVMASISTHSHEDRTAGI-----KLLNSKSIPTYTSE--------------------------LTKKLLAREGKPVPTHYFKDDEFTLGNGLIELAGHTEDNIVAWLPK--SKILFGGCLVRSHER----EGLGYVGDASISSWADSIKNIVSKKYPIQMVV-------PGHGKVGSSD............. 224
40 -19.4004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  14  6............DLKIEKLDEGV------------------YVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTA---KDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGI-----EWLNSRSIPTYASE--------------------------LTNELLKKDGKVQATNSFSGVNYWLVKNKIEVPGHTPDNVVVWLPE--RKILFGGGFIKPYGLGN---------DANIEAWPKSAKLLKSKYGKAKLVV-------PSHSEVGDAS............. 204
41 -19.3004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  15  48............DLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW--VEPATAPNFGPLKVFYPG------PGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAPDSRA............. 257
42 -19.1005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  15  23..................................DTFEVAPGVRWLRMPLPFSLD-HINLWLLRGQAGWTIVDCGISS---EAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFG-LCEGGDQGRWNVRLWMTLGEYMF-AAGNGSNAGGAAAADHFARHGLTDPAALDKLRSRRRYRRLREGDAVKTWRVVTGYGHSPEHCAL---SEADGVLISGDMV----LPRISTNVSV--EANPLALYLESLGRYETMAPDTLVLPSHGKPFRGV.................... 278
43 -19.1003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  15  22............DLVFRQLAPNV------------------WQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTA---QILNWIKQEINLP--VALAVVTHAHQDKMGGMD------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW--VEPATAPNFGPLKVFYPG------PGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAPDSRA............. 231
44 -18.9004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  14  7............DLKIEKLEEGV------------------YVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTA---TDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGI-----EWLNSQSIPTYASE--------------------------LTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVPGHTQDNVVVWLPE--KKILFGGCFVKPDGLGN---------DANLEAWPKSAKILMSKYVKAKLVV-------SSHSEIGDAS............. 205
45 -18.6002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  20  21......................................................NIDFNGFAWIRPEGNILIDPV------ALSNHDWKHLESLG----GVVWIVLTN--SDHVRSAKEIADQT--YTKIAGPVAEKENFPIYCDR-------------------------------WLSDGDELVPGLKVMELQGKTPGELALLLEET---TLITGDLVRAYRAGGLEILPDEKL-MNKQKVVASVRRLAALEKVEAV--------LVGDGWSVFRDGR........... 190
46 -18.3001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  20  10............DISITQLSDKV------------------YTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPIND---AQTEMLVNWVTDSLHAK--VTTFIPNHWHGDCIGGL-----GYLQRKGVQSYANQMTIDLAKEKGLPVPE----------HGFTDSLTVSLDGMPLQCYYLG-----------GGHATDNIVVWLPT--ENILFGGCMLKDNQT----TSIGNISDADVTAWPKTLDKVKAKFPSARYVV-------PGHGNYGGTE............. 213
47 -18.2003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  19  32..........................................................NSMYLVTKKGVVLFDVPWEKVQYQ---SLMDTIKKRHNLP--VVAVFATHSHDDRAGDLSFFNNK---GIKTYATAKTNEFLKKDGKATST------------EIIKTGKPYRIGGEEFVVDFLGE-----------GHTADNVVVWFPK--YNVLDGGCLVKSNSA----TDLGYIKEANVEQWPKTINKLKAKYSKATLII-------PGHDEWKGGG............. 207
48 -18.1001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  21  10............DISITQLSDKV------------------YTYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPIND---AQTETLVNWVADSLHAK--VTTFIPNHWHGDCIGGLQKKGVQSYANQMTIDLAKEKGLPVPE------------------HGFTDSLTVSLDGMPLQCYYLG-----------GGHATDNIVVWLPT--ENILFGGCMLKDNQA----TSIGNISDADVTAWPKTLDKVKAKFPSARYVV-------PGHGDYGGTE............. 213
49 -17.8002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  20  9...................................................TAFSQNCSLIWCEQTRLAALVDPGG------DAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHY--GVPVIGPEKEDEFWLQGLPA---------------QSRMFGLDECQPLTPDRWLNDGDRVS-LQVLHCPGHTPGHVVFF--DEQSQLLISGDVIFKGGVG----RSDFPRGDHTQLIDAIKRKLLP--LGDDVTFIPGHGPLSTLGYERLHN............. 205
50 -17.7004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  11  2........................PKSSDHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQ---TLMDWVAKT--MKPKKVVAINTHFHLDGTGG-----NEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSSNELVEVPAHSPDNVVVYFPK--KKLLFGGCMIKPKELGY---------DANVKAWPDSARRLKKFDAK---------IVIPGHGEWGGPE............. 232
51 -17.6001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  16  1............DVKIEKLKDNLYVYTT-------------------YNTFNGTKYAANAVYLVTDKGVVVIDCPWGE---DKFKSFTDEIYKKHGKK--VIMNIATHSHDDRAGGL-----EYFGKIGAKTYSTKMTDSILAKENKPRAQ----------YTFDNNKSFKVGKSEFQVYYPG-----------KGHTADNVVVWFPK--EKVLVGGCIIKSADS----KDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVV-------AGHDDWKDQR............. 203
52 -17.2002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  11  1..............................MRGSGSVEVQVLIENVVFARNFVAEHGLS-LLLKKGNKEIVVDTGQSENF-------IKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKG---ERNPEVKIYTHKENKKYAMRKGGQFEEIGFDLSFYEKYKNNFVLIDKDAEIEEGFYVITNTDITYDNEFTTKNFFVE-DEVFVVVKEEDGINVVTGCSHAGILNI----------LETARNRFGVSYIKS-------LIGGFHLRGMEEEKVKDI.............. 233
53 -17.1003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  11  27..........................................................NSMVYIGTDGITIIGATWTPETAE---TLYKEIRKVSPLP--INEVINTNYHTDRAGGNAYWKTL---GAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTV-FPGDFNLQNGSIRAMYLG------EAHTKDGIFVYFPA--ERVLYGNCILKENLGNMSFANRT-----EYPKTLEKLKGLIEQGELKVDSIIAGH.......................... 211
54 -16.9001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  13  4.....................................SLTQVSGPVYVVEDNYYVQE-NSMVYFGAKGVTVVGATWTPDTAR---ELHKLIKRVSRKP--VLEVINTNYHTDRAGGNAYWKSI---GAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPLVLPNVV-HDGDFTLQEGKVRAFYAG------PAHTPDGIFVYFPD--EQVLYGGCILKEKLGNLS--------FADVKAYPQTLERLKAMKLPIKTVI-------GGHDSP................. 207
55 -16.6004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  19  10....................................ERLSNRVVRVLGCNPGPMTLGTNTYLVGTGPRRILIDTG-EPAIPEYISCLKQALTEFN---TAIQEIVVTHWHRDHSGGI-------------------------GDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTLRVLYTPGHTDDHMALLLEE--ENAIFSGDCI----------GEGTTVFEDLYDYMNSLKELLKIKAD---------IIYPGHGPVIH............... 205
56 -16.3001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  12  34......................................................GEATSGYLFEHDGFRLLVDCGSGVL-----AQLQKYI-----TPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENG--------------FHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPVTCFAMRITAGNDIVVYSADSSYIPEF------IPFTKDADLFICECN-------MYAHQEAAKAGHMNSTEVASIAKDAN............ 221
57 -16.2001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  17  16.....................................................................LVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK--VKLESGLKVY---------------------------GGDDRIGALTHKITHLSTLQVGS------NVKCLATPCHTSGHICYFVGGSEPPAVFTGDTLFVAGCG---------YEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGN.......... 190
58 -15.9002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  14  22......................................................EVGRSCIILEFKGRKIMLDCGI-----PGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYSDYVKVSNISADDMLYTETDLEESMDKIETIN-------FHEVKEVAGIKFWCYAGHVLGAAMFMIEIAGVKLLYTGDFSRQEDRHLMAAEIESTYGTHIHEKREEREARFCNTVHDIVNRGGR-IPVFALGRAQEQNHPELHDIPIYYAS 272
59 -15.1002ycb_A mol:protein length:636 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  15  190......................................................EVGRSCLYLQTPNSRVLLDCGV-NVAGGDDKNSYPYLNVPEFTLDSLDAVIITHAHLDHSGFLPYLYHYGY-DGPVYCTAPTRDL-LDHIDIAHREDEPLPFNVKHVKKSVKHTITLDYGEVT------DIAPDIRLLHNAGHILGSAMAHLGDGQHNMVYTGDFKYEQSRLLEAAESTYGGHEDVQPSRNRAEKELVKTIYSTLRRGGK-IPVFAVGRAQE............... 423
60 -15.1003g1p_A mol:protein length:258 Protein phnP  ali model follow..  12  2............SLTLTLTGTGGAQGVPAWGCECAACARAR--------RSPQYRRQPCSGVVKFNDAITLIDAGL-------------HDLADRWSPGSFQQFLLTHYHMDHVQGL------------------PLRWGVGDPIPVYGPPDEQGCDDLFKHPGLLDFSHTVEPFVVFDLQGLQVTP---------HSKLTFGYLLETAHSRVAWLSDTAGLPEKTLKRNHCDLNTVLALNQVIRSPRVILTHISHENALPSGFEVGFDGM.................... 247
61 -15.1002dkf_A mol:protein length:431 metallo-beta-lactamase superfamily protein  ali model follow..  19  15..........................................................SAHLLLAGGRRVLLDCGM------QGKEEARNHAPFGFDPKEVDAVLLTHAHLDHVGRLPKLFREGY-RGPVYATRATVLLMEIVLEDALKVMDEPFFGPEDVEEALGHLRPLE-------YGEWLRLGALSLFGQAGHLPGSAFVVAQGEGRTLVYSGDLGNREKDVLPDPSLPPLADLPYRETVREFLEILEKTLSQGGKVL---IPTFAVERAQE............... 230
62 -14.7002i7x_A mol:protein length:717 Protein CFT2  ali model follow..  14  12......................................................SGTTVGSVVRFDNVTLLIDPG----WNPSKVSYEQCIKYWEKVIPEIDVIILSQPTIECLGAHS---SHFISRIQVYATLPVINL-TIDSYASAGVIGPYDTNKLDLEDIEISFDHIVPLKYSQLVDLRSRYDGLTLLANAGVCPGGSIWCISTYSEKLVYAKRWNHTRDNILNAASITTLDRFGSSQPFKKRSKIFKDTLKKGLSSDGS-IPVDMSGKFLD............... 256
63 -14.6003af5_A mol:protein length:651 Putative uncharacterized protein PH1404  ali model follow..  15  199......................................................EVGRSALLVQTDESFVLVDFGVNVAMLNDPYKAFPHFDAPELREGLLDAIIITHAHLDHCGMLPYLFRYNLFDGPIYTTPPTRDL-KDFIEIQQSNGQDPLYRPRDIKEVIKHTITLDYGEVR------DISPDIRLLHNAGHILGSAIVHLGNGLHNIAITGDFKFIPTRLLEPANAKFDIQMPREEAEKRLIEVIHNTIKRGGKVL---IPAMAVGRAQE............... 438
64 -14.6003h3e_A mol:protein length:267 uncharacterized protein Tm1679  ali model follow..  13  10........................................HVLCDDSSQNGFESEHGFSVLV-----DSVLFDTGKSDV-------FLKNARKLGIDL--PKDVLISHGHYDHAGGLLY-GKRVWLRKEALDQKYSGERYAGADWNEVLYYNTGKFVIERITEIGKNMFLLGPANLRGKVPTGDFFVERNGERRKDLFEDEQTLVVRTKEGLVVITG-CSHRGIDNI----------------LLDIAETFNERIK--MVVGGFHLLKSSDDEIEKI.............. 214
65 -14.2002xr1_A mol:protein length:640 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  20  194......................................................EVGRSCFLLSTPESRILIDCGVNV--GSDENMTPYLYVPEVFPLNQIDAVIVTHAHLDHQGLVPLLFKYGY-EGPVYCTPPTRDL-LDYIDVAAKEGKKIPYESGMVAKTLKHTIPLDYEEVT------DIAPDIKLFHNAGHILGSAIFHIGDGLHNVVFTGDYKYEKTRLFDPAVNKFPFQPALKDAEKHLQMVVKNTIERGGIAV---IPAFAVGRSQE............... 426
66 -13.6001ww1_A mol:protein length:280 tRNase Z  ali model follow..  14  5....................................................GFSKALFSTWIYYSPERILFDAGEGVS------------TTLGSKVYAFKYVFLTHGHVDHIAGLW--GVVNIRNNGMGDREKPLDVFYPEGNRAVEEYTEFIKRANPDLRFSFNVHPLKEGERVFLRNAGGFKRYVQPFRTK-HVKGRDFVTEEYHKKVLTISGDSLALDPEEIRGTELLIH--LDARDRRYKNHAAIDEVMEGVKKVILYHISTRYIRQLKSVIKKYREEMP..... 265
67 -13.3002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  22  36...........................................................SYLIHTTHTLAAVDVNADY--KPILTYIEEHLKQQGNADVTFSTILSTHKHWDHSGGNAK---------------------LKAELEAMNSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLS-----VEVIDAPCHTRGHVLYKVQHNDGVALFTGDTMFIAGIG---------FEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFSEKTFPDR... 237
68 -13.0001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  19  14...........................................................AYILHDTGTVGVVDPS-------EAEPIIDSLKRSGR---NLTYILNTHHHYDHTGGNLELKDRY--GAKVIGSAMDKD------------------------RIPGIDMALKDGDKWMFAGHE-----VHVMDTPGHTKGHISLYFPGSR--AIFTGDTMFSLSCG---------FEGTPKQMLASLQK-ITSLPDDTSIYCGHEYTLSNSKFALSLEPNN.......... 186
69 -12.8004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  19  36..................................................................DSVLDYDPKSGRTCSASADRLVERVNELNA---SVRWVLETHVHADHLGGHTAIGAHITQVQKVFLFNAEPGFARDGSQFDVLLEDEEGFRIGNLQ--------------------------ARALHTPGHTPACMSFMIEDAGEIAVFVGDTLFMPDYGTARCDFPGA---DARTLYRSIRRLLAFPDQTRLFMCHDYLP........................ 216
70 -12.2003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  16  32..........................................................GSLMLTYDNHSIQVDPVSEY--------------ADYTTFPKADIILITHEHGDHLD--PKAIQAVEKSDTEIIANENSQKKLGKGKVLKNGDTDTSI----------------SYMKIEAVPAYNTTPGRDKYHPRHRDNG---YILTFDGLRVYIAGDTEDIPEMKLKDIDIAFPYTMTVSQAAKAARMFSPKI------LYPYHY......................... 204
71 -12.2002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  13  17......................................................TIGGTVIEVAYKDAHIFFDFGTERPELDLPDDHIETLINNRLVPEQHTAVFLSHAHLDHSRMI----NYLDPAVPLYTLKETKMILNSLNRKGDF-------------LIPSPFEEKNFTREMIGLNKNDVIKSVEIVPVDHDAYGASALLIRTPDHFITYTGD-----------------LRLHGHNREETLAFCEKAKHTELLMMEGVSISFP...................... 223
72 -11.7001vme_A mol:protein length:410 Flavoprotein  ali model follow..  16  44.......................................................ISYNAYLVKLNGANVLIDG----WKGNYAKEFIDALSKI-VDPKEITHIIVNHTEPDHSGSLPATLKTIGHDVEIIASNF----------------------------GKRLLEGFYGIKDVTVVKDGEEREGGKKFKFVMTPWLHWPDTMVTYLDGILFSCDVGGYLLPEILDDSNESVVERYLPHVTKYIVTVIGHYKNEKLSSLKIKALLPGHGLIWKKD............. 241
73 -11.7004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  14  41.......................................................TTSNSYVIE-GDKTAIIDPPVESFMKIYLEALQQTV-----NLKKLDYVILGHFSPNRIPTFKA--LELAPQITFVCSLPAAGD-----------------LRAAFPDDNLNILPMRGKETLDLGKGHV----LKFLPIP-RWPA--GLCTYDVQTQILYTDKIFGAHICG------DDVFDDNWESFKEDQRYYFNCLALEKISDLQVRLYAVGHGPLVRTSLIALTQAYADWSK 251
74 -11.7003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  23  14.......................................................LAHASYLVQETGEACVIDP-----------DVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRA--GAAICVSDEGPPEWKSE---------------------------YVKAYPHRLLKDGDELH-IVVMHTPGHTPEHVSYLLYDGKTS-LFSGDFVFVGDVG--RPDLLERVAGESGSSEALARQMFRSLRKDHVQVLPAH----GAGSA................. 204
75 -11.4002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  25  23............................................................VLTNDEGRCVIVDPG-------EAAPVLKAIAEHKW---MPEAIFLT----DHVGGVKE--LQHFPQMTVYGPAET--------------------------QDKGATHLVGDGDTIRVLGEK-----FTLFATPGHTLGHVCYF----SRPYLFCGDTLFSGGCG---------FEGTPSQMYQSLMKI--NSLPDDTLICCAH.......................... 168

FFAS is supported by the NIH grant R01-GM087218-01
1 1 8 0 3 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.