current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4ysb_A mol:protein length:233 Metallo-beta-lactamase family protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MIFRQLFDSESSTYTYLIGDEATRQAVLIDPVLEQVDRDLQMVAELDLTLTHVFDTHVHADHITASGALRERTQATVVGSVNGASCANVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLGDRVFTGDALLVRGNGRTDFQNGNASQLYDSLTRVLFTLPDETLVYPGHDYKGRTVTSIAEEKRHNPRVAGKSREEFIHIMENLNLPRPKLIDAAVPANRACGHTAPSPQGALast
1 -130.0004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model  100  1MIFRQLFDSESSTYTYLIGDEATRQAVLIDPVLEQVDRDLQMVAELDLTLTHVFDTHVHADHITASGALRERTQATVVGSVNGASCANVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLGDRVFTGDALLVRGNGRTDFQNGNASQLYDSLTRVLFTLPDETLVYPGHDYKGRTVTSIAEEKRHNPRVAGKSREEFIHIMENLNLPRPKLIDAAVPANRACGHTAPSPQGA 233
2 -116.0002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  48  3LLFRQLFENESSTFTYLLADVPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVSKASGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHDYKGFEVSTVGEEMQHNPRL-TKDKETFKTIMSNLNLSYPKMIDVAVPANMVCGLQDVPSQAN 245
3 -115.0004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  48  7ILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVSRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRL-TLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGVQTPT.... 237
4 -87.9004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  29  7..VEGFFDPATCTISYLLFDSGSGECALIDSVLDSADQLIARVAALGARVRWLLETHVHADHLSAAPYLKTRVGGEIAIGRHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAAFVGDTLFMPGTARCDFPGGDARSLYRSI-RKVLSLPPATRLYMCHDYQPQYASTVADELRENVHIRGVTEDDFVAMRRDATLDMPVLMLPSVQVNMRAGRLPEPEDNG 287
5 -87.7004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  34  9..VDAFYDEATSTISYLVMDRETRQCALIDSVLDSADRLVERVNELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIEDAVFVGDTLFMPGTARCDFPGADARTLYRSI-RRLLAFPDQTRLFMCHDYLPQYVTTVAEQRASNIHIHGIDEDSFVAMRRDKTLEMPVLILPSVQVNMRSGQLPPPEANG 283
6 -53.5003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  28  4MYLRRFYDEGLAHASYLVGCQETGEACVIDPARD-VEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEWKRLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDALFSGDFVFVGDVGRPDLLERVARQMFRSL-RKFEALPDHVQVLPAHALGAVPSSTVGYEKLVNWALQHKDEDAFVQALLAGQPEAPIYFARMKLVNKV........... 259
7 -52.9003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  29  19MFFKQFYDKHLSQASYLIGCQKTGEAMIIDPIRD-LSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLGHFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDELFSGDFIFVGDIGRPDLLEKAAKQMFKSI-ESIKDLPDYIQIWPGHSLGAIPTSTLGYEKQTNWAFSENNEATFIDKLISDQPAPPHHFAQMKKINQFGMNLYQPYT.. 282
8 -51.1001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  29  10..........TDNYMYLVIDDETKEAAIVDPV--QPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLEGLKVYGGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKAVFTGDTLFVAGCGK--FYEGTADEMCKALLEVLGRLPPDTRVYCGHEYEPTVPSTLAEEFTYNPFMRVREKT----VQQHAGETDPVTTMRAVRREKDQFKMPRD.... 260
9 -49.0002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  26  1MRVFPVTLGPLQENAYLVET--GEGPVLIDP--DEPEKLLALFQTTGLIPLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEGADLAARAWGLAIFGFQVLHLPGHSPGHVAFYDPEGVFSGDLLFRGSVGRYDLPGADPKALFASL-KRLLSLPPETRVHPGHG-----GTTLGLEARTNPFLTGLEWEA.................................... 207
10 -46.6001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  23  10..........KDNYAYILHDEDTGTVGVVDP--SEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSIFTGDTMFSLSCGKL---EGTPKQMLASL-QKITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYA-AHVAELRSKKLPTIPTTVKMEKACN............. 218
11 -45.4002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  31  16...............SLIWCEQTRLAALVDP--GDAEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDETPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLPLGDDVTFIPGHG-----LSTLGYERLHNPFLQ.......................................... 209
12 -43.9002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  26  32..........KDNFSYLINDHTTHTLAAVDPILTYIEEHLKQNADVTYTFSTILSTHKHWDHSGGNAKLKAELEAMVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHALFTGDTMFIAGIGA--FFEGDEKDMCRAMEKNDYALDKVTFIFPGHEYDPSVPSSLAEEKRQNLFLRVADPA----FVAKMNQGNAHALMMYLY............... 301
13 -39.4002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  24  17..........QDNYIWVLTN-DEGRCVIVDP--GEAAPVLKAIAEHKWMPEAIFLT----DHVGGVKELLQHFPQMTVYGPAETKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSRPYLFCGDTLFSGGCGRL---EGTPSQMYQSL-MKINSLPDDTLICCAHEYTLANIKFALSILPHDSFINEY-YRKVKELRVKKQMTLPVILKNERKIN............. 217
14 -37.6003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  20  8SIPAGPVEFPEIATVYVMCG--EKLTVMIDAGVSNSIADFSFLDK----LDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDDFLFTGDSAFNGVVIPTTPPVIDYKMYMESL-KRQIELKPKV-VGFAH------LVSPKIMEEHLKQMLSKEE...................................... 228
15 -36.9005aeb_A mol:protein length:272 LRA-12  ali model follow..  15  26IAGNLYYIGTYDLACYLITTKQGN--IIVNTGLASALQIKNNIKALGFKTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDRILIANMPVIEKKFSEVSSYPGIAKDYAYTL-QAMKNLSFDI-WVASHA-----QFSMHSKHKPKSFMDRKGYDESLDKLQK............................. 263
16 -34.9001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  18  22.........TDDLASYLIVTPRG--NILINSDLANVPMIKASIKKLGFKTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAKVLESMRCDIFL-GSHAGMFDLKNKYVSKGQNNPFVDPTGCKNYIEQKAN............................. 251
17 -34.6003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  15  14IYGNTHYVGTGGISAVLLSSPQG--HILVDGTTKGAQVVAANIRAMGFKVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQEQGKCKDVVFADSLSADSYRFSDHPEVVASLREAVEKLSCDIAI-AAHPEVNDMWTRQQRAAKESAYVDNGACRAIAAAGRK............................. 251
18 -34.2005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  19  19LFGNTYYVGMKGLSSVLVTSPQG--HVLIDGGLESAPKIIANIGALGFRVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQDGPRCLNMVYADSINAVSRPGFNALADLRHSFETLEKLPCDVLI-SAHPEASQLWQRLEASATGDAFVDPQACRAYVAAARTL............................ 260
19 -33.9003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  17  57..............VYVIKTSQG--LILMDTAMQSTGMIKDNIAKLGFKIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTDGKEDREVLFFCSGGQPTYA-GIVDDYRATF-AKAKAMKIDVLL-GPHPEVYGMQAKRAKDGAPNPFIKPGELVTYATSLSE............................. 278
20 -33.9001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  19  40..............ALLVQTPDG--AVLLDGGMQMASHLLDNMKARGVTLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVNADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTRNGKPVRIAYADSLSAPGYQLQGNPRYYRRSFATVRALPCDVLL-TPHP-----ASNWDYAAGARAGAKALTCKAYADAAEQ............................. 255
21 -32.1002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  20  19.......ARNIDFNGFAWIRPEG--NILIDPV-ALSNHDWKHLESLG-GVVWIVLTN--SDHVRSAKEIADQTYTKIAGPVAEKENFDRWLSDGDELVPG---LKVMELQGKTPGELALLLEETLITGDLVRAYRAGGLEILPDNKQKVVASV-RRLAALEKVEAVLVGD---GWSVFRDGRDR................................................. 192
22 -30.5004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  15  46VYGNTWYVGTCGISALLVTSDAG--HILVDAATQAGPQILANIRALGFRVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSQMVYADSLTAISDDVFRYSD-GYLAAFRNTLARVAALDCDILV-TPHPSASGLWNRIGPRAA-APLMDTTACRRYAQGARQR---LEKRLAEEAATSPSSGARP...... 303
23 -30.3004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  16  46VYGNTWYVGTCGISALLVTSDAG--HILVDAATQAGPQILANIRALGFRVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSQMVYADSLTAISDDVYRYSD-GYLAAFRNTLARVAALDCDILV-TPHPSASGLWNRIGPRAA-APLMDTTACRRYAQGARQ............................. 283
24 -28.9002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  21  38..............VFLLRLGEASWALVEGGISRDAELVWADLCRWVAQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAVRAVADGEWLELGPHRLQVIEAHGHSDDHVVFY-RRRLFCGDALGEFDEAEGVWVFDDMEAYLESL-ERLQRLPTLLQLIPGH............................................................... 235
25 -26.9004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  21  30..........QGTNTYLVG--TGPRRILIDT--EYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEAIFSGDCIL-----------GEGTTVFEDLYDYMNSLKKADIIYPGHNAEAKIQQYISHRNIREQQINFEKSFTVMELVKIIYKNTPENLHEMAKHNL............ 262
26 -25.3004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  17  40.....................DKGNAFIVDTPWRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTKENKKEPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPKSLFGGCFVRSLDSEGLGYGEAHIDQWSRSAQNALSRYSEAQIVIPGHG.............................................................. 201
27 -23.4004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  20  40.....................VNAEAYLIDTTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASEKKDGKVQATNSFSGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERLFGGGFIKPYGLGNLG--DANIEAWPKSAKLLKSKYGKAKLVVPSHS.............................................................. 198
28 -23.2002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  19  40.....................DNNQAYIIDTPWSDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSEAREGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSLFGGCLVRSHEWEALGYGDASISSWADSIKNIVSKKYPIQMVVPGHG.............................................................. 201
29 -23.2004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  18  41.....................VNTDAYLIDT--TDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASEKKDGKVQAKNSFSGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKLFGGCFVKPDGLGNLG--DANLEAWPKSAKILMSKYVKAKLVVSSHS.............................................................. 199
30 -22.5003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  20  38.....................TKKGVVLFDV--VQYQSLMDTIKKRNLPVVAVFATHSHDDRAGDLSFFNNKAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFPKYLDGGCLVKSNSATDLGYKEANVEQWPKTINKLKAKYSKATLIIPGHD.............................................................. 201
31 -22.5002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  22  43.....................TSKGLVLVDS--KLTKELIEMVEKKQKRVTDVIITHAHADHIGGIKTLKER--TAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYLVGGSLVKSTSAKDLGVADAYVNEWSTSIENVLKRYRNINAVVPGHG.............................................................. 206
32 -22.3005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  19  58.....................DGDELLLIDT--KNTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSALYGGCAVLALSRTSAGNADADLAEWPTSVERIQKHYPEAEVVIPGHGLPG-GLDLLQHTANVVTAHKNRSVAE.................................... 248
33 -22.1001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  21  44.....................NNHQAALLDTPINQTETLVNWVADSHAKVTTFIPNHWHGDCIGGLGYLQKKQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTELFGGCMLKDNQATSIGISDADVTAWPKTLDKVKAKFPSARYVVPGHG.............................................................. 207
34 -22.1004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  19  76.....................DGDELLLIDT--KNTAALLAEIEKQGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSALYGGCAVLELSSTSAGVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPG-GLDLLQHTANVVKAHKNRSVAE.................................... 266
35 -22.1001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  20  44.....................NNHQAALLDTPINQTEMLVNWVTDSHAKVTTFIPNHWHGDCIGGLGYLQRKQMTIDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTELFGGCMLKDNQTTSIGISDADVTAWPKTLDKVKAKFPSARYVVPGHG.............................................................. 207
36 -22.1002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  21  49.....................TSKGLVLVDSSWDLTKELIEMVEKKQKRVTDVIITHAHASRIGGIKTLKER--TAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYLVGGCLVKSTSAKDLGVADAYVNEWSTSIENVLKRYRNINAVVPGHG.............................................................. 212
37 -21.9005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  19  57.....................DNNQAYIIDTPWSDTKLLLSWATDRGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSEAREGKPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSLFGGCLVRSHEREGLGYGDASISSWADSIKNIVSKKYPIQMVVPGHG.............................................................. 218
38 -21.8001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  26  26.........AHFSTVVYL--EHKDRRIIIDPNLSSMDELEEKFSELGISITDVLFTHVHLDHIFNSVLFEN---ATFYVHEVYSSWKNVVLLKGEESLFDE-KVKVFHTPWHAREHLSFLLGRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDR----VGRIDLLVFPHD.............................................................. 206
39 -21.8003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  20  43.....................TSKGLVLVDSSWDLTKELIEMVEKKQKRVTDAIITHAHADRIGGIKTLKERALTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYLVGGCLVKSTSAKDLGVADAYVNEWSTSIENVSKRYRNINAVVPSHG.............................................................. 206
40 -21.7002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  23  18........PLKTVNLYLLQGAGE---ALVDTALGTRAARGALLAELGLCVKTILLTHHHPDHYGLSGFFEG-LGARVFLHEEEFARGHRFLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEELLAGDALLSPNVGLWAYTRENPLKDFLRSLDRLADLGAR-VAYAGHDVRQRAEELKAHHQARLEALLALLDGP.................................... 265
41 -21.6001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  15  34.....................TDKGVVVIDC--DKFKSFTDEIYKKGKKVIMNIATHSHDDRAGGLEYFGKI-MTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFPKELVGGCIIKSADSKDLGYGEAYVNDWTQSVHNIQQKFSGAQYVVAGHD.............................................................. 197
42 -21.2002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  17  76.....................DGDELLLIDT--KNTAALLAEIEKIGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSALYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHPEAQFVIPGHGLPG-GLDLLKHTTNVVKAHTNRSVVE.................................... 266
43 -21.0002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  17  75.....................DADELLLIDT--KNTVALLAEIEKQGLPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVPAVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQRPEAEVVIPGHGLPG-GLELLQHTTNVVKTHKVRPVAE.................................... 265
44 -20.2004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  23  66..........GGAEAALE--EAARGPILVDTGPWAREALLGALAGQGVAVTLVVGTHGHSDHIGNLGLFPG---AALLVSHDFGRYLPHGLGEGQPLRLGP-GLEVWATPGHGGQRDVSVVGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVVAD--VVVPGHG.............................................................. 232
45 -19.8005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  19  47..............LWLLRDEIDGQ-TIVDCGISSEAIRTHWEQIFGLPVLRVLVTHCHPDHFGLANWLCERWNVRLWMTLGEYMFGCLMLREGDAVKIGARTWRVVTGYGHSPEHCALHSEADLISGDMVLPRISTNVSVPEANPLALYLESLGRYETMAPDTLVLPSHGVRTRIAQLRAHHDARLEEVRVACAEKPMSAAGIVPIMFRRRELDIHQMTFALGEA....... 332
46 -19.6003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  18  49.....................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHS.............................................................. 218
47 -19.5004tyf_A mol:protein length:231 NDM-4  ali model follow..  18  43.....................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHS.............................................................. 212
48 -19.4004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  18  55.....................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAPKASMIVMSHS.............................................................. 224
49 -19.2005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  18  55.....................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHS.............................................................. 224
50 -19.1004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  18  58.....................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHS.............................................................. 227
51 -19.1003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  18  56.....................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHS.............................................................. 225
52 -18.7004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  18  82.....................DGGRVLVVDT--DQTAQILNWIKQENLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLANGWVEPATAPNFGPLKVFYP--PGHTSDNITVGIDGTAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAPKASMIVMSHS.............................................................. 251
53 -18.6004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  13  42.....................LDGTVVIVSSPFENTQTLMDWVAKTKPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKLFGGCMIK---PKELGYLGDANVKAWPDSARRLKKFDAKIVI-PGHG------------EWGGPEMVNKTIKVAEKAVGEMRL.......................... 250
54 -18.4001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  14  22..........QENSMVYFGA---KGVTVVGATWTTARELHKLIKRVRKPVLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMNVVHDGDFTLQEGKVRAFYA--PAHTPDGIFVYFPDELYGGCILK---EKLGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPLHGPELIDHYEALIKAAPQSS....................................... 228
55 -18.4003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  22  35............VYSILIEHAEGR--FLIDPIQEKHQTIPGALGLLGLEIDVVVNSHFHFDHCGGNKYFPH---AKKICHRSEVPQATFEGIDGDVDLARGVKL--ISTPGHSIGHYSLLVKPILFTIDAAYTQKSLETLCQAADPVAGVNSMRKKKLAEDHGAELMYSHD.............................................................. 253
56 -18.1003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  22  39............VWCYLLETEEGP--ILVDPKMTEEDRIVNILKRVGYELLYIISSHLHFDHAGGNGAFTN---TPIIVQRTEYEAANYKIIEGDYEVVPGVQL--LYTPGHSPGHQSLFIGSVLLTIDASYTKENFEDEVPF-DPELALSSIKRKEVVKKEKPIIFFGHD.............................................................. 240
57 -18.1002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  22  37............VWCYLLETEEGP--ILVDPKMTEEDRIVNILKRVGYELLYIISSHLHFDHAGGNGAFTN---TPIIVQRTEYEAANYKIIEGDYEVVPGVQL--LYTPGHSPGHQSLFIGSVLLTIDASYTKENFEDEVPF-DPELALSSIKRKEVVKKEKPIIFFGHD.............................................................. 238
58 -17.6002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  16  43............VSAYLIQCTDAT--VLYDYIGASECNLPERLRQLGLSISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDEFATADLVGRDERERELAPGVNLLNFGTGHASGMLGLAVPGFLLVSDACYTATNYGPPARRADTIGYDRTVSHRQYAESRSLTVLFGHD.............................................................. 260
59 -16.3003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  13  33.....................GTDGITIIGA--ETAETLYKEIRKVPLPINEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSPGDFNLQNGSIRAMYLEAHTKDGIFVYFPAELYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGEKVDSIIAGHDTPIHDVGLIDHYLTL............................................... 227
60 -13.1002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  15  29.IFHGYHTDEGSSYSYFIDDECP---TVIDSVKYPAEEWLSRIAACLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEH-LIVDDKYTLKIGKRTLKFIPVP-HWPDSTTYCPEDKIFSNDGFGQHYATSRRWAD-LFKEYTANI-EVASTVEIK-YILSAHGVSWRGDAMGLAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGAR........... 282
61 -12.8001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  17  33..........TTYNAYLVEDEKT---TLFDTVAEYKGELLCGIASV--KIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKA-QVVKHGETLSLGKRTVTFYETR-HWPDSMSWFADEKVISNDIFGQNIAASERFSD-AMREYYANIVNPYAPQTLKAIICPDHGVIFRGADQCTFAVQKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFR........... 278
62 -12.6002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  18  24.NYHGYTLQGTTYNAYLVCGDE--GVALIDNS-ELMARVEDALQQVGMRVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKG-MTVKTGDVLDLGGKTLTFLETP-HWPDSMTLLDEDGIFSNDAFGQHLCCPQRLDRDAARKFYANLITPLSKLVLKKFIAPSHGQIWTDPMKIIEAYT---GWATGMVDERVTVIYDTMHGSTRKMAHAIAEGAM........... 282
63 -12.6003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  14  45.........NLPTHPILI--QTAQYNLIIDA-VDEESHIIADLANYNLTIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDIKMQHSGGHSFGHTIITIESQVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPQQYWFLFYHDENYFAVKYSDDGENID.............................................. 268
64 -12.1004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  17  38.......ERGTTSNSYVIEGDKT---AIIDPPVESMKIYLEALQQTLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAGD-LPMRGKETLDLGK-VLKFLPIP-RWPAGLTYDVQTQIYTDKIFGAHICGDDVFDDNDQRYYFNCLMEKISDLQVRL-YAVGH............................................................... 231
65 -12.0001vme_A mol:protein length:410 Flavoprotein  ali model follow..  14  33.YFEAVWEIPEGI-AYLV--KLNGANVLIDGWGNYAKEFIDALSKIPKEITHIIVNHTEPDHSGSLPATLKTIGHDVEIIASNFGKR-TVVKDGEEREIGGKKFKFVMTP-HWPDTMVTYLDGILFSCDVGGGYLLPEVERYLPHVTKYIVTV-EKLSSLKIKA-LLPGHGWKKDPQRLLNHYVSVA---KGDPKKGKVTVIYDSMYGFVENVMKKAIDSLK........... 285
66 -11.8003g1p_A mol:protein length:258 Protein phnP  ali model follow..  12  32.......SPQYRRQPCSGVVKFNDAITLIDAGLHD-----LADRWSPGSFQQFLLTHYHMDHVQGLFPLRWGVGDPILFKHPGLLDFSHTVEPFVVFDLQGLQVTPLPL--HSKLTFGYLLSRVAWLSDTAGLPEKTLKFLRNNQPQVMVMDCSHPPRADAPRN-----HCDLNTVLALNQVIRSPRVILTHISHQFDAWLMEN---ALPSGFEVG................. 243
67 -11.6001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  18  34..........TTYNAYLIVDDKT---ALVDTVYEPKEELIAKLKQIPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDS-TIVKTGTSVSLGKRSLTFIEAP-HWPDSMTYVPEEALLPNDAFGQHIATSVRFDDDEAAKYYANILMPFSNLITKKLIAPSHG----WRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLV........... 277
68 -11.0004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  21  33..........SSYNSYLIREEKN---VLIDTVDHKSREFVQNLRNE--DIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDS-NVVKTGDTLDIGN-QLIFVETP-HWPDSMTYLTGDAVFSNDAFGQHYCDEHLFND-QCQRYYANILTPFSRLVTPKIIATSHG----WRDNPTQIVELYLKWAADYQEDRITIFYDTMSNNTRMMADAIAQGIA........... 273
69 -10.5003x2x_A mol:protein length:227 UPF0173 metal-dependent hydrolase TM_1162  ali model follow..  12  7.............LGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGL-PKIDYILVTAGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYTPAVHGSGILDGDSMIYGGNPS----GFLITIEGKKIYHAGDTGLTRE--MELLAEENVDVAFLPIGGNMDVEDAVRAAVMIKPKKVVPMHYGTWELIFAD............................. 201
70 -10.4003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  14  37....................TYDNHSIQVDPVSEYADYT---------KADIILITHEHGDHLDPKAIQAVEKSDTEIIANENSQKKKVLKNGDTDTSISYMKIEAVPA-GYIDGLRVYIAGDTEDIPEMKDLKDIDIAFLPVNQPYTMTVSQAAKAARMFSPKILYPYH............................................................... 203
71 -10.3004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  13  56.........DMAINILLV--KTKEKLILMDT--ERTGFLLKSLQKAGFSITDIFLSHAHPDHIGGVVDKQNKLVFPNASIFISKIEHDKFYDLNKTLYSH---FNFQLAPGHTPGLTVTTISSGMYVADLIHSDVILSGDTDLDIATASRKKFLKQLAD--TKARAFTSH............................................................... 269
72 -10.2001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  18  92.......PLETSVTGYLV--NTGSKLVLVDT--PTLGRLAANLKAAGYQVDEIYITHMHPDHVGGLMVGEQLANAVVRADQKEADFW-KPFSGNTDLVPG---IKALASHGHTPGHTTYVVESQALLGDLILVAAVQQLDSDSKSVAVERKKAFADAAK--GGYLIAASH............................................................... 302
73 -10.1004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  22  86.........QTAVNAYLI--NTGDNLVLIDT--PTLGVVQTNLKASGYQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFW-KPYKTEGELLPG---VSLVASSGHTPGHTSYLFKSGLVWGDILINHAVQEFDVDSDQARQSRQRILAEAAT--DKLWVAGAH............................................................... 294
74 -10.1004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  23  86.........QTAVNAYLI--NTGDNLVLIDT--PTLGVVQTNLKASGYQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFW-KPYKTEGELLPG---VSLVASPGHTPGHTSYLFKSGLVWGDILLNHAVQEFDVDSDQARQSRQRILAEAAT--DKLWVAGAH............................................................... 294
75 -10.0001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  14  33........AGEATSGYLFEHDGFR--LLVDGVLAQLQKYITPSD-----IDAVVLSHYHHDHVADIGVLQTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTV-HPVTCFAMRITAGVYSADSFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAK................................................ 244

FFAS is supported by the NIH grant R01-GM087218-01
1 0 9 9 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.