current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4zo2_A mol:protein length:294 Acylhomoserine lactonase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst DDLSGFKKIKLGELELFILTDGYIHEENLISFAPRGNVAELKTILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIFADERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLVFPNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNKTLYSHFNFQLAPGHTPGLTVTTISSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKVKAPGFEWIPESFMNLast
1 -117.0004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model  100  1DDLSGFKKIKLGELELFILTDGYIHEENLISFAPRGNVAELKTILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIFADERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLVFPNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNKTLYSHFNFQLAPGHTPGLTVTTISSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKVKAPGFEWIPESFMN 294
2 -103.0004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  23  1KQVAGYYQYQAGDVQITALLDGTNFMSP--NLFKDIPQQQVHEILKKYYADQEKVQTSINAFLVNIGKSLILIDSGAASCFGSHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISK-DGVANFPNATVYVSNDEASFWLDPKQAAKLPKEKQ---ANYLGTVEKIKQAIAPYKQRFKTYKLG-DDIQGFKVINTAGHTPGHFSYELKTKGESIVFIGDIVHSHTVQFDRPETAIEYDIDPKKAVETRLKQFANFAKNGQTIAAPHLPFPGIGHTYSDGKSYQWIPIHFKD 291
3 -101.0004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  28  32TQVPGYYRMALGDFEVTALYDGYVDLPAS--LLKGIDDKDLQSLLARMFVASEKVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEAT-------MAKAPEGMQGMFKMAQQAVAPYMNKLKPYKTEGELLPGVSLVASPGHTPGHTSYLFKSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVPVEFS. 318
4 -101.0004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  27  32TQVPGYYRMALGDFEVTALYDGYVDLPAS--LLKGIDDKDLQSLLARMFVASEKVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEAEFWLDEAT-------MAKAPEGMQGMFKMARQAVAPYMNKLKPYKTEGELLPGVSLVASSGHTPGHTSYLFKSGGQSLLVWGDILINHAVQFAKPEVVWEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVREEAQGYAWVPVEFS. 318
5 -97.4001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  25  42TSAPGYYRMLLGDFEITALSDGTVALPVD--KRLNQPAPKTQSALAKSFQKAP-LETSVTGYLVNTGSKLVLVDTGAAGLFGPTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMV-GEQLAFPNAVVRADQKEADFWLSQTNLDKAPD------DESKGFFKGAMASLNPYAGKFKPFSGNTDLVPGIKALASHGHTPGHTTYVVESQGQKLALLGDLILVAAVQFDDPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIAASHLSFPGIGHIRAEGKGYRFVPVNYS. 326
6 -77.1003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  16  1........MKIGDISIHYLNGGNTKMDGGAMF--GVVPKPLWSKQYNAN-ERNQINLPTHPILIQTAQYNLIIDAGIGNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKS---------------TYWDKNKGDYSNKLILFEKHFEPVPGIKMQHSGGHSFGHTIITIESQGDKAVHMGDIF--PTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAYI..... 271
7 -52.4001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  15  3..................................SDKIMELKILVTNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNL----SSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNS------VLFENATFYVHEVYKTKNYLSFGTIVGRI---------------YSKVISSWKNVVLLKGEESLFDEKVKVFHTPWHAREHLSFLLDTENARVLITGDITPNR---------LSYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPL...................... 209
8 -49.8004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  19  7.CGASPLLVPGDPYSVVVLLQGYAEPEGVGDAVRADGSVTLVLGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPW----AREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNL------GLFPGAALLVSHDFCLPG-------------------------------GRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGTALVVVAGDVFERD----GDEDSWQALSEDPAAQERSRKRVLVVAD----VVVPGHGP-----RVLREASQPETEGGGNS. 252
9 -46.8003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  17  1..........MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEV--------------RFPVYSILIEHAEGRFLIDTGYDYDIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGN------KYFPHAKKICHRSEVPQACNPQPFEHLDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEPRRKPILFTIDAAYTQK----ETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDM---FKTYRTGTQFYG........ 268
10 -41.6003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  18  2.......RISMTVKKLYFIPAGRCMLD--------------HSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLIVNILKRVGYEPDDLLYIISSHLHFDHAGGN------GAFTNTPIIVQRTEYEAALHREE---------------------YMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIEEQSGSVLLTIDASYTKEFEDEVP----FAGFDPELALSSIKRLKEVVKKEKPIIFFGH......................... 239
11 -41.3002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  18  1........MDMTVKKLYFIPAGRCMLD--------------HSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLIVNILKRVGYEPDDLLYIISSHLHFDHAGGN------GAFTNTPIIVQRTEYEAALHREE---------------------YMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKEQSGSVLLTIDASYTKEFEDEVP----FAGFDPELALSSIKRLKEVVKKEKPIIFFGH......................... 237
12 -40.6002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  15  2............GNKLFVLDLGEIRVDENFII-----ANSTFVTPQKPTVSSRLIDIPVSAYLIQCTDATVLYDTGCHPECMGTNGRLPERLRQLGLSPDDISTVVLSHLHNDHAGCV------EYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWLATPRN-------WDLVGRDERERELAPGVNLLFGTGHASGMLGLAVREKQPGFLLVSDACYTAT-NYGPPARRAGVLHDTIGYDRTVSHIRQYAESRSLTVLFGHDR---FASLIKSTDGF......... 274
13 -30.9002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  12  1..........MGSSSSGLVPRGSHMLRLSAPGQLDDDLCLLGD-------------VQVPVFLLRLGEAWALVEGGIS----RDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLL-----CPRLPNVQVLASERTCQAWKSESAVRVVERLNRQLLRAEQRL----PEACAWDALPVRAVADGEWLELGLQVIEAHGHSDDHVVFY--DVRRRRLFCGDALGEFDEAEGVWRPLVFDDMEAYLESLERLQRLP----TLLQLIPGH......................... 235
14 -29.0001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  21  38..........................................................LTALLVQTPDGAVLLDGGMPQ----MASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRT---GAKVAANAESAVLLARGGSDDLHFGDGITYPPANAD----------------RIVMDGEVITVGFTAHFMAGHTPGSTAWTWTDTRNRIAYADSLSAPGYQLQGNPR----YPHLIEDYRRSFATVRALPCD---VLLTPH......................... 225
15 -28.9004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  20  58..........................................................ISALLVTSDAGHILVDAATPQ----AGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKAT---GAPVYARAPAIDTLKRGLPDRTDPQFEVAEP---------------APVANIVTLADDGVVSVGLTAVASPGHTPGGTSWTWEGDDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARVAALDCD---ILVTPH......................... 250
16 -28.8003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  22  55..........................................................IAVYVIKTSQGLILMDTAMPQ----STGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKET---GAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKVD----------------RAVKEGDRVTLGLTAHATPGHSPGCTSWEMTVKDGEVLFFCSGTVALNRLVGQPTY-------AGIVDDYRATFAKAKAMKIDVLLGPH......................... 242
17 -28.6005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  18  30.........................................................GLSSVLVTSPQGHVLIDGGLPE----SAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRS---NALVAASPSAALDLASGEVGPDDPQYHALPK---------------PPVKDMRLARDGGQFNVGLTAHATPGHTPGGLSWTWQSCDGNMVYADSI------AVSRPGFKFSASSEYPNALADLRHSFETLEKLPCVLISAH......................... 223
18 -28.5004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  20  58..........................................................ISALLVTSDAGHILVDAAT----PQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKAT---GAPVYARAPAIDTLKRGLPDRTDPQFEVAEP---------------APVANIVTLADDGVVSVGLTAVASPGHTPGGTSWTWEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCD---ILVTPH......................... 250
19 -28.4005aeb_A mol:protein length:272 LRA-12  ali model follow..  14  35.......................................................TYDLACYLITTKQGNIIVNTGLAA----SALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKIT---GAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIA----------------RLLHDKDTIQLGLVMLHHPGHTKGSCSFLFDTKDERILIANMPTIVIEKKFSE------VSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKS..... 247
20 -28.1001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  17  24.........................................................DLASYLIVTPRGNILINSDLEA----NVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQT---KAKYMVMDEDVSVILSGGKSDFHYANDSSTYFTQSTV---------------KVLHDGERVELGLTAHLTPGHTRGCTTWTMKLKDHGKQ--YQAVIIGSIGVNPGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVLLSKGQNNP..... 235
21 -28.0003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  14  20..........................................................ATVYVMCGEKLTVMIDAGVSNSIAD-------------SFLDKLDYIVLTHLHIDHIGLLPE----LQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKLD--QDKVIEVEGNEEFDLGMRLIYTPGHARHHMSVLV----DDFLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKV-----VGFAHGGLVSPKIMEE.............. 218
22 -28.0003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  16  25.........................................................GISAVLLSSPQGHILVDGTTEK----GAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLT---GATVLAGAANVDTLRTGVSPKSDPQFGSLSN---------------PGSAKVRAVADGELVKLGVKAHATPGHTEGGITWTWQSCEQDVVFADSLTAVSADSYRFSDH-------PEVVASLRGSFEAVEKLSCDIAIAAH......................... 215
23 -25.1002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  17  2......................................KALLPGLYLLPVPIPYPLKTVNLYLLQGAGEVALVDTALGT--RAARGALELHLAELGLCFQDVKTILLTHHHPDHYGGFFEGLG------ARVFLHEEEFAFWREPEAFAEASWRLFLDHGTPEGALQGIRETVEKTRERVHPPQNPLPLRDGLRVLWTPGHADGHAAFYLEE--EGVLLAGDAL----LEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGH-PIADV................... 240
24 -23.3002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  24  10.......................................................PLQENAYLVETGEGPVLIDPG------DEPEKLLALFQTTGLIPLAI---LLTHAHFDHVGAVAPLVEALDLP---VYLHPLD-LPLYEGADLAARAWGLAIPKPPLPV----------------RPLEEGMRLF-GFQVLHLPGHSPGHVAFYDPE--GAQVFSGDLLFRGSVG--RYDLPGA---DPKALFASLKRLLS--LPPETRVHPGHGPGTTLGLEARTNTGLEW....... 205
25 -22.2005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  11  2...............AMNALEHQLDYPFADTLPAAGDTFEVAPGVRWLRMPLPFSLDHINLWLLRGQAGWTIVDCGISS---EAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGNWLCEGGDQGRWNVRLWMTLGEYMMAAGNGSNAGGAAAAPAALDKLRSRRSYYSDLVPAVPPRYRRLREGDAVKIG-RVVTGYGHSPEHCALH--SEADGVLISGDMV-LPRISTNVSVFDLEPEANPLALYLESLGRYETMAPDTLVLPSHGKPFRGV................... 278
26 -21.1004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  18  31GEYPTVNEIPVGEVRLYQIADGV--------------------WSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA---KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGV--------------VLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVR---GPVELFYPG------------AAHSTDNLVVYVPS--ANVLYGGCAVLELSS----TSAGNVADADLAEWPTSVERIQKHYPEAEVVI-------PGHGLP................ 243
27 -20.8005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  19  13GEYPTVNEIPVGEVRLYQIADGV--------------------WSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA---KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGV--------------VLRKAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVR---GPVELFYPG------------AAHSTDNLVVYVPS--ANVLYGGCAVLAL----SRTSAGNVADADLAEWPTSVERIQKHYPEAEVVI-------PGHGLP................ 225
28 -20.5002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  18  31GEYPTVSEIPVGEVRLYQIADGV--------------------WSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGA---KNTAALLAEIEKQIGLP--VTRAVSTHFHDDRVGGV--------------VLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVR---GPVELFYPG------------AAHSTDNLVVYVPS--ASVLYGGCAIYEL----SRTSAGNVADADLAEWPTSIERIQQHYPEAQFVI-------PGHGLP................ 243
29 -20.5002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  17  30GEYPTVDDIPVGEVRLYKIGDGV--------------------WSHIATQKLGDTVYSSNGLIVRDADELLLIDTAWGA---KNTVALLAEIEKQIGLP--VTRSISTHFHDDRVGGV--------------VLRAAGVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVVR---GPVEVFYPG------------AAHSGDNLVVYVPA--VRVLFGGCAVHEASR----ESAGNVADANLAEWPATIKRIQQRYPEAEVVI-------PGHGLP................ 242
30 -20.4002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  17  1............................................MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPG------GDAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHYGVP---VIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPD----------------RWLNDGDRVSVGLQVLHCPGHTPGHVVFF--DEQSQLLISGDVIFKGGVG--RSDFPRGDHTQLIDAIKRKLLPLG----DDVTFIPGHGPLSTLGYERLHN............ 205
31 -19.9002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  20  1...KTVIKNETGTISISQLNKNV--------------------WVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDD---KLTKELIEMVEKKFQKR--VTDVIITHAHADHIGGI------KTLKERGIKAHSTA-----------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPG------------KGHTEDNIVVWLPQ--YNILVGGSLVKSTSA----KDLGNVADAYVNEWSTSIENVLKRYRNINAVV-------PGHGEVGDKG............ 212
32 -19.4003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  18  1...KTVIKNETGTISISQLNKNV--------------------WVHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDD---KLTKELIEMVEKKFQKR--VTDAIITHAHADRIGGI------KTLKERGIKAHSTA-----------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPG------------KGHTEDNIVVWLPQ--YNILVGGCLVKSTSA----KDLGNVADAYVNEWSTSIENVSKRYRNINAVV-------PSHGEVGDKG............ 212
33 -19.2002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  19  4KVEKTVIKNETGTISISQLNKNV--------------------WVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDD---KLTKELIEMVEKKFQKR--VTDVIITHAHASRIGGI------KTLKERGIKAHSTA-----------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPG------------KGHTEDNIVVWLPQ--YNILVGGCLVKSTSA----KDLGNVADAYVNEWSTSIENVLKRYRNINAVV-------PGHGEVGDKG............ 218
34 -19.1004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  17  6............ELRIEKVKENIF-------------------LHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSD---RDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGI------KWLNDQSISTYATT---------------------STNHLLKENKKEPAKYTLKGNESTLVDGLIE---VFYPGGGHTIDNVVVWLPK--SKILFGGCFVRSLDS----EGLGYTGEAHIDQWSRSAQNALSRYSEAQIVI-------PGHGKIGDIA............ 207
35 -18.9001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  4.......................................SLTQVSGPVYVVEDNYYVQENSMVYFGAKGVTVVGATWTP---DTARELHKLIKRVSRKP--VLEVINTNYHTDRAGG------NAYWKSIGAKVVSTRQTRDLMKSDWAEIVAFTRKGLPEYPDLPLVLPNVV--HDGDFTLQEGKVRAF-----YAGPAHTPDGIFVYFPD--EQVLYGGCILKEKLGNLS--------FADVKAYPQTLERLKAMKLPIKTVI-------GGHDSPLHGPELID........ 215
36 -18.8004tyf_A mol:protein length:231 NDM-4  ali model follow..  16  1....GPGDQRFGDLVFRQLAPNVW-------------------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTD---DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMD-------------ALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGW-----VEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP................ 214
37 -18.7002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  14  1................................MRGSGSVEVQVLIENVVFARNFVAEHGLSLLLKKGNKEIVVDTGQSEN-------FIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKG----ERNPEVKIYTHK------------EILNKKYAMRKGGQFEEIGFDLSFYEKYKNNFVLIDKDAEIEEGFYVITTYDNEFTTKNFFVEKEGK--RIPDKFLDEVFVVVKEEDGINVVTGCSHAGILNILETARNRFGVSSLIGGFHLRGMEEEKVKDIARKIE........ 238
38 -18.7004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  16  49...........................................................NGLIVRDGGRVLVVDTAWTD---DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGM--------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW-----VEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGAADTEHYAASARAFGAAFPKASMIV-------MSHSAP................ 226
39 -18.5002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  15  17...................................................NPARNIDFNGFAWIRPEGNILIDPV------ALSNHDWKHLESLG----GVVWIVLTN--SDHVRSAKEIADQT---YTKIAGPVAEKENFPIYCD---------------------------------RWLSDGDELVPGLKVMELQGKTPGELALLLEET---TLITGDLVRAYRAGGLEILPDEKL-MNKQKVVASVRRLAALEKVEAV--------LVGDG.................. 182
40 -18.5004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  16  52...........................................................NGLIVRDGGRVLVVDTAWTD---DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMD-------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW-----VEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP................ 229
41 -18.4005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  16  49...........................................................NGLIVRDGGRVLVVDTAWTD---DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMD-------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW-----VEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP................ 226
42 -18.3003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  16  43...........................................................NGLIVRDGGRVLVVDTAWTD---DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMD-------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW-----VEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP................ 220
43 -18.3003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  16  32...........................................................NSMYLVTKKGVVLFDVPWEK---VQYQSLMDTIKKRHNLP--VVAVFATHSHDDRAGDLS-------------FFNNKGIKTYATAKTNEFLKKDGKATST--------------------EIIKTGKPYRIGGEEFVVEGHTADNVVVWFPK--YNVLDGGCLVKSNSA----TDLGYIKEANVEQWPKTINKLKAKYSKATLII-------PGHDEW................ 203
44 -18.1004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  18  6............DLKIEKLDEGVY-------------------VHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTA---KDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGI------EWLNSRSIPTYASE------------LTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPG------------PGHTPDNVVVWLPE--RKILFGGGFIKPYGLGN---------DANIEAWPKSAKLLKSKYGKAKLVV-------PSHSEV................ 200
45 -18.1003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  10  2..................................SEKNLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTP---ETAETLYKEIRKVSPLP--INEVINTNYHTDRAGG------NAYWKTLGAKIVATQ----MTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLTVFPGDFNLQNGSIRAM-----YLGEAHTKDGIFVYFPA--ERVLYGNCILKENLGNMS--------FANRTEYPKTLEKLKGLIEQGEL---KVDSIIAGHDTPIHDVGLID........ 222
46 -18.1001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  17  10............DISITQLSDKVY-------------------TYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPIND---AQTEMLVNWVTDSLHAK--VTTFIPNHWHGDCIGGL--------------YLQRKGVQSYANQMTIDLAKEKGLPVPEHG-------------FTDSLTVSLDGMPLQ---CYYLGGGHATDNIVVWLPT--ENILFGGCMLKDNQT----TSIGNISDADVTAWPKTLDKVKAKFPSARYVV-------PGHGNY................ 209
47 -18.0002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  18  6............PLEVIKIEDGVY-------------------LHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLL------LSWATDRGYQVMASISTHSHEDRTAGI------KLLNSKSIPTYTSE------------LTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPG------------AGHTEDNIVAWLPK--SKILFGGCLVRSHEW----EALGYVGDASISSWADSIKNIVSKKYPIQMVV-------PGHGKVGSSD............ 207
48 -18.0001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  17  10............DISITQLSDKVY-------------------TYVSLAEIEGWGMVPSNGMIVINNHQAALLDTPIND---AQTETLVNWVADSLHAK--VTTFIPNHWHGDCIGGL--------------YLQKKGVQSYANQMTIDLAKEKGLPVPEHG-------------FTDSLTVSLDGMPLQ---CYYLGGGHATDNIVVWLPT--ENILFGGCMLKDNQA----TSIGNISDADVTAWPKTLDKVKAKFPSARYVV-------PGHGDY................ 209
49 -18.0003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  16  50...........................................................NGLIVRDGGRVLVVDTAWTD---DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGMD-------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW-----VEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP................ 227
50 -18.0004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  16  48............DLVFRQLAPNVW-------------------QHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTD---DQTAQILNWIKQEINLP--VALAVVTHAHQDKMGGM--------------ALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW-----VEPATAPNFGPLKVF-----YPGPGHTSDNITVGIDG--TDIAFGGCLIKDSKA----KSLGNLGDADTEHYAASARAFGAAFPKASMIV-------MSHSAP................ 253
51 -17.9001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  15  1............DVKIEKLKDNL--------------------YVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGE---DKFKSFTDEIYKKHGKK--VIMNIATHSHDDRAGGLE-------------YFGKIGAKTYSTKMTDSILAKENKPRAQYT-------------FDNNKSFKVGKSEFQ---VYYPGKGHTADNVVVWFPK--EKVLVGGCIIKSADS----KDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVV-------AGHDDWKDQR............ 203
52 -17.7004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  17  7............DLKIEKLEEGVY-------------------VHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTA---TDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGI------EWLNSQSIPTYASE------------LTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPG------------PGHTQDNVVVWLPE--KKILFGGCFVKPDGLGN---------DANLEAWPKSAKILMSKYVKAKLVV-------SSHSEI................ 201
53 -17.5005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  18  23............PLEVIKIEDGVY-------------------LHTSFKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLL------LSWATDRGYQVMASISTHSHEDRTAG------IKLLNSKSIPTYTSE------------LTKKLLAREGKPVPTHYFKDDEFTLGNGLIELYYPG------------AGHTEDNIVAWLPK--SKILFGGCLVRSHER----EGLGYVGDASISSWADSIKNIVSKKYPIQMVV-------PGHGKVGSSD............ 224
54 -17.5004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  14  2..........................PKSSDHVDLPYNLTATKIDSDVFVVTDRDFYSSNVVAKMLDGTVVIVSSPFEN---LGTQTLMDWVAKT--MKPKKVVAINTHFHLDGTGGNEIYKKM----GAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVP---ADNVFDLKQGKVFSFSNELVEVPAHSPDNVVVYFPK--KKLLFGGCMIKPKELGY------------GDANVKAWPDSARRLKKFDAKIV-----IPGHGEW................ 228
55 -16.5004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  24  13.....................................SNRVVRVLGCN--PGPMTLQGTNTYLVGTGPRRILIDTG-EPAIPEYISCLKQALTEFN---TAIQEIVVTHWHRDHSGGI--------------------------GDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGLRVLYTPGHTDDHMALLLEE--ENAIFSGDCI----------GEGTTVFEDLYDYMNSLKELLKIKAD---------IIYPGHGPVIHNAEAK......... 210
56 -15.8001zkp_A mol:protein length:268 hypothetical protein BA1088  ali model follow..  14  36.........................................................ATSGYLFEHDGFRLLVDCGSGVL-----AQLQKYI-----TPSDIDAVVLSHYHHDHVADIGVLQYARLITSAT---QLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTV----------------HPVTCFAMRITAGNDIVVYSADSTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPFSGHITLAHSGYVWN........ 261
57 -15.4001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  14  16......................................................................LVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK---VKLESGLKVYGGD-------------------------------------DRIGALTHKITHLSTLQVGVKCLATPCHTSGHICYFVGGSEPPAVFTGDTLFVAGCG---------YEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARH.............. 185
58 -14.6003h3e_A mol:protein length:267 uncharacterized protein Tm1679  ali model follow..  11  1................................MGSDKIMRIHVLCDDSSQNGFESEHGFSVLV-----DSVLFDTGKSDV-------FLKNARKLGIDL--PKDVLISHGHYDHAGGLLYLSGKRVWLRKEALDQK------------------------SGERYAGADWNEVLYYNTGKFVIERITEIGKNMFLLGPANLRGKVPTGDFFVERNGERRKDLFEDEQTLVVRTKEGLVVITGCSHRGIDNILLDIAETFNERIVVGGFHLLKSSDDEIEKIVKAFN........ 219
59 -14.6002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  13  22.......................................................EVGRSCIILEFKGRKIMLDCGI-----PGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATK-------AIYRWLLSDYVKVSNISADDMLYTETDLEESMDKIETINFHEVKVAGIKFWCYAGHVLGAAMFMIEIAGVKLLYTGDFSRQEDRHLMAAEIESTYGTHIHEKREEREARFCNTVHDIVNRGGR-IPVFALGRAQE.............. 248
60 -14.3002dkf_A mol:protein length:431 metallo-beta-lactamase superfamily protein  ali model follow..  13  15...........................................................SAHLLLAGGRRVLLDCGM------QGKEEARNHAPFGFDPKEVDAVLLTHAHLDHVGRL-----------PKLFREGYRGPVYATRATVLLMEIVLEDALKVMDEPFFGPEDVEEALGHLRPLEYGEWLRLGALSLFGQAGHLPGSAFVVAQGEGRTLVYSGDLGNREKDVLPDPSLPPLADLPYRETVREFLEILEKTLSQGGKVL---IPTFAVERAQE.............. 230
61 -14.2002ycb_A mol:protein length:636 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  15  190.......................................................EVGRSCLYLQTPNSRVLLDCGV-NVAGGDDKNSYPYLNVPEFTLDSLDAVIITHAHLDHSGFL-----------PYLYHYGYDGPVYCTAPTRDLMTLLQLDHIDIAHREDEPLPFNVKHVKKSVKHYGEVTDIAPDIRLLHNAGHILGSAMAHLGDGQHNMVYTGDFKYEQSRLLEAAESTYGGHEDVQPSRNRAEKELVKTIYSTLRRGGK-IPVFAVGRAQE.............. 423
62 -14.0003af5_A mol:protein length:651 Putative uncharacterized protein PH1404  ali model follow..  12  199.......................................................EVGRSALLVQTDESFVLVDFGVNVAMLNDPYKAFPHFDAPELREGLLDAIIITHAHLDHCGMLPYLFRYNLFDGPIYTTPPTRDLMVLLQKDFIEIQQSNGQDPLYRPRDIKEVIKHTITLD-----YGEVRDISPDIRLLHNAGHILGSAIVHLGNGLHNIAITGDFKFIPTRLLEPANAKFDIQMPREEAEKRLIEVIHNTIKRGGKVL---IPAMAVGRAQE.............. 438
63 -13.8002i7x_A mol:protein length:717 Protein CFT2  ali model follow..  13  1............................................MTYKYNCCDDGSGTTVGSVVRFDNVTLLIDPG----WNPSKVSYEQCIKYWEKVIPEIDVIILSQPTIECLGALYYNFTSHFISRIQVYATLPVINLGRVSTIDSYASAGVIGPYDTNKLDLEDIEISFDHIVP---KYSQLVDLRSGLTLLANAGVCPGGSIWCISTYSEKLVYAKRWNHTRDNILNAASITTLDRFGSSQPFKKRSKIFKDTLKKGLSSDGS-IPVDMSGKFLD.............. 256
64 -13.6001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  18  20................................................................EDTGTVGVVDPS-------EAEPIIDSLKRSGR---NLTYILNTHHHYDHTGGNLELKDRY---GAKVIGSAMDKD----------------------------------RIPGIDMALKDGDKWMFAVHVMDTPGHTKGHISLYFPG--SRAIFTGDTMFSLSCG---------FEGTPKQMLASLQKI--TSLPDDTSIYCGH......................... 169
65 -13.6003g1p_A mol:protein length:258 Protein phnP  ali model follow..  11  2............SLTLTLTGTGG---------AQGVPAWGCECAACARARRSPQYRRQPCSGVVKFNDAITLIDAGL-------------HDLADRWSPGSFQQFLLTHYHMDHVQGLFP------------WGVGDPIPVYGPPDEQGCDDLFKHPGLLDFSHTVEPFVVF-----------------LQGLQVTPLP-HSKLTFGYLLETAHSRVAWLSDTAGLPEKTLK.............................................................. 174
66 -13.5004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  14  36...................................................................DSVLDYDPKSGRTCSASADRLVERVNELNA---SVRWVLETHVHADHLSALKEKLGGHTAIGAHI-----------------------TQVQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGARALHTPGHTPACMSFMIEDAGEIAVFVGDTLFMPDYGTARCDFPGA---DARTLYRSIRRLLAFPDQTRLFMCHDYLP....................... 216
67 -13.3002xr1_A mol:protein length:640 CLEAVAGE AND POLYADENYLATION SPECIFICITY FACT  ali model follow..  16  194.......................................................EVGRSCFLLSTPESRILIDCGVNV--GSDENMTPYLYVPEVFPLNQIDAVIVTHAHLDHQGLV-----------PLLFKYGYEGPVYCTPPTRDLMVLLQLDYIDVAAKEGKKIPYESGMVAKTLKHYEEVTDIAPDIKLFHNAGHILGSAIFHIGDGLHNVVFTGDYKYEKTRLFDPAVNKFPFQPALKDAEKHLQMVVKNTIERGGIAV---IPAFAVGRSQE.............. 426
68 -13.1002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  14  36............................................................SYLIHTTHTLAAVDVNADY--KPILTYIEEHLKQQGNADVTFSTILSTHKHWDHSGG-----------------------------NAKLKAELEAMNSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHNDGVALFTGDTMFIAGIG---------FEGDEKDMCRAMEKVYHIALDKVTFIFPGH......................... 220
69 -12.9002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  13  17.......................................................TIGGTVIEVAYKDAHIFFDFGTERPELDLPDDHIETLINNRLVPEQHTAVFLSHAHLDHSRMI-----NYLDPAVPLYTLKE--------------TKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGVEIVPVDHDAYGASALLIRTPDHFITYTGDLRLH------------GHNREETLAFCEKAKHTELLMMEGVSIS............................ 221
70 -12.6004ojv_A mol:protein length:369 3`,5`-cyclic-nucleotide phosphodiesterase 1  ali model follow..  14  1..MVVFEITILGA-ELIAVDGGAGMYQLREMLVQGRNENEGDDELVPSFYSKLNIQKGLSKSLLQSLKRQGEHFESANT------------MKKTYEVFQGITDYYITHPHLDHISGLVNSKKKTIWGLPHTIDVLQKHVFWPDLTAERSRKLKLKCLNPKEVQKCTIFPWDVIPF-----------KVHHGIGVKTGAPVYSTFYIFRDRKSKDCIIVCGDVEQDRRESEESLLEEFWSYVAENIPLVHLKGILVECSSSKPEQLYGHL........................ 295
71 -12.3001ww1_A mol:protein length:280 tRNase Z  ali model follow..  13  6......................................................FSKALFSTWIYYSPERILFDAGEGVS------------TTLGSKVYAFKYVFLTHGHVDHIAGLWGVVNIRNNPEGFIKRANPDLRFSFNVHPLKEGERVFLRNAGGFKRYVQPTKHVSSEVSFGYHIFEVRRKLKKEFQGLDSK-KEKGRDFVTEEYHKKVLTISGDSLALDPEEIRGTELLIH--LDARDRRYKNHAAIDEVMEGVKKVILYHIS....................... 246
72 -12.3003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  15  14........................................................LAHASYLVQETGEACVIDP-----------DVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRA---GAAICVSDEGPPEWKSEYVKAYP----------------------------HRLLKDGDELHFGIVVMHTPGHTPEHVSYLLYDGKTS-LFSGDFVFVGDVG--RPDLLERVAGESGSSEALARQMFRSLRK--EALPDHVQVLPAHGAGSACGKALGAVPSS... 215
73 -12.3002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  14  1........................................MKLLFRQLFENESSTFTYLLADVSHPDKPALLIDP-------KTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGLKTKLPGVKSVISKASGSKAD------------------------------------------LFLEPGDKVSIGLEVRATPGHTAGCVTYVTGEGADRMAFTGDAVLIRGCG--------RTDFQEGSSDQLYESVHSQIFTKDTLIYPAH......................... 183
74 -11.9004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  12  41........................................................TTSNSYVIE-GDKTAIIDPPVESFMKIYLEALQQTV-----NLKKLDYVILGHFSPNRIPTFKA----ELAPQITFVCSLPAAGD---------------------------LRAAFPDDNLNILPMRGKETLDLGLKFLPIP-RWPA--GLCTYDVQTQILYTDKIFGAHICG------DDVFDDNWESFKEDQRYYFNCLALEKISDLQVRLYAVGHGPLVRTS............ 238
75 -11.9004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  13  14....................................................EPVSCTFTYLLGDESREAVLIDP-------ETAPRDAQLIKELGLR---LLYAVNTHCHADHITGLRSLLPGCQSVISRLSGAQAD------------------------------------------LHIEDGDSIRFGLETRASPGHTPGCVTFVL--NDHSMAFTGDALLIRGCG--------RTDFQQGCAKTLYHSVHEKIFTGDCLIYPAH......................... 179

FFAS is supported by the NIH grant R01-GM087218-01
1 1 4 9 7 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Igarashi Y, Eroshkin A, Gramatikova S, Gramatikoff K, Zhang Y, Smith JW,Osterman AL, Godzik A. CutDB: a proteolytic event database. Nucleic Acids Res. 2007 Jan;35(Database issue):D546-9. Epub 2006 Nov 16.