current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 5a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst GPSPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVAELast
1 -103.0005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model  100  1GPSPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRKAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRSVAE 248
2 -97.4004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  97  19VASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVAE 266
3 -97.0002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  91  19IASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE 266
4 -96.4002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  77  18VLGSAAYSAQPGGEYPTVDDIPVGEVRLYKIGDGVWSHIATQKLGDTVYSSNGLIVRDADELLLIDTAWGAKNTVALLAEIEKQIGLPVTRSISTHFHDDRVGGVDVLRAAGVATYTSPLTRQLAEAAGNEVPAHSLKALSSSGDVVRFGPVEVFYPGAAHSGDNLVVYVPAVRVLFGGCAVHEASRESAGNVADANLAEWPATIKRIQQRYPEAEVVIPGHGLPGGLELLQHTTNVVKTHKVRPVAE 265
5 -92.6003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  34  1..........SNANYMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR...... 237
6 -92.4005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  33  1....MGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRLE.... 245
7 -92.2004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  34  1.GSHMGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR...... 246
8 -92.1004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  33  1....SNAIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGAADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR...... 243
9 -91.2003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  32  1...MPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRKLVPR. 249
10 -90.7004tyf_A mol:protein length:231 NDM-4  ali model follow..  35  1................GPGDQRFGDLVFRQLAPNVWQHTSYLDMPGGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR...... 231
11 -90.6002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  36  1.........ASQKVEKTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHASRIGGIKTLKERGIKAHSTALTAELAKKNG----YEEPLGDLQTVTNLKFGNVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK......... 228
12 -90.1002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  36  1...............KTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADHIGGIKTLKERGIKAHSTALTAELAKKNG----YEEPLGDLQTVTNLKFGNVETFYPGKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKGLLLHTLDLLK......... 222
13 -89.6004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  32  24SGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLRL..... 271
14 -89.6003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  37  1...............KTVIKNETGTISISQLNKNVWVHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDAIITHAHADRIGGIKTLKERGIKAHSTALTAELAKKNG----YEEPLGDLQTVTNLKFGNVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVSKRYRNINAVVPSHGEVGDKGLLLHTLDLLK......... 222
15 -89.3001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  26  1........................DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPR----AQYTFDNNKSFKVGKFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQKA. 221
16 -88.4001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  29  1...............AQKSVKISDDISITQLSDKVYTYVSLAEIEGGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWVTDSLHAKVTTFIPNHWHGDCIGGLGYLQRKGVQSYANQMTIDLAKEKG----LPVPEHGFTDSLTVSLDGLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGNYGGTELIEHTKQIVNQYIESTSK. 231
17 -88.4001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  30  1...............AQKSVKISDDISITQLSDKVYTYVSLAEIEGGMVPSNGMIVINNHQAALLDTPINDAQTETLVNWVADSLHAKVTTFIPNHWHGDCIGGLGYLQKKGVQSYANQMTIDLAKEKG----LPVPEHGFTDSLTVSLDGLQCYYLGGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGDYGGTELIEHTKQIVNQYIESTSK. 231
18 -88.3003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  27  1....................QVKDFVIEPPIKNNLHIYKTFGVFGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKAT----STEIIKTGKPYRIGGFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNK........ 218
19 -84.2004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  32  1...................NDEVPELRIEKVKENIFLHTSYSRVNGFGVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRK-NGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKE-----PAKYTLKGNESTLVDIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQ. 225
20 -82.7002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  33  1...................SQGHKPLEVIKIEDGVYLHTSFKNIEGGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFK-----DDEFTLGNIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQ. 225
21 -81.8004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  30  1..................AGARLPDLKIEKLEEGVYVHTSFEEVNGWGVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVE-RGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSF-----SGVSYWLVKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDG---LGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKK. 223
22 -81.7001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  25  1.......................AGMSLTQVSGPVYVVE-----DNYYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDLMKSDWAELPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCILKEK----LGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPHGPELIDHYEALIKAAPQSS... 228
23 -81.2005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  33  15................PALAQGHKPLEVIKIEDGVYLHTSFKNIEGYGVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATD-RGYQVMASISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFK-----DDEFTLGNIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQ. 242
24 -81.1004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  30  1...................AESLPDLKIEKLDEGVYVHTSFEEVNGWGVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVE-RGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFS-----GVNYWLVKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYG---LGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK. 222
25 -79.7003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  21  1....................MSEKNLTLTHFKGPLYIVED-----KEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKEN----LGNMSFANRTEYPKTLEKLKGLIEKVDSIIAGHDTPHDVGLIDHYLTLLEKAPK..... 233
26 -77.8004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  27  2.............PKSSDHVDLPYNLTATKIDSDVFVVT-----DRDFYSSNVLVAKMLDGVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKANVFDLKQGKVFSFSNVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKE---LGYLGDANVKAWPDSARRLKKF--DAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMR.. 249
27 -37.1002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  22  11................................................LQENAYLVETGEGPVLIDPGDE---PEKLLALFQTT-GLIPLAILLTHAHFDHVGAVAPLVEADLPVYLHPLDLPLYEGADLAPKPPLPVRPLEEGMRL---GFQVLHL-PGHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYD-LPGADPKALFASLKRLLSL-PPETRVHPGHGPGTTLGLEARTNPFLTGLEWEA... 207
28 -36.6001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  15  1.....AEVPLPQLRAYTVDASWLQPMAPLQIADHTWQI--------GTEDLTALLVQTPDGAVLLDGGM-PQMASHLLDNMKARTPRDLRLILLSHAHADHAGPVAELKRRGAKVAANAESAVLLARGGSDYPPANADRIVMDGEVITVGGIVFAHFMAGHTPGSTAWTWTDTRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRAL--PCDVLLTPHPGASNWDYAAGARAGAK......... 242
29 -36.2002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  18  5..........................SSGLVPRGSHMLLDDDLCLLGDVQVPVFLLRGEASWALVEGGISRD-AELVWADLCRADPSQVHYWLITHKHYDHCGLLPYLCPRNVQVLASERTCQAWKSESACAWDALPVRAVADGEWLELGPRHRLQVAHGHSDDHVVFYDVRRRRLFCGDALFDEAEGVWRPLVFDDMEAYLESLERLQRL-PTLLQLIPGHGGLRGRLAADGAESAYTECLRLCRR. 261
30 -36.2002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  15  6..............................HRPDLYSWSTFNPARN--IDFNGFAWIRPEGNILIDPVALSNHDWKHLESLGG-----VVWIVLTN--SDHVRSAKEIADQYTKIAGPVAEKENFPIY--------CDRWLSDGDELVPGLKVMELQG-SKTPGELALLLEE-TTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVRRLLEKVEAVLVGDGWSVFRDGRDRLKELVATL....... 200
31 -35.8002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  19  1...........................MKALLPGLYLLPVPIPYPLKTV--NLYLLQGAGEVALVDTALGTRAARGALELHLAELGQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHQGIRETVEKTRERVHPPQNPLPLRDGEALEVAGKRLVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAENPLKDFLRSLDRLADL--GARVAYAGHFGP--EELKAHHQARLEALLALLDGP 265
32 -35.8003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  17  13LLSTGAQAQTIKDFLAVAMKKWTAPFEPFQLIDNIYYV--------GTDGIAVYVIKTSQGLILMDTAM-PQSTGMIKDNIAKL--ADIKLILNTHAHLDHTGGFAEIKKEGAQLVAGERDKPLLEGGDLAFPAVKVDRAVKEGDRVTLGDTTLAHATPGHSPGCTSWEMTVKDVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAM--KIDVLLGPHPEVYG..................... 247
33 -34.5004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  15  16LSSTALASDAPASRGCADDAGWNDPAMPQKVYGNTWYV--------GTCGISALLVTSDAGHILVDAAT-PQAGPQILANIRALRPEDVRAIVLSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGAEPVAPVANIVTLADDGVVSVGPLALAVASPGHTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASGLWN-TACRRYAQGARQRLEKR 288
34 -34.4001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  10  5......................PNPFPPFRIAGNLYYV--------GTDDLASYLIVTPRGNILINSDLEAN-VPMIKASIKKLKFSDTKILLISHAHFDHAAGSELIKQQKAKYMVMDEDVSVILSGGKSDTQSTVDKVLHDGERVELGGTVLAHLTPGHTRGCTTWTMKLKDAVIIGSIGVNPGYKLVDNITPKIAEDYKHSIKVLESM--RCDIFLGSHAGMFD..................... 220
35 -34.3003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  15  6......................SSPQQPFTIYGNTHYV--------GTGGISAVLLSSPQGHILVDGT-TEKGAQVVAANIRAM--SDVKYILSTHSHEDHAGGISAMQKLGATVLAGAANVDTLRTGVSPFPGSAKVRAVADGELVKLGPLAVAHATPGHTEGGITWTWQSCEVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKL--SCDIAIAAHPEVND..................... 220
36 -34.3004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  15  16LSSTALASDAPASRGCADDAGWNDPAMPLKVYGNTWYV--------GTCGISALLVTSDAGHILVDAAT-PQAGPQILANIRALRPEDVRAIVFSHEHFDHAGSLAELQKAGAPVYARAPAIDTLKRGAEPVAPVANIVTLADDGVVSVGPLALAVASPGHTPGGTSWTWRDCRQMVYADSLTAISDDVFRYSDDGYLAAFRNTLARVAAL--DCDILVTPHPSASGLWN-TACRRYAQGARQRLEKR 288
37 -33.7005aeb_A mol:protein length:272 LRA-12  ali model follow..  11  2......MASQKVKEPTVSNADWSKPYRPFRIAGNLYYI--------GTYDLACYLITTKQGNIIVNTGLAAS-ALQIKNNIKAL--TDTKILLTTQAHYDHLGAMAEIKKIGAKLMADEGDATVMADHGSMFEPIIADRLLHDKDTIQLGDTKLMLHHPGHTKGSCSFLFDTKRILIANMPIVIEKKFSEVSSYPGIAKDYAYTLQAMKNL--SFDIWVASHASQFS..................... 232
38 -33.6003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  12  20..................................................ATVYVMCGEKLTVMIDAGVSNSIADFSFLD-------KLDYIVLTHLHIDHIGLLPELLQVKAKVLVKSGFKKYLTSEDGLKKLNESAEEVEGNEEFDLGGYRMLIYTPGHARHHMSVLV--DDFLFTGDSAGAYFNGVVIPTTVIDYKMYMESLKRQIEL--KPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQIN. 232
39 -33.4005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  16  11......................NADQAPFRLFGNTYYV--------GMKGLSSVLVTSPQGHVLIDGGL-PESAPKIIANIGAL--EDVKLILNSHGHIDHAGGLAELQRRNALVAASPSAALDLASGEVKYPPVKDMRLARDGGQFNVGPVYLAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSRPGPNALADLRHSFETLEKL--PCDVLISAHPEASQRAYVAAARTLLDSRLDQEKQQ 271
40 -31.6001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  16  29..................................................STVVYLEHKDRRIIIDPGNLSS-MDELEEKFSELGISPITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEKPWHAREHLSFLLDTENVLITGDITPNRLS-----YYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAP....................... 208
41 -31.4004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  19  8..........................RVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPE-SCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVF-----EDLYDYMNSLKELLKI--KADIIYPGHGPV-----IHNAEAKIQQYISHRNIR 221
42 -29.2004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  22  68..................................................AEAALEEAARGPILVDTGGPWAR-EALLGALAGQGVAPVTLVVGTHGHSDHIGNLGLFP--GAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPGLEV--------WATPGHGGQRDVSVVVAGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVV---ADVVVPGHGPP....................... 234
43 -29.2005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  19  1....MAMNALEHQLDYPFADTLPAAGDTFEVAPGVRWLRMPLPFSLDHI--NLWLLRDQAGWTIVDCGISSEAIRTHWEQIRHLDGLPVLRVLVTHCHPDHFGLANWLCEGNVRLWMTLGEYMFGCLMAAGNGSNAGGAALREGDAVKIGART-VVTGYGHSPEHCALHSEADGVLISGDMVLPRISTNVSVFDLEPLALYLESLGRYETM-APDTLVLPSHGKP--AQLRAHHDARLEEVRVACAEK 303
44 -28.1002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  17  11................................................FSQNCSLIWCEQLAALVDPGGD---AEKIKQEVDAS-GVTLMQILLTHGHLDHVGAASELAQHGVPVIGPEKEDEFWLQG-DECQPLTPDRWLNDGDRVSVGNVTLVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSD-FPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD........ 210
45 -27.6002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  15  41................................................IPVSAYLIQCTDATVLYDTGCHPESECNLPERLRQLGLSPISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEERERELAPGVNLLNFGTGHASGMLGLAVRLEKFLLVSDACYNYGPPARRAGVLHDTIGYDRTVSHIRQYAESRSLVLFGHDREQFASLIKSTDGFYE......... 276
46 -26.7001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  17  9................................................LKDNYAYILHDEDVGVVDPSEAEPIIDSL-----KRSGRNLTYILNTHHHYDHTGGNLELKDRGAKVIGSAMDKDRIPG---------IDMALKDGDKWMFAGHEVHVMDPGHTKGHISLYFPGSRAIFTGDTMFSLS---CGKLFEGTPKQMLASLQKITSL-PDDTSIYCGHEYTLSNSKFALSLE............ 183
47 -26.7001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  17  9................................................LTDNYMYLVIDDEAAIVD----PVQPQKVVDAARKH-GVKLTTVLTTHHHWDHAGGNEKLVKLGLKVY------------GGDDRIGALTHKITHLSTLQVGSLNVKCLAPCHTSGHICYFVSKPGAVFTGDTLFVAG---CGKFYEGTADEMCKALLEVLGRLPPDTRVYCGH---------EYTINNLKFARH..... 185
48 -25.7003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  14  1..................GRISMTVKKLYFIPDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQVLLTIDASYTKENFEDEV-AGFDPELALSSIKRLKEVVKKEKIIFFGH-DIEQEKSCRVFPEYI.......... 254
49 -25.5003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  15  2.......................SDTKVYLLDGGSLVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYEKHQTIPGALGLLGLEPIDVVVNSHFHFDHCGGNKYFP--HAKKICHRSEVPQACNPQPFEHLGYSDLSFSDGDVDLARGVKLIST-PGHSIGHYSLLVEFPRILFTIDAAYTQKSTLCQAAFHIDPVAGVNSMRKVKKLAEDHGALMYSHDMDNFKTYRTGTQFY........... 267
50 -25.5002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  13  35................................................LPVWCYLLETEEGPILVDTGMPESAVNNIVNILKRVGYEPLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQVLLTIDASTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKIIFFGH-DIEQEKSCRVFPEYI.......... 252
51 -25.2002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  16  1.SSGLVPRGSHMRNYCTKTFGSAFSVTVVPTLKDNFSYLINDH--------------TTHTLAAVDVNADYKPILTYIEE-NADVTYTFSTILSTHKHWDHSGGNAKLKAE-----AMNSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDPCHTRGHVLYKVQHPQALFTGDTMFIAG---IGAFFEGDEKDMCRAMEKVYHIHDKVTFIFPGH---------EYTSGFMTFSEK..... 232
52 -24.4004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  20  28.........................................................ESREAVLIDP----ETAPRDAQLIKEL-GLRLLYAVNTHCHADHITGSGLLRSL-------------CQSVISRLSGAQADLHIEDGDSIRFGRFALTRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTL-PGDCLIYPAHD......................... 180
53 -23.7004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  13  2..................SDSKPRDVQVLPIATNTKVLRARS---ERGTTSNSYVIE-GDKTAIIDPP-VESFMKIYLEALQQTVNKKLDYVILGHFSPNRIPTFKALLELQITFVCSLPAAGDLRAAFPDDNLNI--LPMRGKETLDLGKLKFLPIPSPRWPAGLCTYDVQTQILYTDKIF--GAHICGDDVFDDNWESFEAALEKISDL--QVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLE. 256
54 -22.3004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  19  22.........................................................ATRQAVLIDP----EQVDRDLQMVAEL-DLTLTHVFDTHVHADHITASGALRERQATVVGSVNGASCA------------NVQVRHGDEVRVGQLVFVLATPGHTDDSISYLLGDR--VFTGDALLVRGNGRTDF-QNGNASQLYDSLTRVLFTLPDETLVYPGHDYKGTVTSIAEEKRHNPRVAGKSREE 197
55 -22.1002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  17  26.........................................................PDKPALLIDP----KTVDRDLKLIDEL-GLKLIYAMNTHVHADHVTGTGLLKTK-------------VKSVISKASGSKADLFLEPGDKVSIGDIYLVRATPGHTAGCVTYVTPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTL-PKDTLIYPAHDYKGFEVSTVGEEMQHNPRLTKDKET 209
56 -21.9003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  12  5........................DISIHYLNGGNTKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGEESHIIADLANYTPKDIDYVLMTHMHFDHAAGLTVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPGIKMQHSG-GHSFGHTIITIESDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAY....... 270
57 -21.2004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  17  1............KQVAGYYQYQAGDVQITALLDGILKKYYADQEKGVQTSINAFLVNIGKSLILIDSGAASSHLGSVLSNLKASGYQPVDTILLTHLHPDHVCGISYVSNDEASFWLDPKQAAKLPKEKQANYLGTVEKIYQAKQRFKTYKLGDDIQGAGHTPGHFSYELKTESIVFIGDIVVQFDRPETAIEYDIDPKKAVETRLKQFANFAKNGQTIPGIGHTYSAD................... 278
58 -20.8002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  14  2........................KAAAKRISDGVY-LRNYHGYTLQGTTYNAYLVCGDEGVALIDNGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRREAPIYCTEVAVKGLLKHYPSLREAEF-MTVKTGDVLDLGGKTLTFLET-HWPDSMFTLLDEDGILFSNDALMDAARKFYANLITPLSKLVLKKFDEVKELLERIQMIAPSHGQI....................... 236
59 -20.8004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  19  1............DDLSGFKKIKLGELELFILTDGYILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIERTGFLLKSLQKAGFSAITDIFLSHAHPDHIGGV-FISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQNILK-PKLKFYDLNPGHTPGLTVTTISSEKLMYVADLIHSDPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAPGLGFT....................... 278
60 -20.5004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  18  20LPLQAAAPAQQKTQVPGYYRMALGDFEVTALYDGLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGYQPVDTVLLTHLHPDHACGL--VNADGSPAYPNATVEKMAQQAVAPYAKMNKLKPYKTEGELLPGVSLVASPG--HTPGHTSYLFKSQSLLVWGDILVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV....................... 303
61 -20.5004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  13  3............................IVVKNNIHDFHGTEYKTLRGSSYNSYLIR-EEKNVLIDT-VDHKFSREFVQNLRNEIDADIDYIVINHAEEDHAGALTELMAQDTPIYCTANAIDSINGPEWNF------NVVKTGDTLDIGNLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELTPKITEILGFNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYQEDR 249
62 -20.4004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  17  20LPLQAAAPAQQKTQVPGYYRMALGDFEVTALYDGLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQPTLGVVQTNLKASGYQPVDTVLLTHLHPDHACGL--VNADGSPAYPNATVEKMARQAVAPYAKMNKLKPYKTEGELLPGVSLVASSG--HTPGHTSYLFKSQSLLVWGDILVQFAKPEVVWEFDVDSDQARQSRQRILAEAATDKLWVPGLGHV....................... 303
63 -20.3001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  19  30VSTAHAAAPQVRTSAPGYYRMLLGDFEITALSDGTVALAKSFQKAPLETSVTGYLVNTGSKLVLVDTGAAGPTLGRLAANLKAAGYQPVDEIYITHMHPDHVGGLLAFPNAVVRADQKEADFWLSQTNLDKAPDDESKGFFKGAMAVKAGKFKPFSGNHGHTPGHTTYVVESQKLALLGDLIVQFDDPSVTTQLDSDSKSVAVERKKAFADAAKGGYLIPGIGHI....................... 311
64 -20.2002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  12  8.........................VQDQEMIPGVYVRIFHGYHTDEGSSYNSYFID-DECPTVIDS-VKYPFAEEWLSRIAACCPDKIKYVVMNHAEGDHASSLKDHYHKNATFVCTKKCQEHLKILYGMEKATW--LIVDDKYTLKIGKRTLKFIPV-HWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMKALEVASTV--EIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQHCQ 256
65 -19.9001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  17  2..........................QPVAITDGIYYFHGPAFSTHRGTTYNAYLIV-DDKTALVDT-VYEPFKEELIAKLKQIKDVKLDYLVVNHTESDHAGAFPAIMELDAHVLCTQRAFDSLKAHYSHIDFNY--TIVKTGTSVSLGKRSLTFIEA-HWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAK 253
66 -19.6001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  17  1.........................MQATKIIDGFH-LVGAIDWNSRDFHGNAYLVE-DEKTTLFDT-VKAEYKGELLCGIASVIDKKIDYLVIQHLELDHAGALPALIEAPEKIFTSSLGQKAMESHFHYKDWPV--QVVKHGETLSLGKRTVTFYET-HWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLLKAIETLVGAGVAPEFICPDHGVI....................... 229
67 -18.4001vme_A mol:protein length:410 Flavoprotein  ali model follow..  16  12.........................TERIFDDPEIY-VLRIDDDRIRYFEANAYLVKLNGANVLIDG-WKGNYAKEFIDALSKIVDKEITHIIVNHTEPDHSGSLPATLKTDVEIIASNFGKRLLEGFYGIKDVT----VVKDGEEREIGGKKFKFVMT-HWPDTMVTYL--DGILFSCDVGLPHVTKYIVTVIGHYKNYILEGAEKLSSL--KIKALLPGHGLIWKKDPQRLLNHYVSVAKGDPKKG 260
68 -18.3003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  19  15..................................................AHASYLVGCQEACVID----PARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRGAAICVSDEGPP---EWKSEYVKAYPHRLLKDGDELHFGNVRIVMHTPGHTPEHVSYLLYDGKALFSGDFVFVGRVAGESGSSEALARQMFRSLRKFEAL-PDHVQVLPAHGA........................ 201
69 -18.0003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  15  2........SSGVDLGTENLYFQSNAMFFKQFYDKHLSQASY---------------QKTGEAMIID----PIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKNANIYVSGESDDTLGYKNMPNHTH----FVQHNDDIYVGNIKLVLHTPGHTPESISFLLTDEGGLFSGDFIFVGKAVKVEGSSEIGAKQMFKSIESIKDL-PDYIQIWPGHGA........................ 215
70 -17.5002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  14  23.....................................................VLTNDEGRCVIVDPG----EAAPVLKAIAEH-KWMPEAIFLT----DHVGGVKELLQHQMTVYGPAETQ-----------DKGATHLVGDGDTIRVLGEKFTLFAPGHTLGHVCYFSRP--YLFCGDTLFSGG---CGRLFEGTPSQMYQSLMKINSL-PDDTLICCAHANIKFALSILPHDSFINEYYRKVKE. 197
71 -16.2003kl7_A mol:protein length:235 Putative metal-dependent hydrolase  ali model follow..  1....................MGSDKIENLYFQGDSFKTKSGKELTITFIKHGSLMLTYDNHSIQVDPVSEYADYTTF---------PKADIILITHEHGDHLDAIQAVEKSDTEIIANENSQKKLGKGK---------VLKNGDTDTSISYMKIEAVPAYNTTPGYILTFDGLRVYIAGDTEDIPEMKDLKDIDIAFLMTVSQAAKAARMFSP--KILYPYHYGDTKIGELKDALK............ 217
72 -15.9003g1p_A mol:protein length:258 Protein phnP  ali model follow..  12  41....................................................SGVVKFNDAITLIDAGLHDLADRWSPGSFQQ--------FLLTHYHMDHVQGLFPLRGDPIPVYGPPDEQGCDDL--KHPGLLDFSHTVEPFVVFDLQGLQVTPLPLNHSKLTFGYLLETA----HSRVAWLSDTAGLPEKTLKFLRNNQPQVMVMDCSHPPRADAPRNHCDLNTVQVIRSPRVILTHISHQFDAW 230
73 -15.5004nur_A mol:protein length:633 PSdsA  ali model follow..  17  89...........................LFEVTDGIYQVRNYD-------LSNMTIVEGKDGITIFDPLISQETAKAALDLYYKHRPKPVVAVIYTHSHVDHYGGVADVKAGKVKIYAPLGFLEHAVAEGTVTLIPPTDIIKETGETHVIDGLTYEFAPGSEAPAEMLYYIKEKKALNAAEDSTHTNTYSLRGAKIRDPLAWSKYLNEALKLWGDDVQVMPVWGNKEVREQLSLQRDMYRYINDET... 354
74 -15.5004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  13  28.........................................................ETRQCALIDSRTCSASADRLVERVNEL-NASVRWVLETHVHADHLSAAAYLKEKGAHITQVQKVFGALFNAEPGFARSQFDVLLEDEEGFRIGNLQARAL-PGHTPACMSFMIEDEIAVFVGDTLFMPDYGTACDFPGADARTLYRSIRRLLAF-PDQTRLFMCHDYLPGGRDMQYVTTVAEQRASNI... 235
75 -15.4002cfu_A mol:protein length:658 SDSA1  ali model follow..  15  107...........................LFEVAEGIYQVRGFD-------LANITFIRGDSGWIVVDTLTTPATARAAYELVSRELGRPIRTVIYSHAHADHFGGVQQVASGAVQIIAPAGFMEAAIKEGPLSLLAPTRLIEGEGEDLVLDGVPFTFTPGTESPAEMNIWLPRQKALLMAENVVGTNLYTLRGAEVRDALGWSKYINQALHRFGRQAEVMPRWGNAEIVEVLEKQRDLYGYLHDQT... 372

FFAS is supported by the NIH grant R01-GM087218-01
1 0 8 9 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.