current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 5aeb_A mol:protein length:272 LRA-12, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst HMASQKVKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLNENLast
1 -112.0005aeb_A mol:protein length:272 LRA-12  ali model  100  1HMASQKVKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLNEN 272
2 -100.0001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  35  1.............AYPMPNPFPPFRIAGNLYYVGTDDLASYLIVTPRGNILINSDLEANVPMIKASIKKLGFKFSDTKILLISHAHFDHAAGSELIKQQTKAKYMVMDEDVSVILSGGKSDFHYANDSTYFTQSTVDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWTMKLKDHGKQYQAVIIGSIGVNPGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAGMFDLKNKYVLLSKGQNNPFVDPTGCKNYIEQKANDFYTELKKQ 260
3 -99.7005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  26  1.......TPGCEVCATWNADQAPFRLFGNTYYVGMKGLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALGFRIEDVKLILNSHGHIDHAGGLAELQRRSNALVAASPSAALDLASGEVGDDPQYHALPKYPPVKDMRLARDGGQFNVGPVYLTAHATPGHTPGGLSWTWQSCDGPRCLNMVYADSINAVSGFKFSASSEYPNALADLRHSFETLEKLPCDVLISAHPEASQLWQRLEASATGGSDAFVDPQACRAYVAAARTLLDSRLDQE 268
4 -99.5003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  26  1............QDRDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSD-HPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASE 260
5 -96.0003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  31  20..AQTIKDFLAVAMKKWTAPFEPFQLIDNIYYVGTDGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDKPLLEGGYYPGDEKNE-DLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRLVGQPT-YAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGMQAKRAEMKDGAPNPFIKPGELVTYATSLSEDFDKQLAKQ 287
6 -94.3004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  23  21LASDAPASRGCADDAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIG---PRAAAPLMDTTACRRYAQGARQRLEKRLAEE 292
7 -93.6004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  23  21LASDAPASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIG---PRAAAPLMDTTACRRYAQGARQRLEKRLAEE 292
8 -90.3001sml_A mol:protein length:269 PROTEIN (PENICILLINASE)  ali model follow..  25  3..VPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRRTGAKVAANAESAVLLARGGSD-DLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWTWTDTRNGKPVRIAYADSLSAP-GYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGA------RAGAKALTCKAYADAAEQKFDGQLAKE 264
9 -55.6002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  16  1.........................MRVFPVTLGPLQENAYLVETGEGPVLID--PGDEPEKLLALFQTTGLI---PLAILLTHAHFDHVGAVAPLVEALDLPVYLHPLDLPLYEGADLAARAWG---AIPKPPLPVRPLEEGMRL----FGFQVLHLPGHSPGHVAFYDPEGAQVFSGDLLFRGS--------VGRYDLPGADPKALFASLKRLLSLPPETVHPGHGPGTTLGLEART------NPFLTGLEWEA................ 207
10 -51.9003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  13  20.....................................ATVYVMCGEKLTVMIDAGVSNSIADFSF--------LDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVD--------DFLFTGDSGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQSKEEIQINVDIGGVAGEILRKQIEVNLRG. 253
11 -47.9002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  14  15................MLRLSAPGQLDDDLCLLGDVQVPVFLLRGEASWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLNVQVLASERTCQAWKSESAVRVVERLNRQLLRDALPVRAVADGEWLELGPHRLQVIEAHGHSDDHVVFYDVRRR------RLFCGDLGEFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLQLIPGHGGAADGAESAYTECLRLCRRLLWRQSMGESLDELSEELHRAWGGQ 286
12 -45.3002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  20  1.........................MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVT---LMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLD-ECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGG--------VGRSDFPRGDHTQLIDAIRKLLPLGDDVFIPGHGPLSTLGYERLH------NPFLQD..................... 210
13 -43.1001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  18  29.....................................STVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFE---NATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEK---VKVFHTPWHAREHLSFLLDTENAG---RVLITGD--ITPNRLSYYDIIKGYGSVQVKNFLDRVGRI--DLLVFPHDAPLKPEVKK................................... 215
14 -38.6002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  18  20.................................RNIDFNGFAWIRPEGNILIDP--VALSNHDWKHLESLG----GVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENF------------------PIYCDRWLSDGDELVPG---LKVMELQGKTPGELALLLEE-------TTLITGDL--VRAYRAGGLEILPDNKQKVVASVRRLAALEVEAVLVGDGWSVFRDGRDRLKE............................... 195
15 -38.0002gcu_A mol:protein length:245 Putative hydroxyacylglutathione hydrolase 3  ali model follow..  16  1.......................MKLLFRQLFENESSTFTYLLADPDKPALLIDPVDKTVDRDLKLIDELGLK---LIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKA---------------------SGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGADQPQPRMAFTGDA--VLIRGCGRTDFQEGSSDQLYESVSQIFTLPKDTIYPAHDYKGFEVSTVGEEMQHNPRLTKDKETFKTIMSNLNLSYPKMI... 225
16 -37.7003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  18  39.....................................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIETEQSG---SVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGHDIE.......................................... 242
17 -37.6002br6_A mol:protein length:252 AIIA-LIKE PROTEIN  ali model follow..  18  37.....................................VWCYLLETEEGPILVDTGMPESADRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFT---NTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPG---------VQLLYTPGHSPGHQSLFIKTEQSG---SVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGHDIEQ......................................... 241
18 -37.5002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  17  3........................ALLPGLYLLPLKTVNLYLLQGAGEVALVDTALRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEG-LGARVFLHEEEFARGHRFWREPEAFAEASWRLHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTREN-----LKDFLRSLDRLADLGARVAYAGHF-----------------GPI---ADVRQRAEELKAHHQARLEA. 257
19 -37.3004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  17  6........................PILLRQMFEPVSCTFTYLLGDRESRVLIDPVL-ETAPRDAQLIKELGLR---LLYAVNTHCHADHITGSGLLRSLLPGCQSVISR---------------------LSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCG--------RTDFQQGCAKTLYHSVEKIFTLPGDCIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQI... 221
20 -36.9004ysb_A mol:protein length:233 Metallo-beta-lactamase family protein  ali model follow..  15  1.........................MIFRQLFDSESSTYTYLIGDEATRVLIDPVL-EQVDRDLQMVAELDLT---LTHVFDTHVHADHITASGALRERTQATVVGSVNGAS----------------------CANVQVRHGDEVRVGQLVFQVLATPGHTDDSISYLLG--------DRVFTGDA--LLVRGNGRTDFQNGNASQLYDSLRVLFTLPDETVYPGHD-VTSIAEEKRH------NPRVAGKSREEFIHIMEN......... 204
21 -35.7003aj3_A mol:protein length:274 4-pyridoxolactonase  ali model follow..  17  35.....................................VYSILIEHAEGRFLIDTGYDEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFP---HAKKICHRSEVPQACNPQPFEHLGYRANSTFEGIDGDVDLARG---------VKLISTPGHSIGHYSLLVEFPRRK---PILFTIDAAYTQKSETLCQAAFHIDPVAGVNSMRKVKKLAEDELMYSHDMDN......................................... 256
22 -35.4002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  14  43.....................................VSAYLIQCTDATVLYDTGCHPECCNLPERLRQLGLSPDDISTVVLSHLHNDHAGCVEYFGK---SRLIAHEDEFATAVRYFATGDHSSPEAWLATPRNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVRLEKQP----FLLVSDA-CYTATNYGPPARRAGVLHDYDRTVSHIRQYAESTVLFGHDREQ......................................... 263
23 -35.3004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROT  ali model follow..  15  68.....................................AEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPG---AALLVSHDFCLPGGR------------------YLPHGLGEGQPLRLGP-GLEVWATPGHGGQRDVSVVVA--GTALGTVVVAGDV-FERDGDEDSWQALSEDPAAQERSRKRVLVV-ADVVVPGHGPPFRVLREASQ................................. 243
24 -35.0001xm8_A mol:protein length:254 glyoxalase II  ali model follow..  20  14.......................................AYILHDEDTGTVGVVDPSEAEP-IIDSLKRSGRN---LTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPG-------------------IDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFE----------GTPKQMLASLQKITSLPDDTIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKME 214
25 -33.8004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  10  2........PKSSDHVDLPYNLTATKIDSDVFVVDFYSSNVLVAKMLDGTVVISPFENLGTQTLMDWVAKT--MKPKKVVAINTHFHLDGTGGNEIYKKM-GAETWSSDLTKQLRLEENKKDRIKAAESSHPVPADNVFDLKQGKVFSFSNELVEVSFPPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGD----------ANVKAWPDSARRLKKFDAKIVIPGHGEWGG........................................ 230
26 -33.7005a87_A mol:protein length:248 METALLO-BETA-LACTAMASE VIM-5  ali model follow..  11  7.HSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWGAKTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRKA-GVATYASPSTRRLAEA----------EGNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSA------NVLYGGCA-VLALSRTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGG........................................ 227
27 -33.3004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  18  20.........................LGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIG---------NGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVF------------EDLYDYMNSLKELLKIKADIIYPGHGPVIH-------------NAEAKIQQYISHRNIREQQILTLFRE. 231
28 -32.7003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  14  3.................KDFVIEPPIKNNLHIYKEYSANSMYLVTKKGVVLFDVPWEKVYQSLMDTIKKR--HNLPVVAVFATHSHDDRAGDLSFFNNK-GIKTYATAKTNEFLKKDGK--------------ATSTEIIKTGKPYRIGGEEFVVDFLEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIK-------EANVEQWPKTINKLKAKKATLIIPGHDEWKG........................................ 205
29 -32.7004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  10  25.HSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHAVYPSNGLIVRDGDELLLIDTAWGKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEA----------EGNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAN------VLYGGCA-VLELSSTSAGNVADADLAEWPTSVERIQKHEAEVVIPGHGLPGG........................................ 245
30 -32.5002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  11  8.................TGTISISQLNKNVWVHEAVPSNGLVLNTSKGLVLVDSSWDDKTKELIEMVEKK--FQKRVTDVIITHAHADHIGGIKTLKER-GIKAHSTALTAELAKKNGY--------------EEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGSLVKSTSAKDLGNVA-------DAYVNEWSTSIENVLKRNINAVVPGHGEVGD........................................ 210
31 -32.2004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  4.................VPELRIEKVKENIFLHGLVSSNGLVVIDKGNAFIVDTPSDRDTETLVHWIRKNG---YELLGSVSTHWHEDRTAGIKWLNDQ-SISTYATTSTNHLLKENKK---------------EPAKYTLKGNESTLVDGLIEVFYPGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTG-------EAHIDQWSRSAQNALSREAQIVIPGHGKIGDIAL----------------KHTKSLAETASNKSIQPNAN. 229
32 -32.1001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  13  8.................SDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPINDATETLVNWVADS--LHAKVTTFIPNHWHGDCIGGLGYLQKK-GVQSYANQMTIDLAKEKGL--------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQATSIGNIS-------DADVTAWPKTLDKVKAKSARYVVPGHGDYGG........................................ 211
33 -32.1001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  13  8.................SDDISITQLSDKVYTYGMVPSNGMIVINNHQAALLDTPINDATEMLVNWVTDS--LHAKVTTFIPNHWHGDCIGGLGYLQRK-GVQSYANQMTIDLAKEKGL--------------PVPEHGFTDSLTVSLDGMPLQCYYLGGHATDNIVVWLPTENILFGGCMLKDNQTTSIGNIS-------DADVTAWPKTLDKVKAKSARYVVPGHGNYGG........................................ 211
34 -32.0004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  15  3.AIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAA------QHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSL--------NLGAADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 228
35 -31.9004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  15  6.EIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAA------QHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG-------DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 231
36 -31.8001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  14  2....................VKIEKLKDNLYVYTKYAANAVYLVTDKGVVVIDCPWGEDFKSFTDEIYKK--HGKKVIMNIATHSHDDRAGGLEYFGKI-GAKTYSTKMTDSILAKENK--------------PRAQYTFDNNKSFKVGKSEFQVYYPKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIG-------EAYVNDWTQSVHNIQQKGAQYVVAGHDDWKD........................................ 201
37 -31.7002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  10  1....ASQKVEKTVIKNETGTISISQLNKNVWVHEAVPSNGLVLNTSKGLVLVDSSWDDKTKELIEMVEKK--FQKRVTDVIITHAHASRIGGIKTLKER-GIKAHSTALTAELAKKNGY--------------EEPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVA-------DAYVNEWSTSIENVLKRNINAVVPGHGEVGD........................................ 216
38 -31.7002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  10  25.FSVDSSGEYPTVSEIPVGEVRLYQIADGVWS-AVYPSNGLIVRDGDELLLIDTAWGKNTAALLAEIEKQ----LPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEV----------EGNEIPTHSLEGLSSSGDAVRFGPVEL-FYPGAAHSTDNLVVYVPSAS------VLYGGCA-IYELSRTSAGNVADADLAEWPTSIERIQQHEAQFVIPGHGLPGG........................................ 245
39 -31.7003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  11  8.................TGTISISQLNKNVWVHTELGSSGLVLNTSKGLVLVDSSWDDKTKELIEMVEKK--FQKRVTDAIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKNGYE--------------EPLGDLQTVTNLKFGNMKVETFYPKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVA-------DAYVNEWSTSIENVSKRNINAVVPSHGEVGD........................................ 210
40 -31.6002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  24.YSAQPGGEYPTVDDIPVGEVRLYKIGDGVWSHTVYSSNGLIVRDADELLLIDTAWGKNTVALLAEIEKQ--IGLPVTRSISTHFHDDRVGGVDVLRAA-GVATYTSPLTRQLAEA----------AGNEVPAHSLKALSSSGDVVRFGPVEV-FYPGAAHSGDNLVVYVPAV------RVLFGGCA-VHEASRESAGNVADANLAEWPATIKRIQQREAEVVIPGHGLPGG........................................ 244
41 -31.6004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  11  5.................LPDLKIEKLEEGVYVHGVVSKHGLVVLVNTDAYLIDTPTATDTEKLVNWFVERG---YKIKGTISSHFHSDSTGGIEWLNSQ-SIPTYASELTNELLKKDGK---------------VQAKNSFSGVSYWLVKNKIEVFYPPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGD----------ANLEAWPKSAKILMSKKAKLVVSSHSEIGD........................................ 203
42 -31.6005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  15  3.EIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAA------QHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG-------DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 228
43 -31.6003q6v_A mol:protein length:233 Beta-lactamase  ali model follow..  18  3.................EKNLTLTHFKGPLYIVEYVQENSMVYIGTDGITIIGATWTPEAETLYKEIRKVSPLP--INEVINTNYHTDRAGGNAYWKTL-GAKIVATQMTYDLQKSQWGSIVNFTRQGPNLEKSLPDTVFPG--DFNLQNGSIRAMYLEAHTKDGIFVYFPAE------RVLYGNCILKENLGNMSF-----ANRTEYPKTLEKLKGLKVDSIIAGHDTPIHDVGLIDH................................. 223
44 -31.5003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  15  1.....SNANYMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAA------QHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG-------DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 222
45 -31.5003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  15  4.EIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAA------QHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG-------DADTEHYAASARAFGAAKASMIVMSHSAPDSRAA----------------THTARMADKLRKLVPRGSAA. 253
46 -31.5004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  11  4.................LPDLKIEKLDEGVYVHGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVERG---YKIKGSISSHFHSDSTGGIEWLNSR-SIPTYASELTNELLKKDG---------------KVQATNSFSGVNYWLVKNKIEVFYPPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGD----------ANIEAWPKSAKLLKSKKAKLVVPSHSEVGD........................................ 202
47 -31.3004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  15  30.EIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGMVAA------QHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG-------DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 255
48 -31.3001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  17  1..................AGMSLTQVSGPVYVVYYVQENSMVYFGAKGVTVVGATWTPDARELHKLIKRVSRKP--VLEVINTNYHTDRAGGNAYWKSI-GAKVVSTRQTRDLMKSDWAEIVAFTPEYPDLPLVLPNVVHDGDFTLQEGKVRA-FYAGPAHTPDGIFVYFPDE------QVLYGGCILKEKLGNLSF-----ADVKAYPQTLERLKALPIKTVIGGHDSPLHGPELIDHYEA.............................. 219
49 -31.3004tyf_A mol:protein length:231 NDM-4  ali model follow..  16  7.................FGDLVFRQLAPNVWQHGAVASNGLIVRDGGRVLVVDTAWTDDTAQILNWIKQE--INLPVALAVVTHAHQDKMGGMDALHAA-GIATYANALSNQLAPQEGLVAA------QHSLTFAANGWVEPATAPNFGPLKV-FYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG-------DADTEHYAASARAFGAAKASMIVMSHSAPDS........................................ 216
50 -31.1004efz_A mol:protein length:298 Metallo-beta-lactamase family protein  ali model follow..  17  1.....................GPGSMTVEGFFDPATCTISYLLFDSGSGALIDSVLDASADQLIARVAALGAR---VRWLLETHVHADHLSAAPYLKTRVGGEIAIGRH----VTRVQDVFGKLFNAGPAFAHSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARAAFVGDTLFMPDYGTARCDFPGGDARSLYRSIRKVLSLPPATLYMCHPNGRAIQYASTVADELRENVHIREGVTEDDFVAMRTARDATLD.. 262
51 -31.0004ysk_A mol:protein length:294 Beta-lactamase domain protein  ali model follow..  16  10............................DAFYDEATSTISYLVMDRETRALIDSVLDASADRLVERVNELNAS---VRWVLETHVHADHLSAAAYLKEKLGGHTAIGAH----ITQVQKVFGALFNAEPGFARSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIEDAGE----IAVFVGDTLFMPDYGTARCDFPGADARTLYRSIRRLLAFPDQTLFMCHPGGRDMQYVTTVAEQRASNIHIHQGIDEDSFVAMREARDKTLE.. 258
52 -30.8003esh_A mol:protein length:280 Protein similar to metal-dependent hydrolase  ali model follow..  12  45..................................NLPTHPILIQTAQYNLIIDAGIGNEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHANAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPG---IKMQHSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGEN.............................. 266
53 -30.6002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  12  4.................HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPSEEDTKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREGK---------------PVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVG-------DASISSWADSIKNIVSKPIQMVVPGHGKVGS........................................ 205
54 -30.6001qh3_A mol:protein length:260 PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)  ali model follow..  16  3....................VEVLPALTDNY--------MYLVIDDETKEAAIVDPVQPQK-VVDAARKHGVK---LTTVLTTHHHWDHAGGNEKLVKLEGLKVYGGDDRIGAL----------------------THKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSETGDTLFVAGCGKFYE----------GTADEMCKALEVLGRLPPDTVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEE 218
55 -30.1005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  11  21.................HKPLEVIKIEDGVYLHGLVDSNGLVVLDNNQAYIIDTPWSEETKLLLSWATDRG---YQVMASISTHSHEDRTAGIKLLNSK-SIPTYTSELTKKLLAREG---------------KPVPTHYFKDDEFTLGNGLIELYYPAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVG-------DASISSWADSIKNIVSYPIQMVVPGHGKVGSSDI----------------DHTIDLAESASNKLMQPTAE. 246
56 -30.1003tp9_A mol:protein length:474 BETA-LACTAMASE and RHODANESE DOMAIN PROTEIN  ali model follow..  16  4.........................MYLRRFYDEGLAHASYLVGCQETGEACVIDPARDVEPYLLTAKREGLR---IVAALETHIHADFVSGAREMADRAGAAICVSDEGPPEWKSEYVKAYPH-------------RLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKTSPSGDFVFVGDVG-LLERVAGESGSSEALARQMFRSLRKFEALPDHVVLPAHGAGSACGKALGAVPSSTVNWALQHKDEDAFVQALLAGQPE..... 245
57 -29.8002p18_A mol:protein length:311 Glyoxalase II  ali model follow..  13  25....................VTVVPTLKDNF--------SYLINDHTTHTLAAVDVNADYKPILTYIEEHLKQQGTFSTILSTHKHWDHSGGNAKLKAELEAVVVGGANDS-----------------------AVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGDT--MFIAGIGA--FFEGDEKDMCRAMEKVYALDKVTIFPGH--EYTSGFMTFSEKTFPDRASDDLAFIQAQRAKYAASVPSSLAEE 270
58 -29.8003r2u_A mol:protein length:466 Metallo-beta-lactamase family protein  ali model follow..  15  15.....................QSNAMFFKQFYDKHLSQASYLIGCQKTGEAMIIDPIRDLSSYIRVADEEGLT---ITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLGYKNMPNHT--------------HFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGASGDFIFVGDIG-LLEKAVKVEGSSEIGAKQMFKSIESIKDLPDYIIWPGHGAGSPCGKSLGAIPTSTTNWAFSENNEATFIDKLISDQPA..... 259
59 -28.3004zo2_A mol:protein length:294 Acylhomoserine lactonase  ali model follow..  14  56..................................DMAINILLVKTKEKLILMDTGMGIRTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQ-KFYDLNKTLYSH---FNFQLAPGHTPGLTVTTISSGNE----KLMYVADLIHSDVILFPHGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKVKAPGFEWIP......................... 289
60 -28.1005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  14  20..................AAGDTFEVAPGVRWLSLDHINLWLLRDQAGWTIVDCGISEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGGNVRLWMTLGEYMFGCLDKLRSRRSYYSDLVPAVPPRYRRLREGDAVKIGARTWRVVTGYGHSPEHCALHSEADGVLISGDMVL---PRISTNVSVFDLEPEANPLALYLESLGRYETMAPDLVLPSHG-----------------KPF---RGVRTRIAQLRAHHDARLEE. 295
61 -28.0004xuk_A mol:protein length:291 Putative hydrolase  ali model follow..  16  55..................................QTSINAFLVNIGKSLILIDSGAASHLGSVLSNLKASGYQPEQVDTILLTHLHPDHVCGISKDGVANNATVYVSNDEASFWLDPKQAAKLPKEKQAPYQAKQRFKTYKLGDDIQ----GFKVINTAGHTPGHFSYELKTKGE----SIVFIGDIVHSHTVQFDRYDIDPKKAVETRLKQFANFAKNGQTIAAPHLPFPGIGHTYSADGKS............................. 281
62 -27.2004le6_A mol:protein length:324 Organophosphorus hydrolase  ali model follow..  18  86..................................QTAVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMAQQAKPYKTEGELLPG---VSLVASPGHTPGHTSYLFKSGGQ----SLLVWGDILLNHAVQFAKFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVP......................... 314
63 -27.1004o98_A mol:protein length:337 organophosphorus hydrolase  ali model follow..  18  86..................................QTAVNAYLINTGDNLVLIDTGAAQTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPNATVEVPQAEAEFWLDEATMAKAPEGMQGMFKMARQAKPYKTEGELLPG---VSLVASSGHTPGHTSYLFKSGGQ----SLLVWGDILINHAVQFAKFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVREEAQGYAWVP......................... 314
64 -26.6001p9e_A mol:protein length:331 Methyl Parathion Hydrolase  ali model follow..  19  94..................................ETSVTGYLVNTGSKLVLVDTGAAGTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMVGEQLANAVVRADQKEADFWLSQTNLDKAPDDESKGFFKGAMASLFSGNTDLVPG---IKALASHGHTPGHTTYVVESQGQ----KLALLGDLILVAAVQFDDLDSDSKSVAVERKKAFADAAKGGYLIAASHLSFPGIGHIRAEGKGYRFVP......................... 322
65 -25.1002qed_A mol:protein length:258 Hydroxyacylglutathione hydrolase  ali model follow..  16  10....................LNSIPAFQDNY--------IWVLTNDEGRCVIV---PGEAAPVLKAIAEHKWM---PEAIFLT----DHVGGVKELLQHFQMTVYGPAETQ----------------------KGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSR--PYLFCGDTLFSGGCGRLFE----------GTPSQMYQSLMKINSLPDDTICCAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNE 213
66 -24.9001vme_A mol:protein length:410 Flavoprotein  ali model follow..  11  12....................TERIFDDPEIYVLRIISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKI-VDPKEITHIIVNHTEPDHSGSLPATLKTIDVEIIASNFGKRLLEG--------------FYGIKDVTVVKDGEEREIGGKKFKFVMTP-HWPDTMVTYLD--------GILFSCDVGGGYLLPEILDDSNESVVERYLEGAEKLSSLKIKALLPGHGRLLNHYVSVAKGDPKKGKVTVIYDSMYGFVENVMKKAIDSLKEK 287
67 -23.1002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  11  8....................VQDQEMIPGVYWVGIVD-NSYFIDDEC-PTVIDSVKYPFAEEWLSRIAAC-CPLDKIKYVVMNHAEGDHASSLKDHYHKFNATFVCTKKCQEHLKILYGMEKATW------------LIVDDKYTLKIGKRTLKFIPVP-HWPDSTFTYCPEDKILFSNDGF-HYATSRRWADECDVSHVMHLFKEYTRKALEVASTVEIKYILSAHGVSIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARST 284
68 -22.4002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  14  3....................AAAKRISDGVYWTGVLD-NAYLVCGDEGVALIDNSYPGTFDELMARVEDAQVGMERVDYIIQNHVEKDHSGVLVELHRRFEAPIYCTEVAVKGLLKHYPSLREA-------------MTVKTGDVLDLGGKTLTFLETP-HWPDSMFTLLDED------GILFSNDCPQRLDREIPEYILMDAARKFYLKKFDEVKELRIQMIAPSHGDPMKIIEAYTGTGMVDERVTVIYDTMHGSTRKMAHAIAEGAMSE 284
69 -22.4004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  10  9....................VQVLPIATNTKVLRARSSNSYVIEGDK-TAIIDPPVESFMKIYLEALQQT-VNLKKLDYVILGHFSPNRIPTFKALLELAQITFVCSLPAAGDLRAAFPDDNLNI------------LPMRGKETLDLGGHVLKFLPIP-RWPAGLCTYDVQTQ------ILYTDKISFKEDQRYYFNCLMAPHAIHVEAALEKISDLQVRLYAVGHGP........................................... 233
70 -20.9001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  11  1....................MQATKIIDGFHLVGAID-NAYLVEDEK-TTLFDTVKAEYKGELLCGIASV-IDPKKIDYLVIQHLELDHAGALPALIEACPEKIFTSSLGQKAMESHFHYKDWPV------------QVVKHGETLSLGKRTVTFYETR-HWPDSMVSWFADEKVLISNDIF-NIAASERFSDQIPVHTLERAMREYYLKAIETLVGVAPEFICPDHGVIFRGADQCTAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDE 280
71 -20.4001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  14  2.....................QPVAITDGIYWVGAVD-NAYLIV-DDKTALVDTVYEPFKEELIAKLKQI-KDPVKLDYLVVNHTESDHAGAFPAIMELCDAHVLCTQRAFDSLKAHYSHIDFNY------------TIVKTGTSVSLGKRSLTFIEAP-HWPDSMFTYVPEEALLLPNDAF-HIATSVRFDDQVDAGLIMDEAAKYYTKKLDEIQKLAIKTIAPSHGDPGRIIEAYAREGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAG 279
72 -20.3002p4z_A mol:protein length:284 Metal-dependent hydrolases of the beta-lactam  ali model follow..  12  29.......................................SLLLKKGNKEIVVDTGQSE---NFIKNCGLMGIDVGRIKKVVLTHGHYDHIGGLKGLERNPEVKIYTHKEDLSFYEKYKNNFVLIDKDAEIEEGFIPDKFLDEVFVVVKEEDGINVVTGCSHA-GILNILETARNRFGVSYIKSL----------IGGFHLRGMEEEKVKDIARKIEEYGVKKVLTGHCTGIDEYGFLKSV................................ 262
73 -19.5004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDO  ali model follow..  13  3.......................IVVKNNIHWVGQRD-NSYLIREEK-NVLIDTVDHKFSREFVQNLRNE-IDLADIDYIVINHAEEDHAGALTELMAQIDTPIYCTANAIDSINGPEWN-----------------NVVKTGDTLDIGN-QLIFVETP-HWPDSMMTYLTGDA------VLFSNDAEHLFNDEVDQTELFEQCQRYYTPKITEILGLPVDMIATSHGNPTQIVELYLKADYQEDRITIFYDTMSNNTRMMADAIAQGIAET 275
74 -18.7002az4_A mol:protein length:429 hypothetical protein EF2904  ali model follow..  10  3.................SKAKTTVTFHSGILTIG----TVIEVAYKDAHIFFDFGTEFRPELLVPELKDL--KDYQHTAVFLSHAHLDHSRMINYLDP--AVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMILNKNDVIKVGEISVEIVPVDHDAYGASALLIRTPDH----FITYTGD--------LRLHGHNREETLAFCEKAKHTELLMME---------VSISFPEREPDPAQIAVVSEEDLVQHLVRLELENPNRQI... 256
75 -18.7002i7t_A mol:protein length:459 Cleavage and polyadenylation specificity fact  ali model follow..  11  13............................LIRPLGEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSGRTFMTHATKAIYRSNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHA-GHVLGAAMFMIEIAG----VKLLYTGDFSRQEDRHLMAAEIPEEREARFCNTVHDIVNRGGRGLIPVFALGRALDEYWQNHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDK 292

FFAS is supported by the NIH grant R01-GM087218-01
1 0 8 9 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.